F474792

General Info

Members Datasets Scaffolds Average Seq Length
680 374 1360 260

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0022644|Ga0439448_0022644_365_1117
Length 250
Sequence MSGNPIIRLNGARTLFYKEVLRFWKVSFQTVAAPVLTAVLYLLIFGHVLENRVKVYDNVGYTSFLIPGLVMMSVLQNAFANSSSSLIQSKITGNLVFLLVTPLSHWAWFLAYVGASLVRGLAVGLGVFAVTAWFAPPGFALLGAGMLGSLGLIAGLWAEKFDQMAAFQNFIIVPMTFLSGVFYSVHSLPPFWQGVSHLNPFFYMIDGFRRGFFGVSDVSPWLSLSVVATSFVLVSAIALRLLKTGYKLRH

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
160 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
211 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
214 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
217 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
218 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
222 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
223 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
224 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
285 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
286 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
299 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
300 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
301 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
302 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
303 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
304 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
307 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
308 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
309 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
310 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
311 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
327 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
328 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
333 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
334 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
335 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
336 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
337 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
338 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
339 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
340 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
341 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
342 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
343 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
344 2643221569 Achromobacter sp. Root565 Isolate Unclassified
345 2643221585 Pelomonas sp. Root662 Isolate Unclassified
346 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
347 2643221594 Achromobacter sp. Root170 Isolate Unclassified
348 2643221621 Achromobacter sp. Root83 Isolate Unclassified
349 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
350 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
351 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
352 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
353 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
354 2643221656 Pelomonas sp. Root405 Isolate Unclassified
355 2643221660 Methylibium sp. Root1272 Isolate Unclassified
356 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
357 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
358 2842733646 Variovorax sp. R-72446 Isolate Unclassified
359 2855730933 Achromobacter sp. HZ28 Isolate Nodule
360 2855767633 Achromobacter sp. HZ34 Isolate Nodule
361 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
362 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
363 2858950400 Achromobacter sp. K91 Isolate Unclassified
364 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
365 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
366 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
367 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
368 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
369 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
370 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
371 2941479691
372 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
373 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
374 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 0
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.71
Nodule 0.59
Rhizoplane 2.35
Rhizosphere 70.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0022644 3300042005 Bacteria 1955
2 JGI25156J39149_1016063 3300002705 Bacteria 1472
3 JGI25152J39213_1000516 3300002773 Bacteria 21501
4 JGI25150J39212_1009378 3300002774 Bacteria 1867
5 JGI25151J46595_10000121 3300003187 Bacteria 106308
6 JGI25153J46596_10000543 3300003215 Bacteria 23510
7 JGI25153J46596_10005712 3300003215 Bacteria 6487
8 rootH2_10002268 3300003320 Bacteria 2287
9 Ga0055535_1000618 3300003761 Bacteria 28963
10 Ga0055529_1000053 3300003763 Bacteria 198996
11 Ga0055529_1001095 3300003763 Bacteria 12204
12 Ga0055526_1007216 3300003771 Bacteria 5833
13 Ga0055524_1000247 3300003775 Bacteria 56379
14 Ga0055530_10004453 3300003791 Bacteria 7195
15 Ga0055540_1000260 3300003792 Bacteria 47714
16 Ga0055540_1005560 3300003792 Bacteria 5259
17 Ga0055540_1038671 3300003792 Bacteria 1044
18 Ga0055531_10000105 3300003794 Bacteria 91871
19 Ga0055531_10011138 3300003794 Bacteria 4377
20 Ga0065165_1000521 3300005262 Bacteria 58807
21 Ga0065165_1002331 3300005262 Bacteria 16569
22 Ga0070658_10293216 3300005327 Bacteria 1386
23 Ga0070676_10043832 3300005328 Bacteria 2601
24 Ga0070676_10297556 3300005328 Bacteria 1093
25 Ga0070683_100460717 3300005329 Bacteria 1213
26 Ga0070690_100097048 3300005330 Bacteria 1949
27 Ga0070670_100010621 3300005331 Bacteria 7865
28 Ga0070670_100380408 3300005331 Bacteria 1244
29 Ga0070677_10000741 3300005333 Bacteria 10908
30 Ga0070677_10131373 3300005333 Bacteria 1143
31 Ga0068869_100190965 3300005334 Bacteria 1610
32 Ga0070666_10375841 3300005335 Bacteria 1019
33 Ga0068868_100002184 3300005338 Bacteria 13491
34 Ga0068868_100022204 3300005338 Bacteria 4788
35 Ga0068868_100077659 3300005338 Bacteria 2656
36 Ga0068868_100257875 3300005338 Bacteria 1469
37 Ga0070689_100154089 3300005340 Bacteria 1855
38 Ga0070687_100087950 3300005343 Bacteria 1712
39 Ga0070661_100000361 3300005344 Bacteria 35932
40 Ga0070661_100045911 3300005344 Bacteria 3194
41 Ga0070668_100232233 3300005347 Bacteria 1525
42 Ga0070669_100025458 3300005353 Bacteria 4250
43 Ga0070675_100000345 3300005354 Bacteria 31378
44 Ga0070675_100005881 3300005354 Bacteria 9399
45 Ga0070675_100066125 3300005354 Bacteria 2989
46 Ga0070675_100160050 3300005354 Bacteria 1935
47 Ga0070675_100352375 3300005354 Bacteria 1305
48 Ga0070675_100607702 3300005354 Bacteria 992
49 Ga0070671_100001168 3300005355 Bacteria 19603
50 Ga0070671_100006977 3300005355 Bacteria 9047
51 Ga0070671_100037374 3300005355 Bacteria 4026
52 Ga0070671_100062581 3300005355 Bacteria 3098
53 Ga0070671_100137745 3300005355 Bacteria 2058
54 Ga0070671_100255293 3300005355 Bacteria 1489
55 Ga0070671_100427027 3300005355 Bacteria 1135
56 Ga0070674_100003690 3300005356 Bacteria 8625
57 Ga0070674_100026418 3300005356 Bacteria 3792
58 Ga0070674_100029445 3300005356 Bacteria 3617
59 Ga0070674_100181127 3300005356 Bacteria 1614
60 Ga0070674_100313785 3300005356 Bacteria 1254
61 Ga0070673_100011217 3300005364 Bacteria 6111
62 Ga0070673_100048015 3300005364 Bacteria 3325
63 Ga0070673_100092831 3300005364 Bacteria 2470
64 Ga0070673_100465855 3300005364 Bacteria 1138
65 Ga0070688_100104820 3300005365 Bacteria 1871
66 Ga0070659_100001606 3300005366 Bacteria 16262
67 Ga0070667_100515932 3300005367 Bacteria 1096
68 Ga0070701_10301101 3300005438 Bacteria 986
69 Ga0070700_100015225 3300005441 Bacteria 4358
70 Ga0070694_100022166 3300005444 Bacteria 4067
71 Ga0070663_100000113 3300005455 Bacteria 37716
72 Ga0070663_100141706 3300005455 Bacteria 1836
73 Ga0070663_100362828 3300005455 Bacteria 1175
74 Ga0070678_100045152 3300005456 Bacteria 3150
75 Ga0070678_100061182 3300005456 Bacteria 2774
76 Ga0070678_100103672 3300005456 Bacteria 2210
77 Ga0070678_100206299 3300005456 Bacteria 1625
78 Ga0070678_100243295 3300005456 Bacteria 1505
79 Ga0070678_100293416 3300005456 Bacteria 1379
80 Ga0070678_100505917 3300005456 Bacteria 1066
81 Ga0070662_100092313 3300005457 Bacteria 2275
82 Ga0070662_100212958 3300005457 Bacteria 1538
83 Ga0068867_100039987 3300005459 Bacteria 3420
84 Ga0068867_100042155 3300005459 Bacteria 3337
85 Ga0068867_100051624 3300005459 Bacteria 3033
86 Ga0068867_100152324 3300005459 Bacteria 1817
87 Ga0068867_100464269 3300005459 Bacteria 1081
88 Ga0070706_100259897 3300005467 Bacteria 1621
89 Ga0068853_100066195 3300005539 Bacteria 3138
90 Ga0068853_100296793 3300005539 Bacteria 1493
91 Ga0070672_100000229 3300005543 Bacteria 31255
92 Ga0070672_100007945 3300005543 Bacteria 7248
93 Ga0070672_100033131 3300005543 Bacteria 3909
94 Ga0070672_100077310 3300005543 Bacteria 2661
95 Ga0070672_100083064 3300005543 Bacteria 2570
96 Ga0070672_100123786 3300005543 Bacteria 2119
97 Ga0070672_100127409 3300005543 Bacteria 2089
98 Ga0070672_100178702 3300005543 Bacteria 1768
99 Ga0070672_100461019 3300005543 Bacteria 1095
100 Ga0070695_100006828 3300005545 Bacteria 6757
101 Ga0070696_100470642 3300005546 Bacteria 995
102 Ga0070665_100008299 3300005548 Bacteria 10502
103 Ga0070665_100110937 3300005548 Bacteria 2745
104 Ga0068855_100037002 3300005563 Bacteria 5807
105 Ga0068855_100074829 3300005563 Bacteria 3933
106 Ga0068855_100257578 3300005563 Bacteria 1944
107 Ga0068855_100263794 3300005563 Bacteria 1918
108 Ga0070664_100001095 3300005564 Bacteria 21389
109 Ga0070664_100468852 3300005564 Bacteria 1158
110 Ga0070664_100526544 3300005564 Bacteria 1091
111 Ga0068854_100246202 3300005578 Bacteria 1425
112 Ga0068856_100846951 3300005614 Bacteria 933
113 Ga0068852_100060346 3300005616 Bacteria 3292
114 Ga0068852_100130740 3300005616 Bacteria 2312
115 Ga0068852_100418408 3300005616 Bacteria 1321
116 Ga0068852_100805575 3300005616 Bacteria 953
117 Ga0068859_100016893 3300005617 Bacteria 7325
118 Ga0068859_100193649 3300005617 Bacteria 2117
119 Ga0068864_100001954 3300005618 Bacteria 16951
120 Ga0068864_100003420 3300005618 Bacteria 13128
121 Ga0068864_100084362 3300005618 Bacteria 2791
122 Ga0068864_100085934 3300005618 Bacteria 2767
123 Ga0068864_100095719 3300005618 Bacteria 2626
124 Ga0068864_100266993 3300005618 Bacteria 1593
125 Ga0068861_100184381 3300005719 Bacteria 1739
126 Ga0068851_10089650 3300005834 Bacteria 1618
127 Ga0068870_10024913 3300005840 Bacteria 2965
128 Ga0068863_100002555 3300005841 Bacteria 18065
129 Ga0068863_100343394 3300005841 Bacteria 1452
130 Ga0068863_100389602 3300005841 Bacteria 1361
131 Ga0068863_100802714 3300005841 Bacteria 939
132 Ga0068858_100003018 3300005842 Bacteria 16882
133 Ga0068858_100221385 3300005842 Bacteria 1792
134 Ga0068860_100177313 3300005843 Bacteria 2059
135 Ga0068862_100015164 3300005844 Bacteria 6400
136 Ga0068862_100072879 3300005844 Bacteria 2967
137 Ga0075368_10002096 3300006042 Bacteria 6443
138 Ga0075363_100007907 3300006048 Bacteria 4923
139 Ga0075363_100036439 3300006048 Bacteria 2580
140 Ga0075364_10000064 3300006051 Bacteria 40534
141 Ga0075364_10020412 3300006051 Bacteria 4166
142 Ga0075362_10014630 3300006177 Bacteria 3171
143 Ga0075362_10154514 3300006177 Bacteria 1102
144 Ga0075367_10013598 3300006178 Bacteria 4381
145 Ga0075366_10005804 3300006195 Bacteria 6704
146 Ga0075366_10016366 3300006195 Bacteria 4262
147 Ga0075366_10018370 3300006195 Bacteria 4036
148 Ga0075366_10034296 3300006195 Bacteria 2988
149 Ga0075366_10034591 3300006195 Bacteria 2976
150 Ga0075366_10055744 3300006195 Bacteria 2347
151 Ga0075366_10084801 3300006195 Bacteria 1894
152 Ga0075366_10207229 3300006195 Bacteria 1193
153 Ga0075366_10218308 3300006195 Bacteria 1161
154 Ga0097621_100082815 3300006237 Bacteria 2672
155 Ga0097621_100264535 3300006237 Bacteria 1510
156 Ga0097621_100619378 3300006237 Bacteria 991
157 Ga0075370_10000133 3300006353 Bacteria 24995
158 Ga0075370_10001450 3300006353 Bacteria 10303
159 Ga0075370_10004793 3300006353 Bacteria 6624
160 Ga0075370_10010590 3300006353 Bacteria 4828
161 Ga0075370_10013745 3300006353 Bacteria 4308
162 Ga0075370_10061761 3300006353 Bacteria 2134
163 Ga0075370_10167909 3300006353 Bacteria 1289
164 Ga0068871_100051059 3300006358 Bacteria 3347
165 Ga0068871_100140339 3300006358 Bacteria 2054
166 Ga0068871_100191824 3300006358 Bacteria 1760
167 Ga0075430_100120727 3300006846 Bacteria 2185
168 Ga0075433_10333635 3300006852 Bacteria 1341
169 Ga0075429_100005760 3300006880 Bacteria 10698
170 Ga0068865_100078479 3300006881 Bacteria 2362
171 Ga0068865_100197302 3300006881 Bacteria 1560
172 Ga0097620_100016893 3300006931 Bacteria 7325
173 Ga0097620_100193659 3300006931 Bacteria 2117
174 Ga0079104_1000711 3300006946 Bacteria 30224
175 Ga0105244_10038976 3300009036 Bacteria 2476
176 Ga0105245_10295752 3300009098 Bacteria 1587
177 Ga0105245_10376253 3300009098 Bacteria 1413
178 Ga0114129_10215733 3300009147 Bacteria 2591
179 Ga0105243_10041618 3300009148 Bacteria 3593
180 Ga0105243_10064760 3300009148 Bacteria 2934
181 Ga0105243_10079507 3300009148 Bacteria 2673
182 Ga0105242_10040441 3300009176 Bacteria 3757
183 Ga0105242_10436922 3300009176 Bacteria 1230
184 Ga0105242_10470836 3300009176 Bacteria 1188
185 Ga0105248_10004052 3300009177 Bacteria 16195
186 Ga0105248_10166922 3300009177 Bacteria 2481
187 Ga0105248_10899838 3300009177 Bacteria 999
188 Ga0105248_10979104 3300009177 Bacteria 955
189 Ga0105238_10041318 3300009551 Bacteria 4670
190 Ga0105249_10033740 3300009553 Bacteria 4635
191 Ga0105249_10468261 3300009553 Bacteria 1301
192 Ga0157374_10060726 3300013296 Bacteria 3538
193 Ga0157374_10071555 3300013296 Bacteria 3270
194 Ga0157374_10077294 3300013296 Bacteria 3150
195 Ga0157374_10133827 3300013296 Bacteria 2401
196 Ga0157374_10544521 3300013296 Bacteria 1168
197 Ga0157378_10097588 3300013297 Bacteria 2678
198 Ga0157378_10174826 3300013297 Bacteria 2016
199 Ga0163162_10059242 3300013306 Bacteria 3861
200 Ga0163162_10198545 3300013306 Bacteria 2134
201 Ga0157375_10009144 3300013308 Bacteria 8683
202 Ga0157375_10161725 3300013308 Bacteria 2381
203 Ga0157375_10264666 3300013308 Bacteria 1881
204 Ga0163163_10039345 3300014325 Bacteria 4615
205 Ga0163163_10331363 3300014325 Bacteria 1577
206 Ga0163163_10986658 3300014325 Bacteria 906
207 Ga0157380_10065129 3300014326 Bacteria 2928
208 Ga0182008_10001633 3300014497 Bacteria 14849
209 Ga0157379_10016771 3300014968 Bacteria 6446
210 Ga0157376_10210490 3300014969 Bacteria 1795
211 Ga0182007_10003809 3300015262 Bacteria 7024
212 Ga0163161_10001851 3300017792 Bacteria 15456
213 Ga0163161_10126584 3300017792 Bacteria 1924
214 Ga0163161_10471997 3300017792 Bacteria 1017
215 Ga0213872_10001003 3300021361 Bacteria 19713
216 Ga0213872_10017110 3300021361 Bacteria 3356
217 Ga0213872_10083421 3300021361 Bacteria 1434
218 Ga0209258_100074 3300025242 Bacteria 271062
219 Ga0207425_1000426 3300025245 Bacteria 28024
220 Ga0209759_1000909 3300025256 Bacteria 21990
221 Ga0209129_1000269 3300025258 Bacteria 51170
222 Ga0209455_1000066 3300025272 Bacteria 316811
223 Ga0209455_1000447 3300025272 Bacteria 31733
224 Ga0209673_1002449 3300025273 Bacteria 12865
225 Ga0209673_1006112 3300025273 Bacteria 5905
226 Ga0209676_1006101 3300025292 Bacteria 6052
227 Ga0209025_1000019 3300025294 Bacteria 631548
228 Ga0209564_1000300 3300025295 Bacteria 98386
229 Ga0209758_1000453 3300025297 Bacteria 68482
230 Ga0209758_1000605 3300025297 Bacteria 55552
231 Ga0209050_1000770 3300025298 Bacteria 46024
232 Ga0209050_1003148 3300025298 Bacteria 12579
233 Ga0209050_1009610 3300025298 Bacteria 4920
234 Ga0209256_1000049 3300025299 Bacteria 310696
235 Ga0209051_1000247 3300025303 Bacteria 91122
236 Ga0209051_1003582 3300025303 Bacteria 10098
237 Ga0209051_1010607 3300025303 Bacteria 4629
238 Ga0209051_1014684 3300025303 Bacteria 3641
239 Ga0209051_1034612 3300025303 Bacteria 1891
240 Ga0209257_1000047 3300025304 Bacteria 460507
241 Ga0209257_1000141 3300025304 Bacteria 201130
242 Ga0209257_1008855 3300025304 Bacteria 5557
243 Ga0207697_10020000 3300025315 Bacteria 2742
244 Ga0207656_10053271 3300025321 Bacteria 1755
245 Ga0207656_10054319 3300025321 Bacteria 1741
246 Ga0207682_10001493 3300025893 Bacteria 10802
247 Ga0207682_10018894 3300025893 Bacteria 2697
248 Ga0207682_10026689 3300025893 Bacteria 2297
249 Ga0207642_10185226 3300025899 Bacteria 1138
250 Ga0207645_10018015 3300025907 Bacteria 4656
251 Ga0207645_10045823 3300025907 Bacteria 2794
252 Ga0207645_10147664 3300025907 Bacteria 1533
253 Ga0207643_10013289 3300025908 Bacteria 4455
254 Ga0207705_10195193 3300025909 Bacteria 1532
255 Ga0207684_10401818 3300025910 Bacteria 1178
256 Ga0207662_10042029 3300025918 Bacteria 2693
257 Ga0207657_10082993 3300025919 Bacteria 2689
258 Ga0207649_10000335 3300025920 Bacteria 35710
259 Ga0207649_10360688 3300025920 Bacteria 1078
260 Ga0207681_10031313 3300025923 Bacteria 3473
261 Ga0207681_10149690 3300025923 Bacteria 1747
262 Ga0207681_10527783 3300025923 Bacteria 969
263 Ga0207694_10023193 3300025924 Bacteria 4712
264 Ga0207650_10000230 3300025925 Bacteria 62576
265 Ga0207650_10007627 3300025925 Bacteria 7370
266 Ga0207650_10009807 3300025925 Bacteria 6548
267 Ga0207650_10109025 3300025925 Bacteria 2141
268 Ga0207650_10233462 3300025925 Bacteria 1484
269 Ga0207659_10006351 3300025926 Bacteria 7237
270 Ga0207659_10039115 3300025926 Bacteria 3304
271 Ga0207659_10562769 3300025926 Bacteria 970
272 Ga0207687_10014332 3300025927 Bacteria 5187
273 Ga0207687_10051884 3300025927 Bacteria 2860
274 Ga0207687_10188673 3300025927 Bacteria 1603
275 Ga0207644_10006307 3300025931 Bacteria 7723
276 Ga0207644_10012592 3300025931 Bacteria 5622
277 Ga0207644_10051464 3300025931 Bacteria 2956
278 Ga0207644_10071322 3300025931 Bacteria 2541
279 Ga0207644_10166785 3300025931 Bacteria 1716
280 Ga0207644_10345904 3300025931 Bacteria 1206
281 Ga0207690_10000176 3300025932 Bacteria 49560
282 Ga0207706_10004610 3300025933 Bacteria 12933
283 Ga0207706_10227064 3300025933 Bacteria 1634
284 Ga0207706_10369066 3300025933 Bacteria 1246
285 Ga0207686_10038520 3300025934 Bacteria 2893
286 Ga0207709_10042931 3300025935 Bacteria 2723
287 Ga0207709_10315696 3300025935 Bacteria 1168
288 Ga0207670_10015720 3300025936 Bacteria 4529
289 Ga0207669_10008524 3300025937 Bacteria 4819
290 Ga0207669_10109822 3300025937 Bacteria 1845
291 Ga0207669_10129968 3300025937 Bacteria 1728
292 Ga0207704_10050520 3300025938 Bacteria 2509
293 Ga0207704_10061517 3300025938 Bacteria 2329
294 Ga0207691_10000681 3300025940 Bacteria 33590
295 Ga0207691_10012349 3300025940 Bacteria 8186
296 Ga0207691_10059728 3300025940 Bacteria 3466
297 Ga0207691_10300713 3300025940 Bacteria 1379
298 Ga0207711_10016311 3300025941 Bacteria 6171
299 Ga0207711_10090689 3300025941 Bacteria 2687
300 Ga0207711_10134673 3300025941 Bacteria 2218
301 Ga0207689_10006365 3300025942 Bacteria 10455
302 Ga0207679_10000168 3300025945 Bacteria 54187
303 Ga0207679_10117672 3300025945 Bacteria 2109
304 Ga0207679_10224739 3300025945 Bacteria 1581
305 Ga0207667_10057815 3300025949 Bacteria 4069
306 Ga0207667_10061276 3300025949 Bacteria 3936
307 Ga0207667_10329679 3300025949 Bacteria 1558
308 Ga0207667_10395546 3300025949 Bacteria 1407
309 Ga0207651_10037610 3300025960 Bacteria 3172
310 Ga0207651_10136651 3300025960 Bacteria 1886
311 Ga0207651_10280827 3300025960 Bacteria 1376
312 Ga0207712_10031683 3300025961 Bacteria 3563
313 Ga0207712_10212147 3300025961 Bacteria 1543
314 Ga0207668_10221587 3300025972 Bacteria 1519
315 Ga0207640_10134770 3300025981 Bacteria 1791
316 Ga0207658_10025833 3300025986 Bacteria 4113
317 Ga0207658_10031284 3300025986 Bacteria 3777
318 Ga0207658_10142722 3300025986 Bacteria 1940
319 Ga0207677_10015578 3300026023 Bacteria 4477
320 Ga0207677_10103338 3300026023 Bacteria 2103
321 Ga0207703_10012819 3300026035 Bacteria 6536
322 Ga0207703_10624673 3300026035 Bacteria 1020
323 Ga0207639_10024959 3300026041 Bacteria 4331
324 Ga0207639_10269695 3300026041 Bacteria 1492
325 Ga0207678_10034429 3300026067 Bacteria 4411
326 Ga0207708_10022695 3300026075 Bacteria 4739
327 Ga0207641_10083955 3300026088 Bacteria 2771
328 Ga0207641_10113960 3300026088 Bacteria 2401
329 Ga0207641_10380090 3300026088 Bacteria 1352
330 Ga0207641_10603217 3300026088 Bacteria 1075
331 Ga0207648_10024898 3300026089 Bacteria 5337
332 Ga0207648_10050744 3300026089 Bacteria 3627
333 Ga0207648_10077174 3300026089 Bacteria 2904
334 Ga0207676_10001953 3300026095 Bacteria 15029
335 Ga0207676_10112721 3300026095 Bacteria 2279
336 Ga0207676_10119757 3300026095 Bacteria 2217
337 Ga0207676_10126745 3300026095 Bacteria 2163
338 Ga0207676_10315668 3300026095 Bacteria 1432
339 Ga0207674_10010750 3300026116 Bacteria 10333
340 Ga0207675_100008514 3300026118 Bacteria 9650
341 Ga0207683_10006633 3300026121 Bacteria 9904
342 Ga0207683_10409194 3300026121 Bacteria 1248
343 Ga0207698_10043913 3300026142 Bacteria 3353
344 Ga0207698_10076176 3300026142 Bacteria 2684
345 Ga0207698_10106125 3300026142 Bacteria 2342
346 Ga0207698_10125036 3300026142 Bacteria 2185
347 Ga0207698_10353264 3300026142 Bacteria 1389
348 Ga0207698_10368060 3300026142 Bacteria 1363
349 Ga0209281_1000395 3300027111 Bacteria 67983
350 Ga0209996_1001152 3300027395 Bacteria 3169
351 Ga0209995_1004071 3300027471 Bacteria 2334
352 Ga0209968_1000428 3300027526 Bacteria 6838
353 Ga0209966_1000008 3300027695 Bacteria 88938
354 Ga0209998_10005832 3300027717 Bacteria 2564
355 Ga0209813_10050727 3300027866 Bacteria 1296
356 Ga0209974_10114282 3300027876 Bacteria 952
357 Ga0268266_10656411 3300028379 Bacteria 1010
358 Ga0268266_10769069 3300028379 Bacteria 930
359 Ga0268265_10222213 3300028380 Bacteria 1653
360 Ga0265336_10000024 3300028666 Bacteria 188787
361 Ga0307517_10005635 3300028786 Bacteria 18785
362 Ga0307517_10098192 3300028786 Bacteria 2332
363 Ga0307515_10000011 3300028794 Bacteria 633903
364 Ga0307515_10000084 3300028794 Bacteria 221434
365 Ga0307515_10000382 3300028794 Bacteria 107907
366 Ga0307515_10020861 3300028794 Bacteria 11649
367 Ga0307515_10030153 3300028794 Bacteria 9126
368 Ga0307515_10073520 3300028794 Bacteria 4593
369 Ga0265324_10001883 3300029957 Bacteria 11301
370 Ga0268256_1026036 3300030500 Bacteria 1477
371 Ga0307511_10155354 3300030521 Bacteria 1300
372 Ga0307512_10209709 3300030522 Bacteria 1038
373 Ga0265332_10082005 3300031238 Bacteria 1368
374 Ga0265328_10000252 3300031239 Bacteria 24700
375 Ga0265329_10026703 3300031242 Bacteria 1901
376 Ga0265331_10000050 3300031250 Bacteria 181286
377 Ga0265327_10000109 3300031251 Bacteria 181275
378 Ga0265327_10000789 3300031251 Bacteria 48791
379 Ga0265327_10019962 3300031251 Bacteria 4101
380 Ga0307513_10002473 3300031456 Bacteria 25565
381 Ga0307513_10026225 3300031456 Bacteria 6725
382 Ga0307513_10071479 3300031456 Bacteria 3621
383 Ga0307509_10000063 3300031507 Bacteria 143708
384 Ga0307509_10040214 3300031507 Bacteria 5086
385 Ga0307509_10177792 3300031507 Bacteria 1998
386 Ga0307408_100000029 3300031548 Bacteria 227806
387 Ga0307408_100226249 3300031548 Bacteria 1529
388 Ga0307508_10000109 3300031616 Bacteria 97316
389 Ga0307508_10005254 3300031616 Bacteria 12357
390 Ga0307508_10201116 3300031616 Bacteria 1593
391 Ga0307514_10000954 3300031649 Bacteria 43472
392 Ga0307514_10010207 3300031649 Bacteria 7861
393 Ga0307514_10029981 3300031649 Bacteria 4369
394 Ga0307514_10077236 3300031649 Bacteria 2477
395 Ga0265314_10017068 3300031711 Bacteria 5707
396 Ga0307516_10000676 3300031730 Bacteria 46208
397 Ga0307516_10001245 3300031730 Bacteria 35441
398 Ga0307516_10031563 3300031730 Bacteria 5340
399 Ga0307516_10095680 3300031730 Bacteria 2792
400 Ga0307516_10179339 3300031730 Bacteria 1853
401 Ga0307413_10083624 3300031824 Bacteria 2054
402 Ga0307410_10022243 3300031852 Bacteria 3915
403 Ga0307406_10007608 3300031901 Bacteria 6016
404 Ga0307406_10183872 3300031901 Bacteria 1524
405 Ga0307412_10000061 3300031911 Bacteria 126274
406 Ga0307412_10036594 3300031911 Bacteria 3146
407 Ga0307412_10239149 3300031911 Bacteria 1403
408 Ga0307412_10551713 3300031911 Bacteria 968
409 Ga0307416_100059775 3300032002 Bacteria 3099
410 Ga0307416_100537383 3300032002 Bacteria 1240
411 Ga0307411_10144890 3300032005 Bacteria 1757
412 Ga0307415_100112331 3300032126 Bacteria 2024
413 Ga0307507_10209700 3300033179 Bacteria 1331
414 Ga0307510_10004418 3300033180 Bacteria 16555
415 Ga0307510_10017213 3300033180 Bacteria 8527
416 Ga0373940_0016864 3300035088 Bacteria 1814
417 Ga0373939_0000012 3300035114 Bacteria 67223
418 Ga0373960_0000218 3300035121 Bacteria 10541
419 Ga0373961_0004072 3300035241 Bacteria 3559
420 Ga0373931_0002689 3300035691 Bacteria 7910
421 Ga0373935_0492792 3300035692 Bacteria 889
422 Ga0373937_0630638 3300036401 Bacteria 1017
423 Ga0373925_0155437 3300037068 Bacteria 1798
424 Ga0395900_0000183 3300037418 Bacteria 100749
425 Ga0395900_0027656 3300037418 Bacteria 5809
426 Ga0395900_0079101 3300037418 Bacteria 3378
427 Ga0395898_0001293 3300037466 Bacteria 36684
428 Ga0395898_0112304 3300037466 Bacteria 2612
429 Ga0395898_0152268 3300037466 Bacteria 2212
430 Ga0395905_0000027 3300037471 Bacteria 297239
431 Ga0395905_0002201 3300037471 Bacteria 22018
432 Ga0395905_0027641 3300037471 Bacteria 5350
433 Ga0395905_0074018 3300037471 Bacteria 3192
434 Ga0395905_0250170 3300037471 Bacteria 1655
435 Ga0395905_0458190 3300037471 Bacteria 1173
436 Ga0436361_0039667 3300039447 Bacteria 5314
437 Ga0436361_0110525 3300039447 Bacteria 45343
438 Ga0439436_0001048 3300041404 Bacteria 7765
439 Ga0439447_023051 3300041407 Bacteria 1625
440 Ga0439466_0004086 3300041411 Bacteria 5638
441 Ga0439465_0040301 3300041413 Bacteria 1509
442 Ga0451793_0140833 3300041452 Bacteria 1415
443 Ga0451800_1581513 3300041459 Bacteria 2092
444 Ga0439431_0000483 3300041997 Bacteria 8459
445 Ga0439431_0005469 3300041997 Bacteria 2805
446 Ga0439433_0002772 3300041999 Bacteria 3733
447 Ga0439442_024130 3300042002 Bacteria 1264
448 Ga0439445_0059399 3300042004 Bacteria 1043
449 Ga0439432_001040 3300042006 Bacteria 10528
450 Ga0439449_0001389 3300042007 Bacteria 9472
451 Ga0439449_0032823 3300042007 Bacteria 1934
452 Ga0450888_001081 3300042126 Bacteria 2579
453 Ga0450891_002454 3300042129 Bacteria 1867
454 Ga0450892_003377 3300042130 Bacteria 1311
455 Ga0450889_002584 3300042144 Bacteria 1796
456 Ga0439434_0024175 3300042435 Bacteria 1832
457 Ga0450893_0032148 3300042532 Bacteria 939
458 Ga0451577_0000270 3300042876 Bacteria 101581
459 Ga0451577_0003233 3300042876 Bacteria 18316
460 Ga0451577_0008906 3300042876 Bacteria 9714
461 Ga0451577_0076840 3300042876 Bacteria 2977
462 Ga0451577_0394457 3300042876 Bacteria 1256
463 Ga0466969_0000020 3300044656 Bacteria 101861
464 Ga0466969_0189657 3300044656 Bacteria 939
465 Ga0466965_0043431 3300044683 Bacteria 2219
466 Ga0466965_0145957 3300044683 Bacteria 1234
467 Ga0466966_0007572 3300044684 Bacteria 7193
468 Ga0466966_0013049 3300044684 Bacteria 5500
469 Ga0466966_0145052 3300044684 Bacteria 1449
470 Ga0466961_0027938 3300044693 Bacteria 3627
471 Ga0466961_0029661 3300044693 Bacteria 3514
472 Ga0466963_0301687 3300044694 Bacteria 1126
473 Ga0466964_0021846 3300044706 Bacteria 2477
474 Ga0453684_0000868 3300044712 Bacteria 101512
475 Ga0453684_0018604 3300044712 Bacteria 10651
476 Ga0453684_0133946 3300044712 Bacteria 2970
477 Ga0453684_0214160 3300044712 Bacteria 2237
478 Ga0453684_0366101 3300044712 Bacteria 1622
479 Ga0466968_0006113 3300044735 Bacteria 4523
480 Ga0466970_0030545 3300044765 Bacteria 2841
481 Ga0466970_0031448 3300044765 Bacteria 2803
482 Ga0466957_0142010 3300044842 Bacteria 1547
483 Ga0466960_0012273 3300044901 Bacteria 3611
484 Ga0466960_0078188 3300044901 Bacteria 1660
485 Ga0466959_0000210 3300045049 Bacteria 37745
486 Ga0466959_0068705 3300045049 Bacteria 2567
487 Ga0466959_0163203 3300045049 Bacteria 1565
488 Ga0451576_0004748 3300045051 Bacteria 17449
489 Ga0451576_0047445 3300045051 Bacteria 4516
490 Ga0451576_0100852 3300045051 Bacteria 3002
491 Ga0451576_0240622 3300045051 Bacteria 1891
492 Ga0451576_0877205 3300045051 Bacteria 942
493 Ga0495592_0006972 3300046454 Bacteria 8442
494 Ga0495590_0042912 3300046457 Bacteria 1577
495 Ga0495650_0024628 3300046471 Bacteria 2839
496 Ga0495639_0023242 3300046475 Bacteria 2723
497 Ga0495583_0000034 3300046506 Bacteria 246856
498 Ga0495606_0001225 3300046507 Bacteria 35933
499 Ga0495606_0121912 3300046507 Bacteria 1560
500 Ga0495630_0364834 3300046517 Bacteria 1106
501 Ga0495621_0013028 3300046539 Bacteria 2606
502 Ga0495645_0073438 3300046543 Bacteria 2464
503 Ga0495645_0133854 3300046543 Bacteria 1735
504 Ga0495625_0004651 3300046660 Bacteria 12890
505 Ga0495625_0015665 3300046660 Bacteria 5995
506 Ga0495635_0348180 3300046663 Bacteria 989
507 Ga0495588_0280673 3300046674 Bacteria 878
508 Ga0495646_0047667 3300046680 Bacteria 2607
509 Ga0495658_0075719 3300046683 Bacteria 1965
510 Ga0495669_0022325 3300046684 Bacteria 2749
511 Ga0495624_0036674 3300046690 Bacteria 3159
512 Ga0495649_0000428 3300046694 Bacteria 36408
513 Ga0495589_0002853 3300046794 Bacteria 9567
514 Ga0495674_0290321 3300047319 Bacteria 1338
515 Ga0495676_0007213 3300047321 Bacteria 10196
516 Ga0495686_0023580 3300047472 Bacteria 4057
517 Ga0496100_0009165 3300048903 Bacteria 5553
518 Ga0496101_0004382 3300048904 Bacteria 8872
519 Ga0496102_0006127 3300048905 Bacteria 10246
520 Ga0496104_0269833 3300048907 Bacteria 1614
521 Ga0496106_0007087 3300048909 Bacteria 8285
522 Ga0496108_0036590 3300048911 Bacteria 4085
523 Ga0496108_0125637 3300048911 Bacteria 2202
524 Ga0496108_0317044 3300048911 Bacteria 1359
525 Ga0496109_0009016 3300048912 Bacteria 8498
526 Ga0496110_0057567 3300048913 Bacteria 3422
527 Ga0496111_0071605 3300048914 Bacteria 2523
528 Ga0496112_0004885 3300048915 Bacteria 11462
529 Ga0496114_0194525 3300048917 Bacteria 1775
530 Ga0496116_0022632 3300048919 Bacteria 4704
531 Ga0496116_0024092 3300048919 Bacteria 4510
532 Ga0496117_0009792 3300048920 Bacteria 8836
533 Ga0496117_0069549 3300048920 Bacteria 2370
534 Ga0496118_0011294 3300048921 Bacteria 8735
535 Ga0496118_0018649 3300048921 Bacteria 6241
536 Ga0496119_0028700 3300048922 Bacteria 3790
537 Ga0496120_0004304 3300048923 Bacteria 12065
538 Ga0496121_0000647 3300048924 Bacteria 65033
539 Ga0496121_0010291 3300048924 Bacteria 10581
540 Ga0496122_0000612 3300048925 Bacteria 73307
541 Ga0496122_0003062 3300048925 Bacteria 22564
542 Ga0496122_0022055 3300048925 Bacteria 5673
543 Ga0496123_0000274 3300048926 Bacteria 101783
544 Ga0496123_0002506 3300048926 Bacteria 22588
545 Ga0496124_0000013 3300048927 Bacteria 484884
546 Ga0496124_0000108 3300048927 Bacteria 167473
547 Ga0496124_0048778 3300048927 Bacteria 3615
548 Ga0496124_0196702 3300048927 Bacteria 1537
549 Ga0496125_0000051 3300048928 Bacteria 285754
550 Ga0496125_0004939 3300048928 Bacteria 15088
551 Ga0496125_0014355 3300048928 Bacteria 7717
552 Ga0496125_0272563 3300048928 Bacteria 1053
553 Ga0496126_0008185 3300048929 Bacteria 11309
554 Ga0496126_0015870 3300048929 Bacteria 7563
555 Ga0501297_006242 3300049520 Bacteria 1268
556 Ga0501300_001506 3300049523 Bacteria 3498
557 Ga0501301_002968 3300049524 Bacteria 1148
558 Ga0501031_0055745 3300049568 Bacteria 2575
559 Ga0501032_0010987 3300049569 Bacteria 6509
560 Ga0501033_0000668 3300049570 Bacteria 31668
561 Ga0501033_0069374 3300049570 Bacteria 2591
562 Ga0501033_0098599 3300049570 Bacteria 2134
563 Ga0501033_0111228 3300049570 Bacteria 1993
564 Ga0501034_0005349 3300049571 Bacteria 14062
565 Ga0501034_0061854 3300049571 Bacteria 3759
566 Ga0501036_0001501 3300049572 Bacteria 17997
567 Ga0501037_0004363 3300049573 Bacteria 10269
568 Ga0501037_0192545 3300049573 Bacteria 1443
569 Ga0501038_0058343 3300049574 Bacteria 3309
570 Ga0501038_0114468 3300049574 Bacteria 2231
571 Ga0501043_0000002 3300049579 Bacteria 351081
572 Ga0501046_0000008 3300049580 Bacteria 351167
573 Ga0501046_0001989 3300049580 Bacteria 19418
574 Ga0501047_0000003 3300049581 Bacteria 508375
575 Ga0501047_0018975 3300049581 Bacteria 6596
576 Ga0501047_0076103 3300049581 Bacteria 3230
577 Ga0501048_0001479 3300049582 Bacteria 17811
578 Ga0501048_0106826 3300049582 Bacteria 1976
579 Ga0501198_000024 3300049649 Bacteria 67171
580 Ga0501211_000808 3300049658 Bacteria 3239
581 Ga0501222_000020 3300049662 Bacteria 67164
582 Ga0501222_001766 3300049662 Bacteria 2997
583 Ga0501223_024329 3300049663 Bacteria 1179
584 Ga0501242_010433 3300049674 Bacteria 1109
585 Ga0501221_002605 3300049704 Bacteria 2974
586 Ga0501229_000206 3300049706 Bacteria 6441
587 Ga0501080_0053880 3300049742 Bacteria 3746
588 Ga0501232_000662 3300049757 Bacteria 2413
589 Ga0501262_005503 3300049759 Bacteria 1495
590 Ga0501267_002247 3300049764 Bacteria 1719
591 Ga0501269_001983 3300049766 Bacteria 2581
592 Ga0501274_003754 3300049771 Bacteria 1235
593 Ga0501283_003257 3300049779 Bacteria 2141
594 Ga0501035_0006298 3300049822 Bacteria 11155
595 Ga0501035_0026335 3300049822 Bacteria 5321
596 Ga0501035_0141426 3300049822 Bacteria 2092
597 Ga0501035_0325646 3300049822 Bacteria 1290
598 Ga0501044_0000316 3300049823 Bacteria 61151
599 Ga0501044_0004069 3300049823 Bacteria 16400
600 Ga0501044_0038183 3300049823 Bacteria 5016
601 Ga0501044_0089818 3300049823 Bacteria 3100
602 Ga0501044_0227929 3300049823 Bacteria 1812
603 Ga0501045_0003417 3300049824 Bacteria 10864
604 nmdc:mga03683_68446_c1 3300050489 Bacteria 1513
605 nmdc:mga00v17_18021_c1 3300050491 Bacteria 4007
606 nmdc:mga00v17_29017_c1 3300050491 Bacteria 3244
607 nmdc:mga00v17_69137_c1 3300050491 Bacteria 2185
608 nmdc:mga0k408_20607_c1 3300050493 Bacteria 3696
609 nmdc:mga0k408_22368_c1 3300050493 Bacteria 3560
610 nmdc:mga0k408_26608_c1 3300050493 Bacteria 3281
611 nmdc:mga0k408_31894_c1 3300050493 Bacteria 3011
612 nmdc:mga0k408_6011_c1 3300050493 Bacteria 6476
613 nmdc:mga0k408_64479_c1 3300050493 Bacteria 2132
614 nmdc:mga07m45_154696_c1 3300050496 Bacteria 1330
615 nmdc:mga07m45_2735_c1 3300050496 Bacteria 8313
616 nmdc:mga07m45_4966_c2 3300050496 Bacteria 6170
617 nmdc:mga07m45_5336_c1 3300050496 Bacteria 6395
618 nmdc:mga07m45_5339_c1 3300050496 Bacteria 6394
619 nmdc:mga07m45_69460_c1 3300050496 Bacteria 2003
620 nmdc:mga07m45_847_c1 3300050496 Bacteria 13276
621 nmdc:mga05p37_29102_c1 3300050507 Bacteria 6742
622 nmdc:mga09592_1310_c1 3300050508 Bacteria 19982
623 nmdc:mga0qj67_19500_c1 3300050509 Bacteria 5181
624 nmdc:mga08y16_608942_c1 3300050511 Bacteria 1100
625 nmdc:mga0n895_80145_c1 3300050512 Bacteria 3252
626 nmdc:mga0a205_25032_c1 3300050515 Bacteria 5682
627 Ga0495601_0032309 3300053077 Bacteria 3258
628 Ga0500635_0000008 3300053080 Bacteria 167327
629 Ga0500578_0110065 3300053086 Bacteria 1737
630 Ga0500644_0003424 3300053088 Bacteria 3925
631 Ga0500651_0080058 3300053093 Bacteria 2023
632 Ga0500651_0135077 3300053093 Bacteria 1490
633 Ga0500652_000177 3300053131 Bacteria 24784
634 Ga0500559_0000013 3300053136 Bacteria 163436
635 Ga0500559_0004164 3300053136 Bacteria 6938
636 Ga0500561_0009960 3300053137 Bacteria 1948
637 Ga0500590_077134 3300053148 Bacteria 1644
638 Ga0500600_0009254 3300053149 Bacteria 5942
639 Ga0500622_0004247 3300053156 Bacteria 9113
640 Ga0500622_0019490 3300053156 Bacteria 3602
641 Ga0500622_0100443 3300053156 Bacteria 1425
642 Ga0500570_103326 3300053724 Bacteria 1188
643 Ga0500587_005845 3300053739 Bacteria 1645
644 2587725527 2585428057 Bacteria 6737412
645 2587734995 2585428058 Bacteria 6853932
646 2587758433 2585428062 Bacteria 6842168
647 2588290527 2588253510 Bacteria 6901809
648 2599902783 2599185292 Bacteria 6290804
649 2643743617 2643221544 Bacteria 5886209
650 2643861620 2643221569 Bacteria 6064337
651 2643936616 2643221585 Bacteria 5812563
652 2643970042 2643221592 Bacteria 6608788
653 2643980040 2643221594 Bacteria 5811388
654 2644123614 2643221621 Bacteria 6212786
655 2644142984 2643221625 Bacteria 6512927
656 2644222503 2643221639 Bacteria 6649903
657 2644256651 2643221646 Bacteria 6433402
658 2644271956 2643221648 Bacteria 6521465
659 2644303313 2643221654 Bacteria 5273570
660 2644317972 2643221656 Bacteria 5809961
661 2644341115 2643221660 Bacteria 4208257
662 2739611316 2739367655 Bacteria 4051151
663 2809033123 2808606395 Bacteria 6020352
664 2842736416 2842733646 Bacteria 5716726
665 2855732820 2855730933 Bacteria 7047938
666 2855771572 2855767633 Bacteria 7049357
667 2857542501 2857537821 Bacteria 5248181
668 2857543360 2857542790 Bacteria 5326616
669 2858952208 2858950400 Bacteria 6783797
670 2881415624 2881412998 Bacteria 6492157
671 2881929868 2881927736 Bacteria 3993927
672 2885196990 2885192300 Bacteria 5882526
673 2887376220 2887375801 Bacteria 5334027
674 2895517803 2895511927 Bacteria 6802080
675 2904481547 2904479285 Bacteria 5073931
676 2928118038 2928115317 Bacteria 6477646
677 2941482635
678 8002395896 8002392321 Bacteria 4159911
679 8048747535 8048746797 Bacteria 3557226
680 8055228459 8055225921 Bacteria 3341787
681 Ga0439448_0022644
682 JGI25156J39149_1016063
683 JGI25152J39213_1000516
684 JGI25150J39212_1009378
685 JGI25151J46595_10000121
686 JGI25153J46596_10000543
687 JGI25153J46596_10005712
688 rootH2_10002268
689 Ga0055535_1000618
690 Ga0055529_1000053
691 Ga0055529_1001095
692 Ga0055526_1007216
693 Ga0055524_1000247
694 Ga0055530_10004453
695 Ga0055540_1000260
696 Ga0055540_1005560
697 Ga0055540_1038671
698 Ga0055531_10000105
699 Ga0055531_10011138
700 Ga0065165_1000521
701 Ga0065165_1002331
702 Ga0070658_10293216
703 Ga0070676_10043832
704 Ga0070676_10297556
705 Ga0070683_100460717
706 Ga0070690_100097048
707 Ga0070670_100010621
708 Ga0070670_100380408
709 Ga0070677_10000741
710 Ga0070677_10131373
711 Ga0068869_100190965
712 Ga0070666_10375841
713 Ga0068868_100002184
714 Ga0068868_100022204
715 Ga0068868_100077659
716 Ga0068868_100257875
717 Ga0070689_100154089
718 Ga0070687_100087950
719 Ga0070661_100000361
720 Ga0070661_100045911
721 Ga0070668_100232233
722 Ga0070669_100025458
723 Ga0070675_100000345
724 Ga0070675_100005881
725 Ga0070675_100066125
726 Ga0070675_100160050
727 Ga0070675_100352375
728 Ga0070675_100607702
729 Ga0070671_100001168
730 Ga0070671_100006977
731 Ga0070671_100037374
732 Ga0070671_100062581
733 Ga0070671_100137745
734 Ga0070671_100255293
735 Ga0070671_100427027
736 Ga0070674_100003690
737 Ga0070674_100026418
738 Ga0070674_100029445
739 Ga0070674_100181127
740 Ga0070674_100313785
741 Ga0070673_100011217
742 Ga0070673_100048015
743 Ga0070673_100092831
744 Ga0070673_100465855
745 Ga0070688_100104820
746 Ga0070659_100001606
747 Ga0070667_100515932
748 Ga0070701_10301101
749 Ga0070700_100015225
750 Ga0070694_100022166
751 Ga0070663_100000113
752 Ga0070663_100141706
753 Ga0070663_100362828
754 Ga0070678_100045152
755 Ga0070678_100061182
756 Ga0070678_100103672
757 Ga0070678_100206299
758 Ga0070678_100243295
759 Ga0070678_100293416
760 Ga0070678_100505917
761 Ga0070662_100092313
762 Ga0070662_100212958
763 Ga0068867_100039987
764 Ga0068867_100042155
765 Ga0068867_100051624
766 Ga0068867_100152324
767 Ga0068867_100464269
768 Ga0070706_100259897
769 Ga0068853_100066195
770 Ga0068853_100296793
771 Ga0070672_100000229
772 Ga0070672_100007945
773 Ga0070672_100033131
774 Ga0070672_100077310
775 Ga0070672_100083064
776 Ga0070672_100123786
777 Ga0070672_100127409
778 Ga0070672_100178702
779 Ga0070672_100461019
780 Ga0070695_100006828
781 Ga0070696_100470642
782 Ga0070665_100008299
783 Ga0070665_100110937
784 Ga0068855_100037002
785 Ga0068855_100074829
786 Ga0068855_100257578
787 Ga0068855_100263794
788 Ga0070664_100001095
789 Ga0070664_100468852
790 Ga0070664_100526544
791 Ga0068854_100246202
792 Ga0068856_100846951
793 Ga0068852_100060346
794 Ga0068852_100130740
795 Ga0068852_100418408
796 Ga0068852_100805575
797 Ga0068859_100016893
798 Ga0068859_100193649
799 Ga0068864_100001954
800 Ga0068864_100003420
801 Ga0068864_100084362
802 Ga0068864_100085934
803 Ga0068864_100095719
804 Ga0068864_100266993
805 Ga0068861_100184381
806 Ga0068851_10089650
807 Ga0068870_10024913
808 Ga0068863_100002555
809 Ga0068863_100343394
810 Ga0068863_100389602
811 Ga0068863_100802714
812 Ga0068858_100003018
813 Ga0068858_100221385
814 Ga0068860_100177313
815 Ga0068862_100015164
816 Ga0068862_100072879
817 Ga0075368_10002096
818 Ga0075363_100007907
819 Ga0075363_100036439
820 Ga0075364_10000064
821 Ga0075364_10020412
822 Ga0075362_10014630
823 Ga0075362_10154514
824 Ga0075367_10013598
825 Ga0075366_10005804
826 Ga0075366_10016366
827 Ga0075366_10018370
828 Ga0075366_10034296
829 Ga0075366_10034591
830 Ga0075366_10055744
831 Ga0075366_10084801
832 Ga0075366_10207229
833 Ga0075366_10218308
834 Ga0097621_100082815
835 Ga0097621_100264535
836 Ga0097621_100619378
837 Ga0075370_10000133
838 Ga0075370_10001450
839 Ga0075370_10004793
840 Ga0075370_10010590
841 Ga0075370_10013745
842 Ga0075370_10061761
843 Ga0075370_10167909
844 Ga0068871_100051059
845 Ga0068871_100140339
846 Ga0068871_100191824
847 Ga0075430_100120727
848 Ga0075433_10333635
849 Ga0075429_100005760
850 Ga0068865_100078479
851 Ga0068865_100197302
852 Ga0097620_100016893
853 Ga0097620_100193659
854 Ga0079104_1000711
855 Ga0105244_10038976
856 Ga0105245_10295752
857 Ga0105245_10376253
858 Ga0114129_10215733
859 Ga0105243_10041618
860 Ga0105243_10064760
861 Ga0105243_10079507
862 Ga0105242_10040441
863 Ga0105242_10436922
864 Ga0105242_10470836
865 Ga0105248_10004052
866 Ga0105248_10166922
867 Ga0105248_10899838
868 Ga0105248_10979104
869 Ga0105238_10041318
870 Ga0105249_10033740
871 Ga0105249_10468261
872 Ga0157374_10060726
873 Ga0157374_10071555
874 Ga0157374_10077294
875 Ga0157374_10133827
876 Ga0157374_10544521
877 Ga0157378_10097588
878 Ga0157378_10174826
879 Ga0163162_10059242
880 Ga0163162_10198545
881 Ga0157375_10009144
882 Ga0157375_10161725
883 Ga0157375_10264666
884 Ga0163163_10039345
885 Ga0163163_10331363
886 Ga0163163_10986658
887 Ga0157380_10065129
888 Ga0182008_10001633
889 Ga0157379_10016771
890 Ga0157376_10210490
891 Ga0182007_10003809
892 Ga0163161_10001851
893 Ga0163161_10126584
894 Ga0163161_10471997
895 Ga0213872_10001003
896 Ga0213872_10017110
897 Ga0213872_10083421
898 Ga0209258_100074
899 Ga0207425_1000426
900 Ga0209759_1000909
901 Ga0209129_1000269
902 Ga0209455_1000066
903 Ga0209455_1000447
904 Ga0209673_1002449
905 Ga0209673_1006112
906 Ga0209676_1006101
907 Ga0209025_1000019
908 Ga0209564_1000300
909 Ga0209758_1000453
910 Ga0209758_1000605
911 Ga0209050_1000770
912 Ga0209050_1003148
913 Ga0209050_1009610
914 Ga0209256_1000049
915 Ga0209051_1000247
916 Ga0209051_1003582
917 Ga0209051_1010607
918 Ga0209051_1014684
919 Ga0209051_1034612
920 Ga0209257_1000047
921 Ga0209257_1000141
922 Ga0209257_1008855
923 Ga0207697_10020000
924 Ga0207656_10053271
925 Ga0207656_10054319
926 Ga0207682_10001493
927 Ga0207682_10018894
928 Ga0207682_10026689
929 Ga0207642_10185226
930 Ga0207645_10018015
931 Ga0207645_10045823
932 Ga0207645_10147664
933 Ga0207643_10013289
934 Ga0207705_10195193
935 Ga0207684_10401818
936 Ga0207662_10042029
937 Ga0207657_10082993
938 Ga0207649_10000335
939 Ga0207649_10360688
940 Ga0207681_10031313
941 Ga0207681_10149690
942 Ga0207681_10527783
943 Ga0207694_10023193
944 Ga0207650_10000230
945 Ga0207650_10007627
946 Ga0207650_10009807
947 Ga0207650_10109025
948 Ga0207650_10233462
949 Ga0207659_10006351
950 Ga0207659_10039115
951 Ga0207659_10562769
952 Ga0207687_10014332
953 Ga0207687_10051884
954 Ga0207687_10188673
955 Ga0207644_10006307
956 Ga0207644_10012592
957 Ga0207644_10051464
958 Ga0207644_10071322
959 Ga0207644_10166785
960 Ga0207644_10345904
961 Ga0207690_10000176
962 Ga0207706_10004610
963 Ga0207706_10227064
964 Ga0207706_10369066
965 Ga0207686_10038520
966 Ga0207709_10042931
967 Ga0207709_10315696
968 Ga0207670_10015720
969 Ga0207669_10008524
970 Ga0207669_10109822
971 Ga0207669_10129968
972 Ga0207704_10050520
973 Ga0207704_10061517
974 Ga0207691_10000681
975 Ga0207691_10012349
976 Ga0207691_10059728
977 Ga0207691_10300713
978 Ga0207711_10016311
979 Ga0207711_10090689
980 Ga0207711_10134673
981 Ga0207689_10006365
982 Ga0207679_10000168
983 Ga0207679_10117672
984 Ga0207679_10224739
985 Ga0207667_10057815
986 Ga0207667_10061276
987 Ga0207667_10329679
988 Ga0207667_10395546
989 Ga0207651_10037610
990 Ga0207651_10136651
991 Ga0207651_10280827
992 Ga0207712_10031683
993 Ga0207712_10212147
994 Ga0207668_10221587
995 Ga0207640_10134770
996 Ga0207658_10025833
997 Ga0207658_10031284
998 Ga0207658_10142722
999 Ga0207677_10015578
1000 Ga0207677_10103338
1001 Ga0207703_10012819
1002 Ga0207703_10624673
1003 Ga0207639_10024959
1004 Ga0207639_10269695
1005 Ga0207678_10034429
1006 Ga0207708_10022695
1007 Ga0207641_10083955
1008 Ga0207641_10113960
1009 Ga0207641_10380090
1010 Ga0207641_10603217
1011 Ga0207648_10024898
1012 Ga0207648_10050744
1013 Ga0207648_10077174
1014 Ga0207676_10001953
1015 Ga0207676_10112721
1016 Ga0207676_10119757
1017 Ga0207676_10126745
1018 Ga0207676_10315668
1019 Ga0207674_10010750
1020 Ga0207675_100008514
1021 Ga0207683_10006633
1022 Ga0207683_10409194
1023 Ga0207698_10043913
1024 Ga0207698_10076176
1025 Ga0207698_10106125
1026 Ga0207698_10125036
1027 Ga0207698_10353264
1028 Ga0207698_10368060
1029 Ga0209281_1000395
1030 Ga0209996_1001152
1031 Ga0209995_1004071
1032 Ga0209968_1000428
1033 Ga0209966_1000008
1034 Ga0209998_10005832
1035 Ga0209813_10050727
1036 Ga0209974_10114282
1037 Ga0268266_10656411
1038 Ga0268266_10769069
1039 Ga0268265_10222213
1040 Ga0265336_10000024
1041 Ga0307517_10005635
1042 Ga0307517_10098192
1043 Ga0307515_10000011
1044 Ga0307515_10000084
1045 Ga0307515_10000382
1046 Ga0307515_10020861
1047 Ga0307515_10030153
1048 Ga0307515_10073520
1049 Ga0265324_10001883
1050 Ga0268256_1026036
1051 Ga0307511_10155354
1052 Ga0307512_10209709
1053 Ga0265332_10082005
1054 Ga0265328_10000252
1055 Ga0265329_10026703
1056 Ga0265331_10000050
1057 Ga0265327_10000109
1058 Ga0265327_10000789
1059 Ga0265327_10019962
1060 Ga0307513_10002473
1061 Ga0307513_10026225
1062 Ga0307513_10071479
1063 Ga0307509_10000063
1064 Ga0307509_10040214
1065 Ga0307509_10177792
1066 Ga0307408_100000029
1067 Ga0307408_100226249
1068 Ga0307508_10000109
1069 Ga0307508_10005254
1070 Ga0307508_10201116
1071 Ga0307514_10000954
1072 Ga0307514_10010207
1073 Ga0307514_10029981
1074 Ga0307514_10077236
1075 Ga0265314_10017068
1076 Ga0307516_10000676
1077 Ga0307516_10001245
1078 Ga0307516_10031563
1079 Ga0307516_10095680
1080 Ga0307516_10179339
1081 Ga0307413_10083624
1082 Ga0307410_10022243
1083 Ga0307406_10007608
1084 Ga0307406_10183872
1085 Ga0307412_10000061
1086 Ga0307412_10036594
1087 Ga0307412_10239149
1088 Ga0307412_10551713
1089 Ga0307416_100059775
1090 Ga0307416_100537383
1091 Ga0307411_10144890
1092 Ga0307415_100112331
1093 Ga0307507_10209700
1094 Ga0307510_10004418
1095 Ga0307510_10017213
1096 Ga0373940_0016864
1097 Ga0373939_0000012
1098 Ga0373960_0000218
1099 Ga0373961_0004072
1100 Ga0373931_0002689
1101 Ga0373935_0492792
1102 Ga0373937_0630638
1103 Ga0373925_0155437
1104 Ga0395900_0000183
1105 Ga0395900_0027656
1106 Ga0395900_0079101
1107 Ga0395898_0001293
1108 Ga0395898_0112304
1109 Ga0395898_0152268
1110 Ga0395905_0000027
1111 Ga0395905_0002201
1112 Ga0395905_0027641
1113 Ga0395905_0074018
1114 Ga0395905_0250170
1115 Ga0395905_0458190
1116 Ga0436361_0039667
1117 Ga0436361_0110525
1118 Ga0439436_0001048
1119 Ga0439447_023051
1120 Ga0439466_0004086
1121 Ga0439465_0040301
1122 Ga0451793_0140833
1123 Ga0451800_1581513
1124 Ga0439431_0000483
1125 Ga0439431_0005469
1126 Ga0439433_0002772
1127 Ga0439442_024130
1128 Ga0439445_0059399
1129 Ga0439432_001040
1130 Ga0439449_0001389
1131 Ga0439449_0032823
1132 Ga0450888_001081
1133 Ga0450891_002454
1134 Ga0450892_003377
1135 Ga0450889_002584
1136 Ga0439434_0024175
1137 Ga0450893_0032148
1138 Ga0451577_0000270
1139 Ga0451577_0003233
1140 Ga0451577_0008906
1141 Ga0451577_0076840
1142 Ga0451577_0394457
1143 Ga0466969_0000020
1144 Ga0466969_0189657
1145 Ga0466965_0043431
1146 Ga0466965_0145957
1147 Ga0466966_0007572
1148 Ga0466966_0013049
1149 Ga0466966_0145052
1150 Ga0466961_0027938
1151 Ga0466961_0029661
1152 Ga0466963_0301687
1153 Ga0466964_0021846
1154 Ga0453684_0000868
1155 Ga0453684_0018604
1156 Ga0453684_0133946
1157 Ga0453684_0214160
1158 Ga0453684_0366101
1159 Ga0466968_0006113
1160 Ga0466970_0030545
1161 Ga0466970_0031448
1162 Ga0466957_0142010
1163 Ga0466960_0012273
1164 Ga0466960_0078188
1165 Ga0466959_0000210
1166 Ga0466959_0068705
1167 Ga0466959_0163203
1168 Ga0451576_0004748
1169 Ga0451576_0047445
1170 Ga0451576_0100852
1171 Ga0451576_0240622
1172 Ga0451576_0877205
1173 Ga0495592_0006972
1174 Ga0495590_0042912
1175 Ga0495650_0024628
1176 Ga0495639_0023242
1177 Ga0495583_0000034
1178 Ga0495606_0001225
1179 Ga0495606_0121912
1180 Ga0495630_0364834
1181 Ga0495621_0013028
1182 Ga0495645_0073438
1183 Ga0495645_0133854
1184 Ga0495625_0004651
1185 Ga0495625_0015665
1186 Ga0495635_0348180
1187 Ga0495588_0280673
1188 Ga0495646_0047667
1189 Ga0495658_0075719
1190 Ga0495669_0022325
1191 Ga0495624_0036674
1192 Ga0495649_0000428
1193 Ga0495589_0002853
1194 Ga0495674_0290321
1195 Ga0495676_0007213
1196 Ga0495686_0023580
1197 Ga0496100_0009165
1198 Ga0496101_0004382
1199 Ga0496102_0006127
1200 Ga0496104_0269833
1201 Ga0496106_0007087
1202 Ga0496108_0036590
1203 Ga0496108_0125637
1204 Ga0496108_0317044
1205 Ga0496109_0009016
1206 Ga0496110_0057567
1207 Ga0496111_0071605
1208 Ga0496112_0004885
1209 Ga0496114_0194525
1210 Ga0496116_0022632
1211 Ga0496116_0024092
1212 Ga0496117_0009792
1213 Ga0496117_0069549
1214 Ga0496118_0011294
1215 Ga0496118_0018649
1216 Ga0496119_0028700
1217 Ga0496120_0004304
1218 Ga0496121_0000647
1219 Ga0496121_0010291
1220 Ga0496122_0000612
1221 Ga0496122_0003062
1222 Ga0496122_0022055
1223 Ga0496123_0000274
1224 Ga0496123_0002506
1225 Ga0496124_0000013
1226 Ga0496124_0000108
1227 Ga0496124_0048778
1228 Ga0496124_0196702
1229 Ga0496125_0000051
1230 Ga0496125_0004939
1231 Ga0496125_0014355
1232 Ga0496125_0272563
1233 Ga0496126_0008185
1234 Ga0496126_0015870
1235 Ga0501297_006242
1236 Ga0501300_001506
1237 Ga0501301_002968
1238 Ga0501031_0055745
1239 Ga0501032_0010987
1240 Ga0501033_0000668
1241 Ga0501033_0069374
1242 Ga0501033_0098599
1243 Ga0501033_0111228
1244 Ga0501034_0005349
1245 Ga0501034_0061854
1246 Ga0501036_0001501
1247 Ga0501037_0004363
1248 Ga0501037_0192545
1249 Ga0501038_0058343
1250 Ga0501038_0114468
1251 Ga0501043_0000002
1252 Ga0501046_0000008
1253 Ga0501046_0001989
1254 Ga0501047_0000003
1255 Ga0501047_0018975
1256 Ga0501047_0076103
1257 Ga0501048_0001479
1258 Ga0501048_0106826
1259 Ga0501198_000024
1260 Ga0501211_000808
1261 Ga0501222_000020
1262 Ga0501222_001766
1263 Ga0501223_024329
1264 Ga0501242_010433
1265 Ga0501221_002605
1266 Ga0501229_000206
1267 Ga0501080_0053880
1268 Ga0501232_000662
1269 Ga0501262_005503
1270 Ga0501267_002247
1271 Ga0501269_001983
1272 Ga0501274_003754
1273 Ga0501283_003257
1274 Ga0501035_0006298
1275 Ga0501035_0026335
1276 Ga0501035_0141426
1277 Ga0501035_0325646
1278 Ga0501044_0000316
1279 Ga0501044_0004069
1280 Ga0501044_0038183
1281 Ga0501044_0089818
1282 Ga0501044_0227929
1283 Ga0501045_0003417
1284 nmdc:mga03683_68446_c1
1285 nmdc:mga00v17_18021_c1
1286 nmdc:mga00v17_29017_c1
1287 nmdc:mga00v17_69137_c1
1288 nmdc:mga0k408_20607_c1
1289 nmdc:mga0k408_22368_c1
1290 nmdc:mga0k408_26608_c1
1291 nmdc:mga0k408_31894_c1
1292 nmdc:mga0k408_6011_c1
1293 nmdc:mga0k408_64479_c1
1294 nmdc:mga07m45_154696_c1
1295 nmdc:mga07m45_2735_c1
1296 nmdc:mga07m45_4966_c2
1297 nmdc:mga07m45_5336_c1
1298 nmdc:mga07m45_5339_c1
1299 nmdc:mga07m45_69460_c1
1300 nmdc:mga07m45_847_c1
1301 nmdc:mga05p37_29102_c1
1302 nmdc:mga09592_1310_c1
1303 nmdc:mga0qj67_19500_c1
1304 nmdc:mga08y16_608942_c1
1305 nmdc:mga0n895_80145_c1
1306 nmdc:mga0a205_25032_c1
1307 Ga0495601_0032309
1308 Ga0500635_0000008
1309 Ga0500578_0110065
1310 Ga0500644_0003424
1311 Ga0500651_0080058
1312 Ga0500651_0135077
1313 Ga0500652_000177
1314 Ga0500559_0000013
1315 Ga0500559_0004164
1316 Ga0500561_0009960
1317 Ga0500590_077134
1318 Ga0500600_0009254
1319 Ga0500622_0004247
1320 Ga0500622_0019490
1321 Ga0500622_0100443
1322 Ga0500570_103326
1323 Ga0500587_005845
1324 2587725527
1325 2587734995
1326 2587758433
1327 2588290527
1328 2599902783
1329 2643743617
1330 2643861620
1331 2643936616
1332 2643970042
1333 2643980040
1334 2644123614
1335 2644142984
1336 2644222503
1337 2644256651
1338 2644271956
1339 2644303313
1340 2644317972
1341 2644341115
1342 2739611316
1343 2809033123
1344 2842736416
1345 2855732820
1346 2855771572
1347 2857542501
1348 2857543360
1349 2858952208
1350 2881415624
1351 2881929868
1352 2885196990
1353 2887376220
1354 2895517803
1355 2904481547
1356 2928118038
1357 2941482635
1358 8002395896
1359 8048747535
1360 8055228459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

49

240

0.92

PF01061

ABC2_membrane

ABC-2 type transporter

11

213

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jr7-assembly1.cif.gz_B cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 0.7003 20 254
5do7-assembly2.cif.gz_D crystal structure of the human sterol transporter abcg5/abcg8 0.686 17 252
8wbx-assembly1.cif.gz_B cryo-em structure of the abcg25 bound to aba 0.6837 27 252
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.6809 8 256
8wd6-assembly1.cif.gz_A cryo-em structure of the abcg25 0.6796 26 252
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8488 55 250 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8086 56 248 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7625 34 249 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6598 55 250 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6472 34 249 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A176S4K3-F1-model_v4 Abc-type multidrug transport system, permease component 0.9642 59 258 GO:0005886
GO:0140359
AF-A0A4Q3TZG4-F1-model_v4 Transport permease protein 0.9608 62 258 GO:0043190
GO:0140359
AF-A0A381YL02-F1-model_v4 ABC transmembrane type-2 domain-containing protein 0.9555 67 258 GO:0005886
GO:0140359
AF-A0A176S4K3-F1-model_v4 Abc-type multidrug transport system, permease component 0.9549 59 258 GO:0005886
GO:0140359
AF-A0A1G1J6N7-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9523 108 258 GO:0005886
GO:0140359

Map