F474835

General Info

Members Datasets Scaffolds Average Seq Length
681 263 681 461

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10149992|Ga0157375_101499922
Length 529
Sequence VEQQLSCGQPPLVYVTNGGWGTVAADDGGAGYVVRGLTLGIVKPRQRPPVKIRNLATATAVWIRMQKRPNFLVILIDDLRYDEFGAGGHPYMKTPHVDRLAAEGALFERAFHTTPICSPNRASIVTGQYASRHGIIDNVARDAMSHRLPNYHLELQRLGYETAHIGKWHMGNDGQPRPGYDYWVSYDGHGRLHDPTLNHDGKYVEHRGYITDIMNGLAVDFLDRTHGKPWSLFFAHKAVHPDAAQAADGTLRISAQGGYVVAERHKDLYRGAIFPKKPNMLSPAEVVRRKPAWAECLSLRSSEDSRQVLVALHSMEQEEIRLRARMMAAVDEGMGQILDVLERKGELDNTFIVFLGDNGFFFGEHALGPERRFAYEEGIRSPFLVRFPKRAKAGSRRRELVICQDIAPTLIQLAGGKPGPQIQGRSLLPLFARGDTRMRAGWRKSILCEYWAEQAMPWLVGMSYKAVRTDRYKYIHWVNRGRAGELDELYDLDTDPYEIRNLNASRAMTPVRERMRRELRKLVAEALGL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
198 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
199 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
201 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 0.59
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002912 3300005327 Bacteria 14194
2 Ga0070676_10000164 3300005328 Bacteria 26774
3 Ga0070683_100004516 3300005329 Bacteria 11485
4 Ga0070683_100018723 3300005329 Bacteria 6137
5 Ga0070683_100060244 3300005329 Bacteria 3527
6 Ga0070690_100019776 3300005330 Bacteria 4095
7 Ga0070690_100029769 3300005330 Bacteria 3389
8 Ga0070690_100078556 3300005330 Bacteria 2156
9 Ga0070670_100001252 3300005331 Bacteria 20207
10 Ga0070670_100003427 3300005331 Bacteria 13164
11 Ga0070670_100069704 3300005331 Bacteria 3019
12 Ga0070670_100116588 3300005331 Bacteria 2303
13 Ga0068869_100000789 3300005334 Bacteria 18065
14 Ga0068869_100004150 3300005334 Bacteria 8986
15 Ga0068869_100080735 3300005334 Bacteria 2427
16 Ga0070666_10039039 3300005335 Bacteria 3162
17 Ga0070680_100003118 3300005336 Bacteria 12307
18 Ga0070680_100019471 3300005336 Bacteria 5377
19 Ga0070680_100166991 3300005336 Bacteria 1851
20 Ga0070680_100262992 3300005336 Bacteria 1460
21 Ga0070682_100000147 3300005337 Bacteria 55841
22 Ga0068868_100086921 3300005338 Bacteria 2514
23 Ga0070660_100000639 3300005339 Bacteria 23237
24 Ga0070660_100010235 3300005339 Bacteria 6618
25 Ga0070660_100021908 3300005339 Bacteria 4720
26 Ga0070689_100023306 3300005340 Bacteria 4633
27 Ga0070689_100038207 3300005340 Bacteria 3672
28 Ga0070689_100041882 3300005340 Bacteria 3515
29 Ga0070691_10027934 3300005341 Bacteria 2633
30 Ga0070687_100046879 3300005343 Bacteria 2215
31 Ga0070661_100001058 3300005344 Bacteria 19513
32 Ga0070661_100005227 3300005344 Bacteria 8938
33 Ga0070661_100041417 3300005344 Bacteria 3362
34 Ga0070692_10004219 3300005345 Bacteria 5961
35 Ga0070692_10005256 3300005345 Bacteria 5496
36 Ga0070692_10051606 3300005345 Bacteria 2140
37 Ga0070668_100032129 3300005347 Bacteria 3995
38 Ga0070668_100060420 3300005347 Bacteria 2935
39 Ga0070668_100105775 3300005347 Unclassified 2235
40 Ga0070668_100160924 3300005347 Bacteria 1822
41 Ga0070669_100020709 3300005353 Bacteria 4698
42 Ga0070669_100073493 3300005353 Bacteria 2533
43 Ga0070669_100111142 3300005353 Bacteria 2079
44 Ga0070675_100007866 3300005354 Bacteria 8261
45 Ga0070675_100011711 3300005354 Bacteria 6873
46 Ga0070675_100094983 3300005354 Bacteria 2503
47 Ga0070673_100003829 3300005364 Bacteria 9436
48 Ga0070673_100030068 3300005364 Bacteria 4059
49 Ga0070659_100001053 3300005366 Bacteria 20154
50 Ga0070659_100028702 3300005366 Bacteria 4299
51 Ga0070659_100034698 3300005366 Bacteria 3925
52 Ga0070714_100007718 3300005435 Bacteria 8381
53 Ga0070714_100008956 3300005435 Bacteria 7833
54 Ga0070713_100020849 3300005436 Bacteria 5030
55 Ga0070701_10027788 3300005438 Bacteria 2775
56 Ga0070711_100058362 3300005439 Unclassified 2676
57 Ga0070705_100004619 3300005440 Bacteria 6702
58 Ga0070705_100006953 3300005440 Bacteria 5559
59 Ga0070705_100030761 3300005440 Bacteria 2966
60 Ga0070705_100071663 3300005440 Bacteria 2097
61 Ga0070700_100000652 3300005441 Bacteria 17149
62 Ga0070694_100000164 3300005444 Bacteria 34180
63 Ga0070694_100000490 3300005444 Bacteria 21700
64 Ga0070694_100003964 3300005444 Bacteria 8856
65 Ga0070694_100021721 3300005444 Bacteria 4106
66 Ga0070694_100041987 3300005444 Bacteria 3053
67 Ga0070708_100038364 3300005445 Bacteria 4185
68 Ga0070663_100002585 3300005455 Bacteria 10224
69 Ga0070678_100008275 3300005456 Bacteria 6223
70 Ga0070662_100016778 3300005457 Bacteria 4922
71 Ga0070662_100078612 3300005457 Bacteria 2451
72 Ga0070681_10002249 3300005458 Bacteria 17621
73 Ga0070681_10010440 3300005458 Bacteria 9172
74 Ga0070681_10138481 3300005458 Bacteria 2364
75 Ga0068867_100000876 3300005459 Bacteria 20334
76 Ga0068867_100003046 3300005459 Bacteria 11818
77 Ga0068867_100146329 3300005459 Bacteria 1852
78 Ga0070706_100090638 3300005467 Bacteria 2835
79 Ga0070698_100002891 3300005471 Bacteria 18906
80 Ga0070698_100025124 3300005471 Bacteria 6209
81 Ga0070698_100026914 3300005471 Bacteria 5980
82 Ga0070698_100080951 3300005471 Bacteria 3242
83 Ga0070698_100195307 3300005471 Bacteria 1961
84 Ga0070699_100049278 3300005518 Bacteria 3646
85 Ga0070699_100052108 3300005518 Bacteria 3543
86 Ga0070699_100111465 3300005518 Bacteria 2402
87 Ga0070679_100069046 3300005530 Unclassified 3525
88 Ga0070684_100001027 3300005535 Bacteria 19891
89 Ga0070684_100035943 3300005535 Bacteria 4243
90 Ga0070684_100077425 3300005535 Bacteria 2937
91 Ga0070697_100149919 3300005536 Bacteria 1965
92 Ga0068853_100001868 3300005539 Bacteria 15488
93 Ga0068853_100010394 3300005539 Bacteria 7530
94 Ga0068853_100104081 3300005539 Bacteria 2513
95 Ga0070672_100002353 3300005543 Bacteria 11956
96 Ga0070672_100014473 3300005543 Bacteria 5592
97 Ga0070672_100128913 3300005543 Bacteria 2077
98 Ga0070672_100185300 3300005543 Unclassified 1736
99 Ga0070695_100001300 3300005545 Bacteria 13785
100 Ga0070695_100018893 3300005545 Bacteria 4190
101 Ga0070695_100022662 3300005545 Bacteria 3854
102 Ga0070695_100098783 3300005545 Bacteria 1962
103 Ga0070696_100002890 3300005546 Bacteria 11426
104 Ga0070696_100022222 3300005546 Bacteria 4309
105 Ga0070696_100051489 3300005546 Bacteria 2864
106 Ga0070693_100000088 3300005547 Bacteria 39090
107 Ga0070693_100077520 3300005547 Bacteria 1973
108 Ga0070665_100008670 3300005548 Bacteria 10290
109 Ga0070665_100230993 3300005548 Bacteria 1850
110 Ga0070704_100000580 3300005549 Bacteria 17578
111 Ga0070704_100078761 3300005549 Bacteria 2419
112 Ga0068855_100001859 3300005563 Bacteria 26255
113 Ga0068855_100086023 3300005563 Bacteria 3636
114 Ga0068855_100298492 3300005563 Bacteria 1784
115 Ga0068855_100370508 3300005563 Unclassified 1574
116 Ga0070664_100006137 3300005564 Bacteria 9720
117 Ga0070664_100023948 3300005564 Bacteria 5045
118 Ga0068857_100004059 3300005577 Bacteria 12325
119 Ga0068857_100007072 3300005577 Bacteria 9664
120 Ga0068857_100017062 3300005577 Bacteria 6359
121 Ga0068857_100147518 3300005577 Bacteria 2129
122 Ga0068854_100003327 3300005578 Bacteria 10015
123 Ga0068854_100008881 3300005578 Bacteria 6469
124 Ga0068856_100001089 3300005614 Bacteria 28646
125 Ga0068856_100023739 3300005614 Bacteria 5964
126 Ga0068856_100034475 3300005614 Bacteria 4957
127 Ga0068856_100203212 3300005614 Unclassified 1996
128 Ga0068856_100207788 3300005614 Bacteria 1972
129 Ga0070702_100016589 3300005615 Bacteria 3781
130 Ga0068859_100002050 3300005617 Bacteria 20585
131 Ga0068859_100006939 3300005617 Bacteria 11501
132 Ga0068859_100115241 3300005617 Bacteria 2752
133 Ga0068864_100006436 3300005618 Bacteria 9625
134 Ga0068864_100023302 3300005618 Bacteria 5198
135 Ga0068861_100004028 3300005719 Bacteria 9839
136 Ga0068851_10015934 3300005834 Bacteria 3588
137 Ga0068851_10016876 3300005834 Unclassified 3499
138 Ga0068870_10005480 3300005840 Bacteria 5545
139 Ga0068863_100001012 3300005841 Bacteria 28130
140 Ga0068863_100040138 3300005841 Bacteria 4450
141 Ga0068863_100088950 3300005841 Bacteria 2927
142 Ga0068863_100278798 3300005841 Bacteria 1619
143 Ga0068858_100152692 3300005842 Bacteria 2172
144 Ga0068860_100044918 3300005843 Bacteria 4211
145 Ga0068860_100088392 3300005843 Bacteria 2949
146 Ga0068860_100122453 3300005843 Bacteria 2492
147 Ga0068860_100139237 3300005843 Bacteria 2331
148 Ga0068860_100206348 3300005843 Bacteria 1906
149 Ga0068862_100001923 3300005844 Bacteria 18860
150 Ga0068862_100012226 3300005844 Bacteria 7097
151 Ga0068862_100018363 3300005844 Bacteria 5823
152 Ga0068862_100057883 3300005844 Bacteria 3325
153 Ga0068862_100187319 3300005844 Bacteria 1860
154 Ga0081455_10000824 3300005937 Bacteria 39882
155 Ga0081455_10001949 3300005937 Bacteria 24788
156 Ga0081455_10094342 3300005937 Unclassified 2417
157 Ga0081538_10037454 3300005981 Bacteria 3146
158 Ga0081539_10000797 3300005985 Bacteria 61227
159 Ga0081539_10031165 3300005985 Bacteria 3293
160 Ga0075365_10086033 3300006038 Bacteria 2136
161 Ga0075368_10047499 3300006042 Bacteria 1699
162 Ga0075364_10109912 3300006051 Bacteria 1839
163 Ga0075432_10005305 3300006058 Bacteria 4388
164 Ga0070712_100001581 3300006175 Bacteria 13929
165 Ga0070712_100118277 3300006175 Unclassified 1990
166 Ga0068871_100004074 3300006358 Bacteria 10110
167 Ga0075428_100002789 3300006844 Bacteria 19006
168 Ga0075428_100004047 3300006844 Bacteria 16112
169 Ga0075428_100050090 3300006844 Bacteria 4581
170 Ga0075428_100332366 3300006844 Unclassified 1632
171 Ga0075430_100004062 3300006846 Bacteria 12352
172 Ga0075430_100015771 3300006846 Bacteria 6436
173 Ga0075430_100019910 3300006846 Bacteria 5709
174 Ga0075430_100063274 3300006846 Bacteria 3108
175 Ga0075430_100098995 3300006846 Bacteria 2435
176 Ga0075431_100000073 3300006847 Bacteria 58648
177 Ga0075431_100001889 3300006847 Bacteria 19868
178 Ga0075431_100004172 3300006847 Bacteria 14132
179 Ga0075431_100011522 3300006847 Bacteria 8918
180 Ga0075431_100049276 3300006847 Bacteria 4343
181 Ga0075431_100072345 3300006847 Bacteria 3558
182 Ga0075431_100191508 3300006847 Unclassified 2095
183 Ga0075433_10000184 3300006852 Bacteria 35069
184 Ga0075433_10002071 3300006852 Bacteria 15163
185 Ga0075433_10006577 3300006852 Bacteria 9202
186 Ga0075433_10048205 3300006852 Bacteria 3705
187 Ga0075434_100000358 3300006871 Bacteria 33110
188 Ga0075434_100002746 3300006871 Bacteria 15560
189 Ga0075434_100067221 3300006871 Bacteria 3571
190 Ga0075434_100069941 3300006871 Unclassified 3499
191 Ga0075429_100000691 3300006880 Bacteria 26282
192 Ga0075429_100005736 3300006880 Bacteria 10714
193 Ga0075429_100010802 3300006880 Bacteria 7897
194 Ga0075429_100044699 3300006880 Bacteria 3852
195 Ga0075429_100202191 3300006880 Bacteria 1741
196 Ga0075436_100004153 3300006914 Bacteria 9938
197 Ga0075436_100010219 3300006914 Bacteria 6428
198 Ga0097620_100002051 3300006931 Bacteria 20585
199 Ga0097620_100006939 3300006931 Bacteria 11501
200 Ga0097620_100115242 3300006931 Bacteria 2752
201 Ga0075435_100001390 3300007076 Bacteria 15588
202 Ga0075435_100058413 3300007076 Bacteria 3124
203 Ga0105240_10012112 3300009093 Bacteria 11945
204 Ga0105240_10093438 3300009093 Bacteria 3671
205 Ga0111539_10000724 3300009094 Bacteria 42942
206 Ga0111539_10019169 3300009094 Bacteria 8451
207 Ga0111539_10024762 3300009094 Bacteria 7361
208 Ga0111539_10044598 3300009094 Bacteria 5312
209 Ga0105245_10262176 3300009098 Bacteria 1682
210 Ga0114129_10001057 3300009147 Bacteria 36115
211 Ga0114129_10027640 3300009147 Bacteria 8033
212 Ga0114129_10067074 3300009147 Bacteria 5004
213 Ga0114129_10394966 3300009147 Bacteria 1823
214 Ga0105243_10003195 3300009148 Bacteria 13424
215 Ga0105243_10011356 3300009148 Bacteria 6742
216 Ga0105243_10063427 3300009148 Bacteria 2961
217 Ga0105243_10144348 3300009148 Bacteria 2035
218 Ga0105241_10000541 3300009174 Bacteria 28474
219 Ga0105241_10026181 3300009174 Bacteria 4337
220 Ga0105241_10034519 3300009174 Bacteria 3801
221 Ga0105242_10018292 3300009176 Bacteria 5476
222 Ga0105248_10031847 3300009177 Bacteria 5892
223 Ga0105248_10354541 3300009177 Bacteria 1652
224 Ga0105237_10056368 3300009545 Bacteria 3934
225 Ga0105238_10150055 3300009551 Bacteria 2306
226 Ga0105249_10005966 3300009553 Bacteria 10557
227 Ga0105249_10093938 3300009553 Bacteria 2810
228 Ga0157373_10000397 3300013100 Bacteria 34902
229 Ga0157373_10023936 3300013100 Bacteria 4425
230 Ga0157373_10031614 3300013100 Unclassified 3809
231 Ga0157371_10011892 3300013102 Bacteria 6679
232 Ga0157371_10062440 3300013102 Bacteria 2641
233 Ga0157371_10074613 3300013102 Bacteria 2402
234 Ga0157371_10080115 3300013102 Bacteria 2313
235 Ga0157370_10010331 3300013104 Bacteria 9849
236 Ga0157370_10024359 3300013104 Bacteria 5993
237 Ga0157370_10056149 3300013104 Bacteria 3748
238 Ga0157370_10204317 3300013104 Unclassified 1832
239 Ga0157369_10004373 3300013105 Bacteria 16684
240 Ga0157369_10061232 3300013105 Bacteria 4058
241 Ga0157369_10064706 3300013105 Bacteria 3938
242 Ga0157378_10025324 3300013297 Bacteria 5225
243 Ga0163162_10057168 3300013306 Bacteria 3928
244 Ga0163162_10152154 3300013306 Bacteria 2432
245 Ga0163162_10212000 3300013306 Unclassified 2067
246 Ga0157372_10001274 3300013307 Bacteria 27269
247 Ga0157372_10012997 3300013307 Bacteria 8883
248 Ga0157372_10020399 3300013307 Bacteria 7150
249 Ga0157372_10066700 3300013307 Bacteria 4043
250 Ga0157372_10101813 3300013307 Bacteria 3280
251 Ga0157375_10015727 3300013308 Bacteria 6779
252 Ga0157375_10031192 3300013308 Bacteria 5034
253 Ga0157375_10145870 3300013308 Bacteria 2498
254 Ga0157375_10149992 3300013308 Bacteria 2466
255 Ga0157375_10233731 3300013308 Bacteria 1997
256 Ga0163163_10005091 3300014325 Bacteria 11327
257 Ga0163163_10039414 3300014325 Bacteria 4611
258 Ga0157380_10037451 3300014326 Bacteria 3758
259 Ga0182008_10040807 3300014497 Bacteria 2315
260 Ga0157377_10013374 3300014745 Bacteria 4152
261 Ga0157379_10106418 3300014968 Bacteria 2518
262 Ga0157376_10014370 3300014969 Bacteria 5941
263 Ga0157376_10228689 3300014969 Unclassified 1726
264 Ga0182007_10008718 3300015262 Bacteria 4141
265 Ga0213871_10001775 3300021441 Bacteria 3754
266 Ga0207656_10009391 3300025321 Unclassified 3633
267 Ga0207645_10000397 3300025907 Bacteria 35935
268 Ga0207643_10001176 3300025908 Bacteria 15533
269 Ga0207643_10033109 3300025908 Bacteria 2891
270 Ga0207684_10005312 3300025910 Bacteria 11919
271 Ga0207684_10050713 3300025910 Bacteria 3521
272 Ga0207654_10000830 3300025911 Bacteria 17023
273 Ga0207654_10085733 3300025911 Bacteria 1907
274 Ga0207707_10000078 3300025912 Bacteria 99871
275 Ga0207707_10015848 3300025912 Bacteria 6573
276 Ga0207707_10036832 3300025912 Bacteria 4275
277 Ga0207695_10011778 3300025913 Bacteria 10565
278 Ga0207693_10010502 3300025915 Bacteria 7515
279 Ga0207660_10000335 3300025917 Bacteria 30334
280 Ga0207660_10008764 3300025917 Bacteria 6538
281 Ga0207660_10043397 3300025917 Bacteria 3160
282 Ga0207660_10062844 3300025917 Bacteria 2676
283 Ga0207660_10105010 3300025917 Unclassified 2116
284 Ga0207657_10000151 3300025919 Bacteria 70697
285 Ga0207657_10000171 3300025919 Bacteria 66690
286 Ga0207657_10014391 3300025919 Bacteria 7724
287 Ga0207657_10045828 3300025919 Bacteria 3833
288 Ga0207649_10001560 3300025920 Bacteria 13400
289 Ga0207649_10036128 3300025920 Bacteria 2973
290 Ga0207649_10050481 3300025920 Bacteria 2573
291 Ga0207652_10002588 3300025921 Bacteria 15175
292 Ga0207652_10037059 3300025921 Bacteria 4126
293 Ga0207646_10001625 3300025922 Bacteria 27437
294 Ga0207681_10048338 3300025923 Bacteria 2871
295 Ga0207694_10031809 3300025924 Bacteria 4033
296 Ga0207694_10040663 3300025924 Bacteria 3581
297 Ga0207694_10046641 3300025924 Bacteria 3349
298 Ga0207650_10004272 3300025925 Bacteria 9751
299 Ga0207650_10093534 3300025925 Bacteria 2301
300 Ga0207650_10145627 3300025925 Unclassified 1865
301 Ga0207664_10067889 3300025929 Bacteria 2862
302 Ga0207664_10071248 3300025929 Unclassified 2799
303 Ga0207690_10000917 3300025932 Bacteria 18837
304 Ga0207706_10001320 3300025933 Bacteria 24841
305 Ga0207706_10032284 3300025933 Bacteria 4663
306 Ga0207706_10176272 3300025933 Unclassified 1878
307 Ga0207709_10005588 3300025935 Bacteria 7115
308 Ga0207670_10041599 3300025936 Bacteria 3023
309 Ga0207670_10112279 3300025936 Bacteria 1966
310 Ga0207669_10041711 3300025937 Bacteria 2674
311 Ga0207704_10156166 3300025938 Bacteria 1617
312 Ga0207665_10001524 3300025939 Bacteria 15580
313 Ga0207691_10002783 3300025940 Bacteria 17058
314 Ga0207691_10007330 3300025940 Bacteria 10639
315 Ga0207691_10033432 3300025940 Bacteria 4787
316 Ga0207689_10000145 3300025942 Bacteria 61402
317 Ga0207689_10005712 3300025942 Bacteria 11064
318 Ga0207689_10011411 3300025942 Bacteria 7615
319 Ga0207689_10115191 3300025942 Bacteria 2209
320 Ga0207661_10034621 3300025944 Bacteria 3930
321 Ga0207679_10001573 3300025945 Bacteria 14272
322 Ga0207679_10013299 3300025945 Bacteria 5393
323 Ga0207667_10000460 3300025949 Bacteria 54739
324 Ga0207667_10001678 3300025949 Bacteria 27885
325 Ga0207651_10002196 3300025960 Bacteria 9238
326 Ga0207651_10011420 3300025960 Bacteria 4974
327 Ga0207651_10013977 3300025960 Bacteria 4619
328 Ga0207712_10005617 3300025961 Bacteria 7910
329 Ga0207668_10003150 3300025972 Bacteria 9657
330 Ga0207668_10004756 3300025972 Bacteria 7990
331 Ga0207640_10001797 3300025981 Bacteria 11519
332 Ga0207677_10112699 3300026023 Bacteria 2029
333 Ga0207639_10001047 3300026041 Bacteria 18785
334 Ga0207678_10000941 3300026067 Bacteria 26550
335 Ga0207678_10002480 3300026067 Bacteria 16774
336 Ga0207708_10123599 3300026075 Bacteria 2018
337 Ga0207702_10001916 3300026078 Bacteria 20332
338 Ga0207702_10005739 3300026078 Bacteria 10812
339 Ga0207702_10014160 3300026078 Bacteria 6624
340 Ga0207702_10113676 3300026078 Bacteria 2411
341 Ga0207641_10001097 3300026088 Bacteria 27224
342 Ga0207641_10024315 3300026088 Bacteria 4993
343 Ga0207641_10081077 3300026088 Bacteria 2817
344 Ga0207641_10096781 3300026088 Bacteria 2593
345 Ga0207648_10007171 3300026089 Bacteria 10989
346 Ga0207648_10007874 3300026089 Bacteria 10396
347 Ga0207648_10089993 3300026089 Bacteria 2681
348 Ga0207676_10007102 3300026095 Bacteria 7936
349 Ga0207676_10037544 3300026095 Bacteria 3692
350 Ga0207674_10000248 3300026116 Bacteria 67145
351 Ga0207674_10000650 3300026116 Bacteria 45189
352 Ga0207674_10004811 3300026116 Bacteria 16172
353 Ga0207674_10185202 3300026116 Bacteria 2033
354 Ga0207675_100030585 3300026118 Bacteria 5016
355 Ga0207683_10009224 3300026121 Bacteria 8408
356 Ga0207683_10020624 3300026121 Bacteria 5639
357 Ga0207683_10105089 3300026121 Bacteria 2524
358 Ga0207698_10007732 3300026142 Bacteria 6746
359 Ga0209969_1003079 3300027360 Bacteria 2303
360 Ga0209967_1000460 3300027364 Bacteria 5365
361 Ga0209967_1000554 3300027364 Bacteria 4917
362 Ga0209981_1000615 3300027378 Bacteria 4507
363 Ga0209981_1001151 3300027378 Bacteria 3353
364 Ga0209996_1000434 3300027395 Bacteria 5044
365 Ga0209984_1000614 3300027424 Unclassified 3863
366 Ga0210000_1001726 3300027462 Unclassified 3087
367 Ga0210000_1003174 3300027462 Bacteria 2364
368 Ga0209995_1000422 3300027471 Bacteria 6567
369 Ga0209995_1002434 3300027471 Bacteria 2939
370 Ga0209968_1001670 3300027526 Bacteria 3351
371 Ga0209999_1006748 3300027543 Unclassified 2066
372 Ga0209983_1000184 3300027665 Bacteria 12117
373 Ga0209588_1006914 3300027671 Bacteria 3320
374 Ga0209971_1001259 3300027682 Bacteria 6321
375 Ga0209971_1008604 3300027682 Bacteria 2422
376 Ga0209971_1012182 3300027682 Unclassified 2036
377 Ga0209966_1000700 3300027695 Bacteria 7235
378 Ga0209966_1002924 3300027695 Bacteria 2862
379 Ga0209974_10002094 3300027876 Bacteria 7305
380 Ga0207428_10000276 3300027907 Bacteria 69031
381 Ga0207428_10000367 3300027907 Bacteria 57765
382 Ga0207428_10042873 3300027907 Bacteria 3658
383 Ga0268266_10003146 3300028379 Bacteria 16766
384 Ga0268266_10012759 3300028379 Bacteria 7261
385 Ga0268265_10000922 3300028380 Bacteria 27196
386 Ga0268265_10004017 3300028380 Bacteria 10358
387 Ga0268265_10011548 3300028380 Bacteria 5971
388 Ga0268265_10025011 3300028380 Bacteria 4232
389 Ga0268265_10061839 3300028380 Bacteria 2875
390 Ga0268264_10003021 3300028381 Bacteria 14584
391 Ga0268264_10090445 3300028381 Bacteria 2638
392 Ga0268264_10126364 3300028381 Bacteria 2260
393 Ga0268264_10155219 3300028381 Bacteria 2056
394 Ga0265340_10033026 3300031247 Bacteria 2579
395 Ga0307408_100096726 3300031548 Bacteria 2241
396 Ga0316578_10018812 3300031728 Bacteria 3793
397 Ga0307410_10006474 3300031852 Bacteria 6323
398 Ga0307410_10034351 3300031852 Bacteria 3284
399 Ga0307410_10068121 3300031852 Bacteria 2457
400 Ga0307406_10002846 3300031901 Bacteria 9425
401 Ga0307412_10093747 3300031911 Bacteria 2107
402 Ga0307409_100014523 3300031995 Bacteria 5128
403 Ga0307416_100003495 3300032002 Bacteria 9240
404 Ga0307416_100022943 3300032002 Bacteria 4518
405 Ga0307416_100142482 3300032002 Bacteria 2181
406 Ga0307411_10000468 3300032005 Bacteria 13997
407 Ga0316583_10016133 3300032133 Unclassified 2689
408 Ga0373949_0002144 3300035090 Bacteria 5184
409 Ga0373949_0009796 3300035090 Bacteria 2098
410 Ga0373951_0004297 3300035091 Bacteria 3393
411 Ga0373951_0011778 3300035091 Bacteria 1966
412 Ga0373932_0004818 3300035112 Bacteria 3180
413 Ga0373939_0004635 3300035114 Bacteria 3257
414 Ga0373954_0000072 3300035118 Bacteria 35827
415 Ga0373942_0017631 3300035207 Bacteria 1763
416 Ga0373961_0003773 3300035241 Bacteria 3703
417 Ga0373931_0000241 3300035691 Bacteria 23316
418 Ga0373931_0020886 3300035691 Bacteria 3280
419 Ga0373935_0015604 3300035692 Bacteria 4594
420 Ga0373935_0032752 3300035692 Bacteria 3231
421 Ga0373933_0010657 3300035724 Bacteria 5040
422 Ga0316582_0042743 3300036647 Bacteria 2840
423 Ga0395899_0045877 3300037312 Bacteria 3256
424 Ga0395900_0008419 3300037418 Bacteria 10610
425 Ga0395900_0029736 3300037418 Bacteria 5606
426 Ga0316581_0003420 3300037588 Bacteria 3950
427 Ga0395901_0016199 3300038443 Bacteria 7595
428 Ga0395901_0068664 3300038443 Bacteria 3692
429 Ga0436360_0326106 3300039438 Bacteria 7096
430 Ga0439461_0006148 3300041410 Bacteria 2082
431 Ga0439441_000444 3300042001 Bacteria 4417
432 Ga0439443_000977 3300042003 Bacteria 2935
433 Ga0439448_0000598 3300042005 Bacteria 8501
434 Ga0439448_0025415 3300042005 Bacteria 1858
435 Ga0450888_001876 3300042126 Bacteria 2035
436 Ga0439434_0000239 3300042435 Bacteria 15265
437 Ga0439435_0000100 3300042436 Bacteria 10881
438 Ga0439435_0000964 3300042436 Bacteria 5013
439 Ga0439435_0007293 3300042436 Bacteria 2523
440 Ga0439464_0014354 3300042439 Bacteria 2128
441 Ga0439460_0000500 3300042461 Bacteria 8519
442 Ga0439460_0004795 3300042461 Unclassified 3302
443 Ga0451577_0001895 3300042876 Bacteria 26532
444 Ga0451577_0019866 3300042876 Bacteria 6170
445 Ga0451577_0029150 3300042876 Bacteria 4989
446 Ga0451577_0162282 3300042876 Bacteria 2013
447 Ga0453683_0005957 3300044673 Bacteria 8403
448 Ga0453683_0031809 3300044673 Bacteria 3332
449 Ga0466963_0018269 3300044694 Bacteria 4380
450 Ga0453684_0012868 3300044712 Bacteria 13706
451 Ga0451576_0003301 3300045051 Bacteria 22404
452 Ga0451576_0005211 3300045051 Bacteria 16421
453 Ga0451576_0045108 3300045051 Unclassified 4644
454 Ga0451576_0045921 3300045051 Bacteria 4599
455 Ga0451576_0106236 3300045051 Bacteria 2921
456 Ga0451576_0450225 3300045051 Bacteria 1351
457 Ga0466967_0022604 3300045976 Bacteria 5135
458 Ga0466967_0198776 3300045976 Bacteria 1898
459 Ga0495662_0027181 3300046476 Bacteria 2764
460 Ga0495630_0064707 3300046517 Bacteria 2748
461 Ga0495636_0009851 3300047318 Bacteria 3764
462 Ga0496102_0008529 3300048905 Bacteria 8788
463 Ga0496106_0010136 3300048909 Bacteria 6962
464 Ga0496109_0087498 3300048912 Bacteria 2878
465 Ga0496109_0262380 3300048912 Bacteria 1627
466 Ga0501031_0072531 3300049568 Bacteria 2242
467 Ga0501033_0053874 3300049570 Bacteria 2978
468 Ga0501033_0056699 3300049570 Bacteria 2895
469 Ga0501033_0066733 3300049570 Bacteria 2646
470 Ga0501034_0009203 3300049571 Bacteria 10361
471 Ga0501034_0023085 3300049571 Bacteria 6339
472 Ga0501034_0042205 3300049571 Bacteria 4617
473 Ga0501036_0021855 3300049572 Bacteria 5379
474 Ga0501036_0041759 3300049572 Bacteria 3881
475 Ga0501037_0039582 3300049573 Bacteria 3471
476 Ga0501037_0110628 3300049573 Unclassified 1979
477 Ga0501037_0120927 3300049573 Unclassified 1883
478 Ga0501038_0001136 3300049574 Bacteria 24136
479 Ga0501038_0001317 3300049574 Bacteria 22584
480 Ga0501038_0012047 3300049574 Bacteria 7896
481 Ga0501038_0072900 3300049574 Bacteria 2909
482 Ga0501038_0090366 3300049574 Unclassified 2567
483 Ga0501038_0097117 3300049574 Bacteria 2458
484 Ga0501038_0112415 3300049574 Bacteria 2255
485 Ga0501039_0009399 3300049575 Bacteria 7452
486 Ga0501039_0018729 3300049575 Bacteria 5314
487 Ga0501039_0050782 3300049575 Bacteria 3209
488 Ga0501039_0114038 3300049575 Bacteria 2114
489 Ga0501040_0000196 3300049576 Bacteria 35200
490 Ga0501040_0009224 3300049576 Bacteria 6423
491 Ga0501040_0016636 3300049576 Bacteria 4873
492 Ga0501040_0020366 3300049576 Bacteria 4419
493 Ga0501040_0030624 3300049576 Bacteria 3635
494 Ga0501040_0030968 3300049576 Bacteria 3615
495 Ga0501040_0038662 3300049576 Bacteria 3244
496 Ga0501040_0043019 3300049576 Bacteria 3078
497 Ga0501040_0061355 3300049576 Bacteria 2586
498 Ga0501041_0000776 3300049577 Bacteria 17119
499 Ga0501041_0008577 3300049577 Bacteria 6019
500 Ga0501041_0008710 3300049577 Bacteria 5973
501 Ga0501041_0009043 3300049577 Bacteria 5861
502 Ga0501041_0010791 3300049577 Bacteria 5390
503 Ga0501041_0014471 3300049577 Bacteria 4685
504 Ga0501041_0015466 3300049577 Bacteria 4531
505 Ga0501041_0019263 3300049577 Bacteria 4073
506 Ga0501042_0002296 3300049578 Bacteria 11688
507 Ga0501042_0002488 3300049578 Bacteria 11333
508 Ga0501042_0003861 3300049578 Bacteria 9474
509 Ga0501042_0013853 3300049578 Bacteria 5494
510 Ga0501042_0014756 3300049578 Bacteria 5335
511 Ga0501042_0078213 3300049578 Unclassified 2369
512 Ga0501042_0148017 3300049578 Bacteria 1693
513 Ga0501042_0176733 3300049578 Unclassified 1540
514 Ga0501043_0079058 3300049579 Bacteria 2584
515 Ga0501046_0000992 3300049580 Bacteria 27750
516 Ga0501046_0006358 3300049580 Bacteria 10475
517 Ga0501046_0020661 3300049580 Bacteria 5444
518 Ga0501046_0027458 3300049580 Bacteria 4642
519 Ga0501046_0104371 3300049580 Unclassified 2172
520 Ga0501046_0156603 3300049580 Bacteria 1715
521 Ga0501048_0000595 3300049582 Bacteria 25649
522 Ga0501048_0008335 3300049582 Bacteria 7838
523 Ga0501048_0020030 3300049582 Bacteria 4907
524 Ga0501048_0034116 3300049582 Bacteria 3674
525 Ga0501068_0004433 3300049584 Bacteria 7637
526 Ga0501071_0001226 3300049587 Bacteria 14507
527 Ga0501071_0002467 3300049587 Bacteria 11236
528 Ga0501071_0005456 3300049587 Bacteria 8177
529 Ga0501071_0080008 3300049587 Unclassified 2389
530 Ga0501071_0101933 3300049587 Bacteria 2116
531 Ga0501072_0001619 3300049588 Bacteria 16840
532 Ga0501072_0013728 3300049588 Bacteria 6201
533 Ga0501072_0013765 3300049588 Bacteria 6193
534 Ga0501072_0020147 3300049588 Bacteria 5164
535 Ga0501072_0028237 3300049588 Unclassified 4380
536 Ga0501072_0036753 3300049588 Bacteria 3840
537 Ga0501072_0042493 3300049588 Bacteria 3571
538 Ga0501072_0046135 3300049588 Bacteria 3428
539 Ga0501072_0058421 3300049588 Unclassified 3040
540 Ga0501072_0096923 3300049588 Bacteria 2344
541 Ga0501073_0021815 3300049589 Bacteria 4614
542 Ga0501074_0008297 3300049590 Bacteria 7533
543 Ga0501074_0055977 3300049590 Bacteria 2842
544 Ga0501074_0124390 3300049590 Bacteria 1844
545 Ga0501074_0144117 3300049590 Bacteria 1703
546 Ga0501075_0000018 3300049591 Bacteria 68394
547 Ga0501075_0000045 3300049591 Bacteria 50874
548 Ga0501075_0011247 3300049591 Bacteria 6331
549 Ga0501075_0015438 3300049591 Bacteria 5481
550 Ga0501075_0034981 3300049591 Bacteria 3744
551 Ga0501075_0038925 3300049591 Bacteria 3557
552 Ga0501075_0042911 3300049591 Unclassified 3392
553 Ga0501075_0061437 3300049591 Bacteria 2831
554 Ga0501075_0080912 3300049591 Bacteria 2459
555 Ga0501075_0094866 3300049591 Bacteria 2264
556 Ga0501075_0114542 3300049591 Bacteria 2050
557 Ga0501076_0000002 3300049592 Bacteria 165396
558 Ga0501076_0000582 3300049592 Bacteria 23339
559 Ga0501076_0003698 3300049592 Bacteria 10760
560 Ga0501076_0017369 3300049592 Bacteria 5468
561 Ga0501076_0020034 3300049592 Bacteria 5116
562 Ga0501076_0066635 3300049592 Bacteria 2874
563 Ga0501076_0194738 3300049592 Bacteria 1654
564 Ga0501076_0268493 3300049592 Bacteria 1397
565 Ga0501077_0000629 3300049593 Bacteria 21374
566 Ga0501077_0000986 3300049593 Bacteria 17152
567 Ga0501077_0003754 3300049593 Bacteria 9140
568 Ga0501077_0018074 3300049593 Bacteria 4456
569 Ga0501077_0026316 3300049593 Unclassified 3692
570 Ga0501077_0030231 3300049593 Bacteria 3447
571 Ga0501077_0054088 3300049593 Unclassified 2549
572 Ga0501077_0124035 3300049593 Unclassified 1637
573 Ga0501079_0007109 3300049741 Bacteria 8446
574 Ga0501079_0009483 3300049741 Bacteria 7379
575 Ga0501079_0013825 3300049741 Bacteria 6156
576 Ga0501079_0035719 3300049741 Bacteria 3826
577 Ga0501079_0148628 3300049741 Bacteria 1826
578 Ga0501080_0006044 3300049742 Bacteria 10849
579 Ga0501080_0019706 3300049742 Bacteria 6247
580 Ga0501080_0022747 3300049742 Bacteria 5806
581 Ga0501080_0036305 3300049742 Bacteria 4601
582 Ga0501080_0036440 3300049742 Bacteria 4591
583 Ga0501080_0058689 3300049742 Bacteria 3582
584 Ga0501080_0072515 3300049742 Bacteria 3204
585 Ga0501081_0000034 3300049743 Bacteria 50830
586 Ga0501081_0001457 3300049743 Bacteria 14500
587 Ga0501081_0005411 3300049743 Bacteria 8239
588 Ga0501081_0007070 3300049743 Bacteria 7296
589 Ga0501081_0007892 3300049743 Bacteria 6904
590 Ga0501081_0015606 3300049743 Bacteria 5014
591 Ga0501081_0021589 3300049743 Bacteria 4297
592 Ga0501081_0030185 3300049743 Unclassified 3668
593 Ga0501081_0033301 3300049743 Bacteria 3500
594 Ga0501081_0063847 3300049743 Bacteria 2556
595 Ga0501081_0073450 3300049743 Bacteria 2385
596 Ga0501083_0041311 3300049744 Bacteria 3128
597 Ga0501083_0097938 3300049744 Bacteria 1935
598 Ga0501035_0009186 3300049822 Bacteria 9192
599 Ga0501035_0038720 3300049822 Bacteria 4316
600 Ga0501035_0303900 3300049822 Unclassified 1344
601 Ga0501044_0289993 3300049823 Bacteria 1568
602 Ga0501045_0002359 3300049824 Bacteria 12822
603 Ga0501045_0003770 3300049824 Bacteria 10420
604 Ga0501045_0007513 3300049824 Bacteria 7573
605 Ga0501045_0014153 3300049824 Bacteria 5650
606 Ga0501045_0014649 3300049824 Bacteria 5560
607 Ga0501045_0030617 3300049824 Bacteria 3895
608 nmdc:mga0yw44_10686_c1 3300050492 Bacteria 4701
609 nmdc:mga0yw44_42828_c1 3300050492 Bacteria 2701
610 nmdc:mga0k408_34614_c1 3300050493 Bacteria 2892
611 nmdc:mga06z11_38116_c1 3300050494 Bacteria 2385
612 nmdc:mga05p37_11225_c1 3300050507 Bacteria 10650
613 nmdc:mga05p37_348_c1 3300050507 Bacteria 49472
614 nmdc:mga05p37_55094_c1 3300050507 Unclassified 4892
615 nmdc:mga05p37_639_c1 3300050507 Bacteria 38794
616 nmdc:mga09592_154349_c1 3300050508 Bacteria 1982
617 nmdc:mga09592_23032_c1 3300050508 Bacteria 5139
618 nmdc:mga09592_55031_c1 3300050508 Bacteria 3362
619 nmdc:mga0qj67_13348_c1 3300050509 Bacteria 6200
620 nmdc:mga0qj67_150851_c1 3300050509 Bacteria 1886
621 nmdc:mga0qj67_16106_c1 3300050509 Bacteria 5664
622 nmdc:mga0qj67_19814_c1 3300050509 Bacteria 5145
623 nmdc:mga0qj67_2861_c1 3300050509 Bacteria 12379
624 nmdc:mga0qj67_98774_c1 3300050509 Bacteria 2352
625 nmdc:mga06r32_148250_c1 3300050510 Bacteria 2324
626 nmdc:mga06r32_15989_c1 3300050510 Bacteria 6828
627 nmdc:mga06r32_222516_c1 3300050510 Unclassified 1876
628 nmdc:mga06r32_270552_c1 3300050510 Bacteria 1686
629 nmdc:mga06r32_51_c2 3300050510 Bacteria 15915
630 nmdc:mga06r32_8310_c1 3300050510 Bacteria 9341
631 nmdc:mga08y16_15684_c1 3300050511 Bacteria 7969
632 nmdc:mga08y16_16747_c1 3300050511 Bacteria 7714
633 nmdc:mga08y16_23916_c1 3300050511 Bacteria 6452
634 nmdc:mga08y16_49798_c1 3300050511 Bacteria 4384
635 nmdc:mga08y16_63236_c1 3300050511 Bacteria 3865
636 nmdc:mga08y16_948_c1 3300050511 Bacteria 28184
637 nmdc:mga0n895_1137_c1 3300050512 Bacteria 19479
638 nmdc:mga0n895_18599_c1 3300050512 Bacteria 6434
639 nmdc:mga0n895_191421_c1 3300050512 Unclassified 2076
640 nmdc:mga0n895_19353_c1 3300050512 Bacteria 6326
641 nmdc:mga0rr50_200182_c1 3300050513 Bacteria 1641
642 nmdc:mga0rr50_3387_c1 3300050513 Bacteria 9164
643 nmdc:mga0rr50_8575_c1 3300050513 Bacteria 6372
644 nmdc:mga0rr50_8702_c1 3300050513 Bacteria 6330
645 nmdc:mga0rr50_9028_c1 3300050513 Bacteria 6238
646 nmdc:mga08x19_21784_c1 3300050514 Bacteria 3961
647 nmdc:mga08x19_84606_c1 3300050514 Bacteria 2087
648 nmdc:mga0a205_1929_c1 3300050515 Bacteria 18001
649 nmdc:mga0a205_4612_c1 3300050515 Bacteria 12357
650 nmdc:mga0a205_8497_c1 3300050515 Bacteria 9341
651 nmdc:mga0a205_9216_c1 3300050515 Bacteria 9011
652 nmdc:mga0a205_9854_c1 3300050515 Bacteria 8765
653 nmdc:mga0sz30_416_c1 3300050516 Bacteria 16174
654 Ga0500641_0020317 3300053096 Bacteria 2520
655 Ga0500616_0026581 3300053153 Bacteria 3201
656 Ga0501084_0000335 3300054114 Bacteria 35922
657 Ga0501084_0003030 3300054114 Bacteria 13615
658 Ga0501084_0004843 3300054114 Bacteria 10996
659 Ga0501084_0027927 3300054114 Bacteria 4715
660 Ga0501084_0042926 3300054114 Bacteria 3783
661 Ga0501084_0048643 3300054114 Bacteria 3549
662 Ga0501084_0054286 3300054114 Bacteria 3352
663 Ga0501084_0055663 3300054114 Unclassified 3309
664 Ga0501084_0063952 3300054114 Bacteria 3081
665 Ga0501082_0000148 3300060353 Bacteria 58835
666 Ga0501082_0002429 3300060353 Bacteria 16353
667 Ga0501082_0012910 3300060353 Bacteria 7181
668 Ga0501082_0013681 3300060353 Bacteria 6975
669 Ga0501082_0016482 3300060353 Bacteria 6359
670 Ga0501082_0023461 3300060353 Bacteria 5323
671 Ga0501082_0031111 3300060353 Bacteria 4600
672 Ga0501082_0039344 3300060353 Bacteria 4079
673 Ga0501082_0042384 3300060353 Bacteria 3924
674 Ga0501082_0083920 3300060353 Bacteria 2748
675 Ga0530510_0000021 3300061734 Bacteria 75113
676 Ga0530510_0000493 3300061734 Bacteria 25166
677 Ga0530510_0000909 3300061734 Bacteria 19527
678 Ga0530510_0003541 3300061734 Bacteria 10754
679 Ga0530510_0036733 3300061734 Bacteria 3530
680 Ga0530510_0051544 3300061734 Bacteria 2974
681 Ga0530510_0053377 3300061734 Bacteria 2921

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0110628 Ga0501037_0110628_812_1969 381
2 3300049822 Ga0501035_0303900 Ga0501035_0303900_121_1320 395
3 3300045051 Ga0451576_0450225 Ga0451576_0450225_88_1293 398
4 3300049578 Ga0501042_0078213 Ga0501042_0078213_1137_2342 398
5 3300049588 Ga0501072_0058421 Ga0501072_0058421_35_1240 398
6 3300050508 nmdc:mga09592_154349_c1 nmdc:mga09592_154349_c1_10_1215 398
7 3300045976 Ga0466967_0022604 Ga0466967_0022604_14_1300 416
8 3300049592 Ga0501076_0268493 Ga0501076_0268493_74_1372 428
9 3300049574 Ga0501038_0090366 Ga0501038_0090366_1247_2551 431
10 3300031728 Ga0316578_10018812 Ga0316578_100188122 437
11 3300032133 Ga0316583_10016133 Ga0316583_100161331 437
12 3300036647 Ga0316582_0042743 Ga0316582_0042743_305_1675 437
13 3300037588 Ga0316581_0003420 Ga0316581_0003420_429_1799 437
14 3300061734 Ga0530510_0000909 Ga0530510_0000909_2733_4070 441
15 3300031852 Ga0307410_10034351 Ga0307410_100343512 442
16 3300027378 Ga0209981_1000615 Ga0209981_10006152 447
17 3300027462 Ga0210000_1003174 Ga0210000_10031742 447
18 3300027471 Ga0209995_1002434 Ga0209995_10024342 447
19 3300005334 Ga0068869_100004150 Ga0068869_1000041506 450
20 3300005347 Ga0070668_100160924 Ga0070668_1001609242 450
21 3300005353 Ga0070669_100111142 Ga0070669_1001111422 450
22 3300005456 Ga0070678_100008275 Ga0070678_1000082752 450
23 3300005543 Ga0070672_100014473 Ga0070672_1000144732 450
24 3300005844 Ga0068862_100187319 Ga0068862_1001873191 450
25 3300009148 Ga0105243_10011356 Ga0105243_100113565 450
26 3300009553 Ga0105249_10093938 Ga0105249_100939383 450
27 3300013306 Ga0163162_10152154 Ga0163162_101521541 450
28 3300025936 Ga0207670_10041599 Ga0207670_100415993 450
29 3300025940 Ga0207691_10007330 Ga0207691_100073307 450
30 3300025942 Ga0207689_10005712 Ga0207689_100057127 450
31 3300026089 Ga0207648_10007171 Ga0207648_100071719 450
32 3300026121 Ga0207683_10009224 Ga0207683_100092246 450
33 3300042439 Ga0439464_0014354 Ga0439464_0014354_749_2110 450
34 3300013297 Ga0157378_10025324 Ga0157378_100253243 451
35 3300005336 Ga0070680_100166991 Ga0070680_1001669912 452
36 3300005548 Ga0070665_100230993 Ga0070665_1002309932 452
37 3300005841 Ga0068863_100278798 Ga0068863_1002787981 452
38 3300025908 Ga0207643_10033109 Ga0207643_100331093 452
39 3300025938 Ga0207704_10156166 Ga0207704_101561661 452
40 3300047318 Ga0495636_0009851 Ga0495636_0009851_493_1866 452
41 3300005330 Ga0070690_100078556 Ga0070690_1000785562 453
42 3300005336 Ga0070680_100019471 Ga0070680_1000194715 453
43 3300005340 Ga0070689_100038207 Ga0070689_1000382072 453
44 3300005345 Ga0070692_10004219 Ga0070692_100042195 453
45 3300005347 Ga0070668_100105775 Ga0070668_1001057752 453
46 3300005354 Ga0070675_100094983 Ga0070675_1000949833 453
47 3300005441 Ga0070700_100000652 Ga0070700_10000065213 453
48 3300005459 Ga0068867_100000876 Ga0068867_10000087614 453
49 3300005543 Ga0070672_100128913 Ga0070672_1001289132 453
50 3300005719 Ga0068861_100004028 Ga0068861_1000040285 453
51 3300005844 Ga0068862_100001923 Ga0068862_1000019239 453
52 3300006852 Ga0075433_10000184 Ga0075433_1000018429 453
53 3300006871 Ga0075434_100002746 Ga0075434_10000274620 453
54 3300006914 Ga0075436_100004153 Ga0075436_1000041536 453
55 3300007076 Ga0075435_100001390 Ga0075435_10000139020 453
56 3300009094 Ga0111539_10024762 Ga0111539_100247623 453
57 3300009147 Ga0114129_10027640 Ga0114129_100276404 453
58 3300009148 Ga0105243_10003195 Ga0105243_1000319514 453
59 3300009553 Ga0105249_10005966 Ga0105249_100059667 453
60 3300014326 Ga0157380_10037451 Ga0157380_100374511 453
61 3300014745 Ga0157377_10013374 Ga0157377_100133744 453
62 3300025917 Ga0207660_10062844 Ga0207660_100628442 453
63 3300025935 Ga0207709_10005588 Ga0207709_100055885 453
64 3300025936 Ga0207670_10112279 Ga0207670_101122792 453
65 3300025942 Ga0207689_10011411 Ga0207689_100114114 453
66 3300025961 Ga0207712_10005617 Ga0207712_100056174 453
67 3300025972 Ga0207668_10004756 Ga0207668_100047565 453
68 3300027360 Ga0209969_1003079 Ga0209969_10030792 453
69 3300027526 Ga0209968_1001670 Ga0209968_10016703 453
70 3300027695 Ga0209966_1002924 Ga0209966_10029242 453
71 3300028380 Ga0268265_10000922 Ga0268265_1000092217 453
72 3300035090 Ga0373949_0002144 Ga0373949_0002144_591_1961 453
73 3300035091 Ga0373951_0004297 Ga0373951_0004297_224_1594 453
74 3300035112 Ga0373932_0004818 Ga0373932_0004818_1341_2711 453
75 3300035114 Ga0373939_0004635 Ga0373939_0004635_1226_2596 453
76 3300035241 Ga0373961_0003773 Ga0373961_0003773_1651_3021 453
77 3300035691 Ga0373931_0000241 Ga0373931_0000241_19845_21215 453
78 3300041410 Ga0439461_0006148 Ga0439461_0006148_17_1387 453
79 3300042435 Ga0439434_0000239 Ga0439434_0000239_10324_11694 453
80 3300042436 Ga0439435_0000100 Ga0439435_0000100_5054_6424 453
81 3300049588 Ga0501072_0046135 Ga0501072_0046135_577_1947 453
82 3300049589 Ga0501073_0021815 Ga0501073_0021815_3086_4459 453
83 3300049591 Ga0501075_0038925 Ga0501075_0038925_1935_3305 453
84 3300049593 Ga0501077_0003754 Ga0501077_0003754_1115_2485 453
85 3300050508 nmdc:mga09592_23032_c1 nmdc:mga09592_23032_c1_3574_4944 453
86 3300050511 nmdc:mga08y16_16747_c1 nmdc:mga08y16_16747_c1_5718_7088 453
87 3300050511 nmdc:mga08y16_948_c1 nmdc:mga08y16_948_c1_5728_7098 453
88 3300050512 nmdc:mga0n895_18599_c1 nmdc:mga0n895_18599_c1_3884_5254 453
89 3300050513 nmdc:mga0rr50_3387_c1 nmdc:mga0rr50_3387_c1_5223_6593 453
90 3300050514 nmdc:mga08x19_84606_c1 nmdc:mga08x19_84606_c1_312_1682 453
91 3300050515 nmdc:mga0a205_9854_c1 nmdc:mga0a205_9854_c1_2342_3712 453
92 3300005328 Ga0070676_10000164 Ga0070676_1000016421 454
93 3300005330 Ga0070690_100029769 Ga0070690_1000297695 454
94 3300005331 Ga0070670_100001252 Ga0070670_1000012529 454
95 3300005334 Ga0068869_100000789 Ga0068869_10000078915 454
96 3300005335 Ga0070666_10039039 Ga0070666_100390393 454
97 3300005336 Ga0070680_100003118 Ga0070680_1000031182 454
98 3300005337 Ga0070682_100000147 Ga0070682_10000014713 454
99 3300005338 Ga0068868_100086921 Ga0068868_1000869212 454
100 3300005339 Ga0070660_100000639 Ga0070660_10000063910 454
101 3300005340 Ga0070689_100023306 Ga0070689_1000233066 454
102 3300005344 Ga0070661_100001058 Ga0070661_10000105815 454
103 3300005345 Ga0070692_10005256 Ga0070692_100052563 454
104 3300005345 Ga0070692_10051606 Ga0070692_100516062 454
105 3300005347 Ga0070668_100060420 Ga0070668_1000604203 454
106 3300005353 Ga0070669_100073493 Ga0070669_1000734933 454
107 3300005364 Ga0070673_100030068 Ga0070673_1000300685 454
108 3300005366 Ga0070659_100001053 Ga0070659_10000105312 454
109 3300005440 Ga0070705_100004619 Ga0070705_1000046198 454
110 3300005440 Ga0070705_100006953 Ga0070705_1000069533 454
111 3300005444 Ga0070694_100000490 Ga0070694_10000049013 454
112 3300005444 Ga0070694_100021721 Ga0070694_1000217212 454
113 3300005445 Ga0070708_100038364 Ga0070708_1000383645 454
114 3300005457 Ga0070662_100078612 Ga0070662_1000786122 454
115 3300005458 Ga0070681_10002249 Ga0070681_1000224913 454
116 3300005459 Ga0068867_100003046 Ga0068867_1000030469 454
117 3300005467 Ga0070706_100090638 Ga0070706_1000906382 454
118 3300005471 Ga0070698_100080951 Ga0070698_1000809512 454
119 3300005535 Ga0070684_100077425 Ga0070684_1000774252 454
120 3300005539 Ga0068853_100001868 Ga0068853_10000186812 454
121 3300005545 Ga0070695_100018893 Ga0070695_1000188936 454
122 3300005546 Ga0070696_100002890 Ga0070696_1000028902 454
123 3300005547 Ga0070693_100000088 Ga0070693_10000008828 454
124 3300005549 Ga0070704_100000580 Ga0070704_10000058019 454
125 3300005563 Ga0068855_100001859 Ga0068855_10000185920 454
126 3300005577 Ga0068857_100007072 Ga0068857_10000707211 454
127 3300005578 Ga0068854_100008881 Ga0068854_1000088817 454
128 3300005614 Ga0068856_100001089 Ga0068856_10000108920 454
129 3300005615 Ga0070702_100016589 Ga0070702_1000165895 454
130 3300005617 Ga0068859_100002050 Ga0068859_10000205023 454
131 3300005617 Ga0068859_100115241 Ga0068859_1001152412 454
132 3300005618 Ga0068864_100023302 Ga0068864_1000233024 454
133 3300005840 Ga0068870_10005480 Ga0068870_100054803 454
134 3300005841 Ga0068863_100040138 Ga0068863_1000401383 454
135 3300005841 Ga0068863_100088950 Ga0068863_1000889501 454
136 3300005842 Ga0068858_100152692 Ga0068858_1001526921 454
137 3300005843 Ga0068860_100044918 Ga0068860_1000449182 454
138 3300005843 Ga0068860_100122453 Ga0068860_1001224532 454
139 3300006358 Ga0068871_100004074 Ga0068871_1000040743 454
140 3300006931 Ga0097620_100002051 Ga0097620_10000205123 454
141 3300006931 Ga0097620_100115242 Ga0097620_1001152422 454
142 3300009174 Ga0105241_10000541 Ga0105241_1000054133 454
143 3300013100 Ga0157373_10000397 Ga0157373_1000039728 454
144 3300013102 Ga0157371_10074613 Ga0157371_100746132 454
145 3300013105 Ga0157369_10004373 Ga0157369_1000437319 454
146 3300013307 Ga0157372_10001274 Ga0157372_1000127413 454
147 3300013308 Ga0157375_10031192 Ga0157375_100311927 454
148 3300014325 Ga0163163_10039414 Ga0163163_100394143 454
149 3300015262 Ga0182007_10008718 Ga0182007_100087182 454
150 3300025907 Ga0207645_10000397 Ga0207645_1000039721 454
151 3300025908 Ga0207643_10001176 Ga0207643_1000117614 454
152 3300025910 Ga0207684_10050713 Ga0207684_100507131 454
153 3300025911 Ga0207654_10000830 Ga0207654_1000083013 454
154 3300025912 Ga0207707_10000078 Ga0207707_1000007858 454
155 3300025917 Ga0207660_10000335 Ga0207660_1000033526 454
156 3300025917 Ga0207660_10043397 Ga0207660_100433971 454
157 3300025919 Ga0207657_10000171 Ga0207657_1000017157 454
158 3300025920 Ga0207649_10001560 Ga0207649_100015601 454
159 3300025921 Ga0207652_10002588 Ga0207652_1000258814 454
160 3300025922 Ga0207646_10001625 Ga0207646_1000162529 454
161 3300025932 Ga0207690_10000917 Ga0207690_1000091711 454
162 3300025933 Ga0207706_10001320 Ga0207706_1000132018 454
163 3300025942 Ga0207689_10000145 Ga0207689_1000014534 454
164 3300025945 Ga0207679_10001573 Ga0207679_100015734 454
165 3300025949 Ga0207667_10001678 Ga0207667_100016789 454
166 3300025960 Ga0207651_10002196 Ga0207651_100021962 454
167 3300025972 Ga0207668_10003150 Ga0207668_100031508 454
168 3300025981 Ga0207640_10001797 Ga0207640_1000179713 454
169 3300026023 Ga0207677_10112699 Ga0207677_101126991 454
170 3300026041 Ga0207639_10001047 Ga0207639_100010479 454
171 3300026067 Ga0207678_10002480 Ga0207678_1000248014 454
172 3300026078 Ga0207702_10001916 Ga0207702_1000191614 454
173 3300026088 Ga0207641_10024315 Ga0207641_100243153 454
174 3300026088 Ga0207641_10096781 Ga0207641_100967812 454
175 3300026089 Ga0207648_10007874 Ga0207648_1000787410 454
176 3300026095 Ga0207676_10037544 Ga0207676_100375444 454
177 3300026116 Ga0207674_10000650 Ga0207674_1000065028 454
178 3300026118 Ga0207675_100030585 Ga0207675_1000305853 454
179 3300026121 Ga0207683_10105089 Ga0207683_101050891 454
180 3300028379 Ga0268266_10012759 Ga0268266_100127594 454
181 3300028380 Ga0268265_10011548 Ga0268265_100115486 454
182 3300028381 Ga0268264_10003021 Ga0268264_100030216 454
183 3300028381 Ga0268264_10090445 Ga0268264_100904452 454
184 3300028381 Ga0268264_10126364 Ga0268264_101263641 454
185 3300035091 Ga0373951_0011778 Ga0373951_0011778_342_1724 454
186 3300042005 Ga0439448_0000598 Ga0439448_0000598_4252_5634 454
187 3300042876 Ga0451577_0019866 Ga0451577_0019866_3657_5039 454
188 3300042876 Ga0451577_0029150 Ga0451577_0029150_35_1411 454
189 3300044673 Ga0453683_0005957 Ga0453683_0005957_1140_2516 454
190 3300045051 Ga0451576_0106236 Ga0451576_0106236_140_1522 454
191 3300048905 Ga0496102_0008529 Ga0496102_0008529_2636_4018 454
192 3300048909 Ga0496106_0010136 Ga0496106_0010136_5129_6511 454
193 3300048912 Ga0496109_0262380 Ga0496109_0262380_204_1586 454
194 3300049577 Ga0501041_0015466 Ga0501041_0015466_1765_3138 454
195 3300049824 Ga0501045_0030617 Ga0501045_0030617_2406_3779 454
196 3300005330 Ga0070690_100019776 Ga0070690_1000197762 455
197 3300005331 Ga0070670_100003427 Ga0070670_1000034276 455
198 3300005331 Ga0070670_100069704 Ga0070670_1000697042 455
199 3300005334 Ga0068869_100080735 Ga0068869_1000807352 455
200 3300005340 Ga0070689_100041882 Ga0070689_1000418824 455
201 3300005341 Ga0070691_10027934 Ga0070691_100279342 455
202 3300005343 Ga0070687_100046879 Ga0070687_1000468792 455
203 3300005353 Ga0070669_100020709 Ga0070669_1000207092 455
204 3300005354 Ga0070675_100007866 Ga0070675_1000078666 455
205 3300005354 Ga0070675_100011711 Ga0070675_1000117115 455
206 3300005364 Ga0070673_100003829 Ga0070673_1000038297 455
207 3300005438 Ga0070701_10027788 Ga0070701_100277883 455
208 3300005440 Ga0070705_100030761 Ga0070705_1000307612 455
209 3300005444 Ga0070694_100000164 Ga0070694_10000016416 455
210 3300005444 Ga0070694_100041987 Ga0070694_1000419873 455
211 3300005457 Ga0070662_100016778 Ga0070662_1000167782 455
212 3300005471 Ga0070698_100026914 Ga0070698_1000269147 455
213 3300005471 Ga0070698_100195307 Ga0070698_1001953072 455
214 3300005518 Ga0070699_100111465 Ga0070699_1001114653 455
215 3300005536 Ga0070697_100149919 Ga0070697_1001499192 455
216 3300005543 Ga0070672_100002353 Ga0070672_1000023536 455
217 3300005543 Ga0070672_100185300 Ga0070672_1001853001 455
218 3300005545 Ga0070695_100001300 Ga0070695_1000013005 455
219 3300005545 Ga0070695_100022662 Ga0070695_1000226622 455
220 3300005545 Ga0070695_100098783 Ga0070695_1000987832 455
221 3300005546 Ga0070696_100022222 Ga0070696_1000222223 455
222 3300005546 Ga0070696_100051489 Ga0070696_1000514893 455
223 3300005547 Ga0070693_100077520 Ga0070693_1000775202 455
224 3300005549 Ga0070704_100078761 Ga0070704_1000787612 455
225 3300005577 Ga0068857_100147518 Ga0068857_1001475183 455
226 3300005618 Ga0068864_100006436 Ga0068864_1000064366 455
227 3300005841 Ga0068863_100001012 Ga0068863_1000010126 455
228 3300005843 Ga0068860_100088392 Ga0068860_1000883922 455
229 3300005843 Ga0068860_100139237 Ga0068860_1001392372 455
230 3300006846 Ga0075430_100015771 Ga0075430_1000157716 455
231 3300006847 Ga0075431_100049276 Ga0075431_1000492766 455
232 3300006847 Ga0075431_100072345 Ga0075431_1000723452 455
233 3300006852 Ga0075433_10006577 Ga0075433_100065776 455
234 3300006914 Ga0075436_100010219 Ga0075436_1000102193 455
235 3300009094 Ga0111539_10044598 Ga0111539_100445983 455
236 3300009098 Ga0105245_10262176 Ga0105245_102621761 455
237 3300009148 Ga0105243_10063427 Ga0105243_100634272 455
238 3300009177 Ga0105248_10031847 Ga0105248_100318479 455
239 3300013306 Ga0163162_10057168 Ga0163162_100571683 455
240 3300013306 Ga0163162_10212000 Ga0163162_102120002 455
241 3300013308 Ga0157375_10015727 Ga0157375_100157272 455
242 3300013308 Ga0157375_10145870 Ga0157375_101458701 455
243 3300013308 Ga0157375_10233731 Ga0157375_102337311 455
244 3300014325 Ga0163163_10005091 Ga0163163_100050916 455
245 3300014969 Ga0157376_10014370 Ga0157376_100143702 455
246 3300025910 Ga0207684_10005312 Ga0207684_1000531210 455
247 3300025923 Ga0207681_10048338 Ga0207681_100483383 455
248 3300025925 Ga0207650_10004272 Ga0207650_100042726 455
249 3300025925 Ga0207650_10145627 Ga0207650_101456272 455
250 3300025939 Ga0207665_10001524 Ga0207665_1000152417 455
251 3300025940 Ga0207691_10033432 Ga0207691_100334322 455
252 3300025942 Ga0207689_10115191 Ga0207689_101151912 455
253 3300025960 Ga0207651_10011420 Ga0207651_100114204 455
254 3300025960 Ga0207651_10013977 Ga0207651_100139774 455
255 3300026075 Ga0207708_10123599 Ga0207708_101235992 455
256 3300026088 Ga0207641_10001097 Ga0207641_1000109714 455
257 3300026089 Ga0207648_10089993 Ga0207648_100899932 455
258 3300026095 Ga0207676_10007102 Ga0207676_100071026 455
259 3300026116 Ga0207674_10185202 Ga0207674_101852022 455
260 3300027671 Ga0209588_1006914 Ga0209588_10069142 455
261 3300027695 Ga0209966_1000700 Ga0209966_10007009 455
262 3300028380 Ga0268265_10061839 Ga0268265_100618391 455
263 3300028381 Ga0268264_10155219 Ga0268264_101552192 455
264 3300031548 Ga0307408_100096726 Ga0307408_1000967262 455
265 3300035090 Ga0373949_0009796 Ga0373949_0009796_292_1683 455
266 3300042003 Ga0439443_000977 Ga0439443_000977_1446_2852 455
267 3300042436 Ga0439435_0000964 Ga0439435_0000964_2015_3421 455
268 3300042436 Ga0439435_0007293 Ga0439435_0007293_703_2085 455
269 3300042461 Ga0439460_0000500 Ga0439460_0000500_1955_3361 455
270 3300045051 Ga0451576_0003301 Ga0451576_0003301_8763_10154 455
271 3300045051 Ga0451576_0045921 Ga0451576_0045921_2556_3944 455
272 3300049568 Ga0501031_0072531 Ga0501031_0072531_796_2175 455
273 3300049570 Ga0501033_0056699 Ga0501033_0056699_1029_2408 455
274 3300049570 Ga0501033_0066733 Ga0501033_0066733_871_2259 455
275 3300049572 Ga0501036_0021855 Ga0501036_0021855_2317_3696 455
276 3300049574 Ga0501038_0012047 Ga0501038_0012047_854_2233 455
277 3300049574 Ga0501038_0097117 Ga0501038_0097117_580_1962 455
278 3300049575 Ga0501039_0018729 Ga0501039_0018729_136_1515 455
279 3300049575 Ga0501039_0050782 Ga0501039_0050782_1229_2614 455
280 3300049576 Ga0501040_0009224 Ga0501040_0009224_272_1651 455
281 3300049576 Ga0501040_0043019 Ga0501040_0043019_1218_2600 455
282 3300049577 Ga0501041_0009043 Ga0501041_0009043_4277_5656 455
283 3300049577 Ga0501041_0010791 Ga0501041_0010791_3105_4490 455
284 3300049577 Ga0501041_0019263 Ga0501041_0019263_674_2056 455
285 3300049578 Ga0501042_0003861 Ga0501042_0003861_1854_3233 455
286 3300049578 Ga0501042_0148017 Ga0501042_0148017_75_1454 455
287 3300049579 Ga0501043_0079058 Ga0501043_0079058_914_2293 455
288 3300049580 Ga0501046_0027458 Ga0501046_0027458_164_1543 455
289 3300049580 Ga0501046_0156603 Ga0501046_0156603_137_1516 455
290 3300049582 Ga0501048_0000595 Ga0501048_0000595_2474_3853 455
291 3300049584 Ga0501068_0004433 Ga0501068_0004433_3958_5337 455
292 3300049587 Ga0501071_0005456 Ga0501071_0005456_5830_7209 455
293 3300049588 Ga0501072_0013728 Ga0501072_0013728_664_2046 455
294 3300049588 Ga0501072_0036753 Ga0501072_0036753_1979_3358 455
295 3300049588 Ga0501072_0096923 Ga0501072_0096923_601_1989 455
296 3300049590 Ga0501074_0008297 Ga0501074_0008297_488_1867 455
297 3300049590 Ga0501074_0055977 Ga0501074_0055977_869_2257 455
298 3300049591 Ga0501075_0034981 Ga0501075_0034981_2310_3689 455
299 3300049591 Ga0501075_0094866 Ga0501075_0094866_207_1589 455
300 3300049592 Ga0501076_0000582 Ga0501076_0000582_15392_16771 455
301 3300049592 Ga0501076_0066635 Ga0501076_0066635_982_2370 455
302 3300049593 Ga0501077_0000986 Ga0501077_0000986_9383_10762 455
303 3300049593 Ga0501077_0030231 Ga0501077_0030231_1315_2694 455
304 3300049741 Ga0501079_0007109 Ga0501079_0007109_644_2023 455
305 3300049741 Ga0501079_0013825 Ga0501079_0013825_2622_4010 455
306 3300049741 Ga0501079_0035719 Ga0501079_0035719_586_1968 455
307 3300049742 Ga0501080_0022747 Ga0501080_0022747_3937_5316 455
308 3300049742 Ga0501080_0036305 Ga0501080_0036305_627_2015 455
309 3300049742 Ga0501080_0058689 Ga0501080_0058689_1098_2477 455
310 3300049743 Ga0501081_0007070 Ga0501081_0007070_398_1777 455
311 3300049743 Ga0501081_0015606 Ga0501081_0015606_1098_2477 455
312 3300049743 Ga0501081_0021589 Ga0501081_0021589_2552_3940 455
313 3300049743 Ga0501081_0073450 Ga0501081_0073450_662_2044 455
314 3300049744 Ga0501083_0041311 Ga0501083_0041311_1259_2638 455
315 3300049822 Ga0501035_0009186 Ga0501035_0009186_995_2374 455
316 3300049824 Ga0501045_0007513 Ga0501045_0007513_5798_7177 455
317 3300050507 nmdc:mga05p37_11225_c1 nmdc:mga05p37_11225_c1_4866_6257 455
318 3300050509 nmdc:mga0qj67_13348_c1 nmdc:mga0qj67_13348_c1_3566_4948 455
319 3300050509 nmdc:mga0qj67_19814_c1 nmdc:mga0qj67_19814_c1_1064_2446 455
320 3300050510 nmdc:mga06r32_270552_c1 nmdc:mga06r32_270552_c1_155_1561 455
321 3300050511 nmdc:mga08y16_63236_c1 nmdc:mga08y16_63236_c1_1178_2560 455
322 3300050512 nmdc:mga0n895_191421_c1 nmdc:mga0n895_191421_c1_505_1881 455
323 3300050513 nmdc:mga0rr50_8575_c1 nmdc:mga0rr50_8575_c1_4900_6291 455
324 3300050513 nmdc:mga0rr50_8702_c1 nmdc:mga0rr50_8702_c1_805_2196 455
325 3300050514 nmdc:mga08x19_21784_c1 nmdc:mga08x19_21784_c1_805_2196 455
326 3300050515 nmdc:mga0a205_8497_c1 nmdc:mga0a205_8497_c1_4129_5520 455
327 3300054114 Ga0501084_0004843 Ga0501084_0004843_5904_7283 455
328 3300054114 Ga0501084_0048643 Ga0501084_0048643_437_1825 455
329 3300060353 Ga0501082_0023461 Ga0501082_0023461_2402_3790 455
330 3300060353 Ga0501082_0031111 Ga0501082_0031111_1495_2874 455
331 3300060353 Ga0501082_0039344 Ga0501082_0039344_682_2064 455
332 3300060353 Ga0501082_0083920 Ga0501082_0083920_1235_2623 455
333 3300061734 Ga0530510_0000493 Ga0530510_0000493_646_2028 455
334 3300061734 Ga0530510_0003541 Ga0530510_0003541_7322_8701 455
335 3300005329 Ga0070683_100060244 Ga0070683_1000602444 456
336 3300005339 Ga0070660_100010235 Ga0070660_1000102352 456
337 3300005344 Ga0070661_100005227 Ga0070661_1000052278 456
338 3300005347 Ga0070668_100032129 Ga0070668_1000321294 456
339 3300005366 Ga0070659_100028702 Ga0070659_1000287022 456
340 3300005435 Ga0070714_100008956 Ga0070714_1000089567 456
341 3300005440 Ga0070705_100071663 Ga0070705_1000716632 456
342 3300005458 Ga0070681_10138481 Ga0070681_101384812 456
343 3300005535 Ga0070684_100035943 Ga0070684_1000359432 456
344 3300005539 Ga0068853_100104081 Ga0068853_1001040812 456
345 3300005564 Ga0070664_100023948 Ga0070664_1000239485 456
346 3300005577 Ga0068857_100004059 Ga0068857_1000040595 456
347 3300005834 Ga0068851_10015934 Ga0068851_100159344 456
348 3300005844 Ga0068862_100057883 Ga0068862_1000578834 456
349 3300006846 Ga0075430_100004062 Ga0075430_1000040623 456
350 3300006847 Ga0075431_100011522 Ga0075431_1000115224 456
351 3300006880 Ga0075429_100005736 Ga0075429_1000057362 456
352 3300009093 Ga0105240_10012112 Ga0105240_100121126 456
353 3300009093 Ga0105240_10093438 Ga0105240_100934382 456
354 3300009174 Ga0105241_10034519 Ga0105241_100345192 456
355 3300009177 Ga0105248_10354541 Ga0105248_103545411 456
356 3300009545 Ga0105237_10056368 Ga0105237_100563684 456
357 3300009551 Ga0105238_10150055 Ga0105238_101500551 456
358 3300013100 Ga0157373_10023936 Ga0157373_100239364 456
359 3300013102 Ga0157371_10062440 Ga0157371_100624402 456
360 3300013104 Ga0157370_10204317 Ga0157370_102043172 456
361 3300025911 Ga0207654_10085733 Ga0207654_100857333 456
362 3300025919 Ga0207657_10045828 Ga0207657_100458284 456
363 3300025920 Ga0207649_10036128 Ga0207649_100361282 456
364 3300025924 Ga0207694_10046641 Ga0207694_100466413 456
365 3300025929 Ga0207664_10067889 Ga0207664_100678892 456
366 3300025940 Ga0207691_10002783 Ga0207691_100027836 456
367 3300026116 Ga0207674_10004811 Ga0207674_100048119 456
368 3300046476 Ga0495662_0027181 Ga0495662_0027181_232_1617 456
369 3300046517 Ga0495630_0064707 Ga0495630_0064707_213_1598 456
370 3300049574 Ga0501038_0112415 Ga0501038_0112415_101_1480 456
371 3300049575 Ga0501039_0114038 Ga0501039_0114038_125_1504 456
372 3300049577 Ga0501041_0014471 Ga0501041_0014471_2688_4067 456
373 3300049578 Ga0501042_0176733 Ga0501042_0176733_122_1504 456
374 3300049587 Ga0501071_0002467 Ga0501071_0002467_3412_4791 456
375 3300049587 Ga0501071_0101933 Ga0501071_0101933_575_1954 456
376 3300049590 Ga0501074_0144117 Ga0501074_0144117_178_1557 456
377 3300049591 Ga0501075_0015438 Ga0501075_0015438_321_1700 456
378 3300049591 Ga0501075_0114542 Ga0501075_0114542_220_1596 456
379 3300049742 Ga0501080_0006044 Ga0501080_0006044_6821_8200 456
380 3300049742 Ga0501080_0019706 Ga0501080_0019706_3807_5186 456
381 3300049743 Ga0501081_0033301 Ga0501081_0033301_1431_2810 456
382 3300049824 Ga0501045_0014649 Ga0501045_0014649_3874_5253 456
383 3300050509 nmdc:mga0qj67_2861_c1 nmdc:mga0qj67_2861_c1_3253_4632 456
384 3300054114 Ga0501084_0027927 Ga0501084_0027927_84_1463 456
385 3300061734 Ga0530510_0036733 Ga0530510_0036733_1229_2608 456
386 3300005548 Ga0070665_100008670 Ga0070665_1000086701 457
387 3300005563 Ga0068855_100370508 Ga0068855_1003705081 457
388 3300005937 Ga0081455_10000824 Ga0081455_1000082439 457
389 3300005985 Ga0081539_10000797 Ga0081539_1000079738 457
390 3300006038 Ga0075365_10086033 Ga0075365_100860332 457
391 3300006042 Ga0075368_10047499 Ga0075368_100474992 457
392 3300006844 Ga0075428_100002789 Ga0075428_1000027895 457
393 3300006844 Ga0075428_100332366 Ga0075428_1003323661 457
394 3300006846 Ga0075430_100019910 Ga0075430_1000199102 457
395 3300006847 Ga0075431_100001889 Ga0075431_1000018895 457
396 3300006847 Ga0075431_100004172 Ga0075431_1000041728 457
397 3300006871 Ga0075434_100000358 Ga0075434_10000035831 457
398 3300006880 Ga0075429_100000691 Ga0075429_10000069113 457
399 3300006880 Ga0075429_100010802 Ga0075429_1000108023 457
400 3300007076 Ga0075435_100058413 Ga0075435_1000584132 457
401 3300009147 Ga0114129_10001057 Ga0114129_1000105726 457
402 3300009147 Ga0114129_10067074 Ga0114129_100670743 457
403 3300009147 Ga0114129_10394966 Ga0114129_103949662 457
404 3300014969 Ga0157376_10228689 Ga0157376_102286891 457
405 3300025933 Ga0207706_10176272 Ga0207706_101762722 457
406 3300026121 Ga0207683_10020624 Ga0207683_100206243 457
407 3300027364 Ga0209967_1000460 Ga0209967_10004602 457
408 3300027378 Ga0209981_1001151 Ga0209981_10011513 457
409 3300027395 Ga0209996_1000434 Ga0209996_10004342 457
410 3300027424 Ga0209984_1000614 Ga0209984_10006142 457
411 3300027462 Ga0210000_1001726 Ga0210000_10017262 457
412 3300027471 Ga0209995_1000422 Ga0209995_10004222 457
413 3300027543 Ga0209999_1006748 Ga0209999_10067482 457
414 3300027665 Ga0209983_1000184 Ga0209983_10001842 457
415 3300028379 Ga0268266_10003146 Ga0268266_100031466 457
416 3300031852 Ga0307410_10006474 Ga0307410_100064744 457
417 3300031852 Ga0307410_10068121 Ga0307410_100681212 457
418 3300031901 Ga0307406_10002846 Ga0307406_100028465 457
419 3300031911 Ga0307412_10093747 Ga0307412_100937472 457
420 3300031995 Ga0307409_100014523 Ga0307409_1000145232 457
421 3300032002 Ga0307416_100003495 Ga0307416_1000034958 457
422 3300032002 Ga0307416_100022943 Ga0307416_1000229435 457
423 3300032002 Ga0307416_100142482 Ga0307416_1001424822 457
424 3300032005 Ga0307411_10000468 Ga0307411_100004684 457
425 3300035118 Ga0373954_0000072 Ga0373954_0000072_33465_34850 457
426 3300035207 Ga0373942_0017631 Ga0373942_0017631_362_1744 457
427 3300035691 Ga0373931_0020886 Ga0373931_0020886_1786_3168 457
428 3300035724 Ga0373933_0010657 Ga0373933_0010657_2800_4185 457
429 3300038443 Ga0395901_0016199 Ga0395901_0016199_805_2220 457
430 3300044694 Ga0466963_0018269 Ga0466963_0018269_1063_2478 457
431 3300049570 Ga0501033_0053874 Ga0501033_0053874_1519_2901 457
432 3300049571 Ga0501034_0009203 Ga0501034_0009203_3150_4550 457
433 3300049571 Ga0501034_0042205 Ga0501034_0042205_3077_4477 457
434 3300049573 Ga0501037_0120927 Ga0501037_0120927_428_1810 457
435 3300049574 Ga0501038_0072900 Ga0501038_0072900_1322_2704 457
436 3300049576 Ga0501040_0016636 Ga0501040_0016636_725_2107 457
437 3300049576 Ga0501040_0030624 Ga0501040_0030624_1152_2534 457
438 3300049578 Ga0501042_0002488 Ga0501042_0002488_7162_8544 457
439 3300049578 Ga0501042_0014756 Ga0501042_0014756_1914_3296 457
440 3300049580 Ga0501046_0006358 Ga0501046_0006358_3448_4830 457
441 3300049580 Ga0501046_0104371 Ga0501046_0104371_161_1543 457
442 3300049582 Ga0501048_0008335 Ga0501048_0008335_6301_7683 457
443 3300049587 Ga0501071_0080008 Ga0501071_0080008_288_1670 457
444 3300049588 Ga0501072_0013765 Ga0501072_0013765_4376_5758 457
445 3300049588 Ga0501072_0028237 Ga0501072_0028237_2461_3843 457
446 3300049588 Ga0501072_0042493 Ga0501072_0042493_217_1599 457
447 3300049591 Ga0501075_0011247 Ga0501075_0011247_1106_2488 457
448 3300049591 Ga0501075_0042911 Ga0501075_0042911_1002_2384 457
449 3300049591 Ga0501075_0061437 Ga0501075_0061437_277_1659 457
450 3300049592 Ga0501076_0017369 Ga0501076_0017369_1880_3262 457
451 3300049592 Ga0501076_0194738 Ga0501076_0194738_247_1629 457
452 3300049593 Ga0501077_0026316 Ga0501077_0026316_201_1583 457
453 3300049593 Ga0501077_0054088 Ga0501077_0054088_544_1926 457
454 3300049743 Ga0501081_0007892 Ga0501081_0007892_3738_5120 457
455 3300049743 Ga0501081_0030185 Ga0501081_0030185_1281_2663 457
456 3300049743 Ga0501081_0063847 Ga0501081_0063847_399_1781 457
457 3300049823 Ga0501044_0289993 Ga0501044_0289993_31_1431 457
458 3300049824 Ga0501045_0003770 Ga0501045_0003770_7488_8870 457
459 3300049824 Ga0501045_0014153 Ga0501045_0014153_2661_4043 457
460 3300050492 nmdc:mga0yw44_10686_c1 nmdc:mga0yw44_10686_c1_2778_4172 457
461 3300050493 nmdc:mga0k408_34614_c1 nmdc:mga0k408_34614_c1_323_1717 457
462 3300050494 nmdc:mga06z11_38116_c1 nmdc:mga06z11_38116_c1_633_2027 457
463 3300050507 nmdc:mga05p37_55094_c1 nmdc:mga05p37_55094_c1_1225_2607 457
464 3300050507 nmdc:mga05p37_639_c1 nmdc:mga05p37_639_c1_17612_18994 457
465 3300050508 nmdc:mga09592_55031_c1 nmdc:mga09592_55031_c1_1853_3241 457
466 3300050509 nmdc:mga0qj67_16106_c1 nmdc:mga0qj67_16106_c1_4140_5528 457
467 3300050510 nmdc:mga06r32_15989_c1 nmdc:mga06r32_15989_c1_5331_6713 457
468 3300050510 nmdc:mga06r32_222516_c1 nmdc:mga06r32_222516_c1_110_1492 457
469 3300050510 nmdc:mga06r32_8310_c1 nmdc:mga06r32_8310_c1_4231_5619 457
470 3300050512 nmdc:mga0n895_1137_c1 nmdc:mga0n895_1137_c1_10543_11928 457
471 3300050513 nmdc:mga0rr50_9028_c1 nmdc:mga0rr50_9028_c1_519_1904 457
472 3300050516 nmdc:mga0sz30_416_c1 nmdc:mga0sz30_416_c1_205_1599 457
473 3300054114 Ga0501084_0000335 Ga0501084_0000335_12508_13890 457
474 3300054114 Ga0501084_0055663 Ga0501084_0055663_1053_2435 457
475 3300060353 Ga0501082_0002429 Ga0501082_0002429_8314_9696 457
476 3300060353 Ga0501082_0016482 Ga0501082_0016482_3910_5292 457
477 3300061734 Ga0530510_0053377 Ga0530510_0053377_1394_2776 457
478 3300005327 Ga0070658_10002912 Ga0070658_100029122 458
479 3300005329 Ga0070683_100004516 Ga0070683_1000045167 458
480 3300005329 Ga0070683_100018723 Ga0070683_1000187232 458
481 3300005331 Ga0070670_100116588 Ga0070670_1001165882 458
482 3300005336 Ga0070680_100262992 Ga0070680_1002629921 458
483 3300005339 Ga0070660_100021908 Ga0070660_1000219085 458
484 3300005344 Ga0070661_100041417 Ga0070661_1000414173 458
485 3300005366 Ga0070659_100034698 Ga0070659_1000346983 458
486 3300005435 Ga0070714_100007718 Ga0070714_1000077189 458
487 3300005436 Ga0070713_100020849 Ga0070713_1000208494 458
488 3300005439 Ga0070711_100058362 Ga0070711_1000583621 458
489 3300005444 Ga0070694_100003964 Ga0070694_1000039645 458
490 3300005455 Ga0070663_100002585 Ga0070663_1000025858 458
491 3300005458 Ga0070681_10010440 Ga0070681_1001044010 458
492 3300005459 Ga0068867_100146329 Ga0068867_1001463292 458
493 3300005471 Ga0070698_100002891 Ga0070698_1000028914 458
494 3300005471 Ga0070698_100025124 Ga0070698_1000251248 458
495 3300005518 Ga0070699_100049278 Ga0070699_1000492782 458
496 3300005518 Ga0070699_100052108 Ga0070699_1000521083 458
497 3300005530 Ga0070679_100069046 Ga0070679_1000690463 458
498 3300005535 Ga0070684_100001027 Ga0070684_1000010278 458
499 3300005539 Ga0068853_100010394 Ga0068853_1000103948 458
500 3300005563 Ga0068855_100086023 Ga0068855_1000860232 458
501 3300005563 Ga0068855_100298492 Ga0068855_1002984922 458
502 3300005564 Ga0070664_100006137 Ga0070664_10000613711 458
503 3300005577 Ga0068857_100017062 Ga0068857_1000170624 458
504 3300005578 Ga0068854_100003327 Ga0068854_1000033275 458
505 3300005614 Ga0068856_100023739 Ga0068856_1000237394 458
506 3300005614 Ga0068856_100034475 Ga0068856_1000344752 458
507 3300005614 Ga0068856_100203212 Ga0068856_1002032122 458
508 3300005614 Ga0068856_100207788 Ga0068856_1002077882 458
509 3300005617 Ga0068859_100006939 Ga0068859_1000069397 458
510 3300005834 Ga0068851_10016876 Ga0068851_100168763 458
511 3300005843 Ga0068860_100206348 Ga0068860_1002063482 458
512 3300005844 Ga0068862_100012226 Ga0068862_1000122261 458
513 3300005844 Ga0068862_100018363 Ga0068862_1000183633 458
514 3300005937 Ga0081455_10001949 Ga0081455_1000194917 458
515 3300005937 Ga0081455_10094342 Ga0081455_100943422 458
516 3300005981 Ga0081538_10037454 Ga0081538_100374543 458
517 3300005985 Ga0081539_10031165 Ga0081539_100311652 458
518 3300006051 Ga0075364_10109912 Ga0075364_101099122 458
519 3300006058 Ga0075432_10005305 Ga0075432_100053053 458
520 3300006175 Ga0070712_100001581 Ga0070712_10000158122 458
521 3300006175 Ga0070712_100118277 Ga0070712_1001182772 458
522 3300006844 Ga0075428_100004047 Ga0075428_1000040474 458
523 3300006844 Ga0075428_100050090 Ga0075428_1000500903 458
524 3300006846 Ga0075430_100063274 Ga0075430_1000632743 458
525 3300006846 Ga0075430_100098995 Ga0075430_1000989952 458
526 3300006847 Ga0075431_100000073 Ga0075431_10000007344 458
527 3300006847 Ga0075431_100191508 Ga0075431_1001915082 458
528 3300006852 Ga0075433_10002071 Ga0075433_1000207110 458
529 3300006852 Ga0075433_10048205 Ga0075433_100482052 458
530 3300006871 Ga0075434_100067221 Ga0075434_1000672213 458
531 3300006871 Ga0075434_100069941 Ga0075434_1000699411 458
532 3300006880 Ga0075429_100044699 Ga0075429_1000446994 458
533 3300006880 Ga0075429_100202191 Ga0075429_1002021911 458
534 3300006931 Ga0097620_100006939 Ga0097620_1000069397 458
535 3300009094 Ga0111539_10000724 Ga0111539_1000072430 458
536 3300009094 Ga0111539_10019169 Ga0111539_100191692 458
537 3300009148 Ga0105243_10144348 Ga0105243_101443481 458
538 3300009174 Ga0105241_10026181 Ga0105241_100261814 458
539 3300009176 Ga0105242_10018292 Ga0105242_100182923 458
540 3300013100 Ga0157373_10031614 Ga0157373_100316143 458
541 3300013102 Ga0157371_10011892 Ga0157371_100118928 458
542 3300013102 Ga0157371_10080115 Ga0157371_100801152 458
543 3300013104 Ga0157370_10010331 Ga0157370_100103319 458
544 3300013104 Ga0157370_10024359 Ga0157370_100243594 458
545 3300013104 Ga0157370_10056149 Ga0157370_100561493 458
546 3300013105 Ga0157369_10061232 Ga0157369_100612323 458
547 3300013105 Ga0157369_10064706 Ga0157369_100647063 458
548 3300013307 Ga0157372_10012997 Ga0157372_100129976 458
549 3300013307 Ga0157372_10020399 Ga0157372_100203993 458
550 3300013307 Ga0157372_10066700 Ga0157372_100667004 458
551 3300013307 Ga0157372_10101813 Ga0157372_101018133 458
552 3300013308 Ga0157375_10149992 Ga0157375_101499922 458
553 3300014497 Ga0182008_10040807 Ga0182008_100408072 458
554 3300014968 Ga0157379_10106418 Ga0157379_101064182 458
555 3300021441 Ga0213871_10001775 Ga0213871_100017752 458
556 3300025321 Ga0207656_10009391 Ga0207656_100093913 458
557 3300025912 Ga0207707_10015848 Ga0207707_100158482 458
558 3300025912 Ga0207707_10036832 Ga0207707_100368323 458
559 3300025913 Ga0207695_10011778 Ga0207695_1001177811 458
560 3300025915 Ga0207693_10010502 Ga0207693_1001050211 458
561 3300025917 Ga0207660_10008764 Ga0207660_100087643 458
562 3300025917 Ga0207660_10105010 Ga0207660_101050103 458
563 3300025919 Ga0207657_10000151 Ga0207657_1000015167 458
564 3300025919 Ga0207657_10014391 Ga0207657_100143918 458
565 3300025920 Ga0207649_10050481 Ga0207649_100504812 458
566 3300025921 Ga0207652_10037059 Ga0207652_100370593 458
567 3300025924 Ga0207694_10031809 Ga0207694_100318093 458
568 3300025924 Ga0207694_10040663 Ga0207694_100406632 458
569 3300025925 Ga0207650_10093534 Ga0207650_100935342 458
570 3300025929 Ga0207664_10071248 Ga0207664_100712482 458
571 3300025933 Ga0207706_10032284 Ga0207706_100322845 458
572 3300025937 Ga0207669_10041711 Ga0207669_100417112 458
573 3300025944 Ga0207661_10034621 Ga0207661_100346212 458
574 3300025945 Ga0207679_10013299 Ga0207679_100132993 458
575 3300025949 Ga0207667_10000460 Ga0207667_100004608 458
576 3300026067 Ga0207678_10000941 Ga0207678_1000094116 458
577 3300026078 Ga0207702_10005739 Ga0207702_100057392 458
578 3300026078 Ga0207702_10014160 Ga0207702_100141605 458
579 3300026078 Ga0207702_10113676 Ga0207702_101136762 458
580 3300026088 Ga0207641_10081077 Ga0207641_100810773 458
581 3300026116 Ga0207674_10000248 Ga0207674_1000024845 458
582 3300026142 Ga0207698_10007732 Ga0207698_100077328 458
583 3300027364 Ga0209967_1000554 Ga0209967_10005547 458
584 3300027682 Ga0209971_1001259 Ga0209971_10012596 458
585 3300027682 Ga0209971_1008604 Ga0209971_10086041 458
586 3300027682 Ga0209971_1012182 Ga0209971_10121821 458
587 3300027876 Ga0209974_10002094 Ga0209974_100020945 458
588 3300027907 Ga0207428_10000276 Ga0207428_1000027664 458
589 3300027907 Ga0207428_10000367 Ga0207428_1000036731 458
590 3300027907 Ga0207428_10042873 Ga0207428_100428732 458
591 3300028380 Ga0268265_10004017 Ga0268265_1000401711 458
592 3300028380 Ga0268265_10025011 Ga0268265_100250114 458
593 3300031247 Ga0265340_10033026 Ga0265340_100330262 458
594 3300035692 Ga0373935_0015604 Ga0373935_0015604_3046_4437 458
595 3300035692 Ga0373935_0032752 Ga0373935_0032752_248_1648 458
596 3300037312 Ga0395899_0045877 Ga0395899_0045877_281_1702 458
597 3300037418 Ga0395900_0008419 Ga0395900_0008419_7575_8996 458
598 3300037418 Ga0395900_0029736 Ga0395900_0029736_154_1530 458
599 3300038443 Ga0395901_0068664 Ga0395901_0068664_560_1936 458
600 3300039438 Ga0436360_0326106 Ga0436360_0326106_5349_6749 458
601 3300042001 Ga0439441_000444 Ga0439441_000444_2014_3402 458
602 3300042005 Ga0439448_0025415 Ga0439448_0025415_96_1544 458
603 3300042126 Ga0450888_001876 Ga0450888_001876_390_1811 458
604 3300042461 Ga0439460_0004795 Ga0439460_0004795_350_1798 458
605 3300042876 Ga0451577_0001895 Ga0451577_0001895_21717_23105 458
606 3300042876 Ga0451577_0162282 Ga0451577_0162282_275_1723 458
607 3300044673 Ga0453683_0031809 Ga0453683_0031809_329_1717 458
608 3300044712 Ga0453684_0012868 Ga0453684_0012868_1786_3174 458
609 3300045051 Ga0451576_0005211 Ga0451576_0005211_9422_10810 458
610 3300045051 Ga0451576_0045108 Ga0451576_0045108_3171_4619 458
611 3300045976 Ga0466967_0198776 Ga0466967_0198776_307_1683 458
612 3300048912 Ga0496109_0087498 Ga0496109_0087498_1208_2587 458
613 3300049571 Ga0501034_0023085 Ga0501034_0023085_1465_2865 458
614 3300049572 Ga0501036_0041759 Ga0501036_0041759_1984_3363 458
615 3300049573 Ga0501037_0039582 Ga0501037_0039582_690_2078 458
616 3300049574 Ga0501038_0001136 Ga0501038_0001136_7566_8954 458
617 3300049574 Ga0501038_0001317 Ga0501038_0001317_6975_8354 458
618 3300049575 Ga0501039_0009399 Ga0501039_0009399_1661_3049 458
619 3300049576 Ga0501040_0000196 Ga0501040_0000196_3136_4524 458
620 3300049576 Ga0501040_0020366 Ga0501040_0020366_771_2171 458
621 3300049576 Ga0501040_0030968 Ga0501040_0030968_429_1808 458
622 3300049576 Ga0501040_0038662 Ga0501040_0038662_1471_2850 458
623 3300049576 Ga0501040_0061355 Ga0501040_0061355_1014_2411 458
624 3300049577 Ga0501041_0000776 Ga0501041_0000776_13948_15336 458
625 3300049577 Ga0501041_0008577 Ga0501041_0008577_3611_4990 458
626 3300049577 Ga0501041_0008710 Ga0501041_0008710_3013_4413 458
627 3300049578 Ga0501042_0002296 Ga0501042_0002296_3154_4533 458
628 3300049578 Ga0501042_0013853 Ga0501042_0013853_261_1661 458
629 3300049580 Ga0501046_0000992 Ga0501046_0000992_12433_13821 458
630 3300049580 Ga0501046_0020661 Ga0501046_0020661_3724_5103 458
631 3300049582 Ga0501048_0020030 Ga0501048_0020030_1856_3244 458
632 3300049582 Ga0501048_0034116 Ga0501048_0034116_231_1610 458
633 3300049587 Ga0501071_0001226 Ga0501071_0001226_7037_8425 458
634 3300049588 Ga0501072_0001619 Ga0501072_0001619_252_1640 458
635 3300049588 Ga0501072_0020147 Ga0501072_0020147_1480_2880 458
636 3300049590 Ga0501074_0124390 Ga0501074_0124390_114_1502 458
637 3300049591 Ga0501075_0000018 Ga0501075_0000018_38895_40274 458
638 3300049591 Ga0501075_0000045 Ga0501075_0000045_22978_24366 458
639 3300049591 Ga0501075_0080912 Ga0501075_0080912_633_2030 458
640 3300049592 Ga0501076_0000002 Ga0501076_0000002_89750_91129 458
641 3300049592 Ga0501076_0003698 Ga0501076_0003698_8960_10360 458
642 3300049592 Ga0501076_0020034 Ga0501076_0020034_1411_2799 458
643 3300049593 Ga0501077_0000629 Ga0501077_0000629_632_2020 458
644 3300049593 Ga0501077_0018074 Ga0501077_0018074_1029_2429 458
645 3300049593 Ga0501077_0124035 Ga0501077_0124035_190_1611 458
646 3300049741 Ga0501079_0009483 Ga0501079_0009483_2255_3643 458
647 3300049741 Ga0501079_0148628 Ga0501079_0148628_437_1816 458
648 3300049742 Ga0501080_0036440 Ga0501080_0036440_1986_3374 458
649 3300049742 Ga0501080_0072515 Ga0501080_0072515_685_2106 458
650 3300049743 Ga0501081_0000034 Ga0501081_0000034_4209_5588 458
651 3300049743 Ga0501081_0001457 Ga0501081_0001457_12677_14077 458
652 3300049743 Ga0501081_0005411 Ga0501081_0005411_4035_5423 458
653 3300049744 Ga0501083_0097938 Ga0501083_0097938_485_1873 458
654 3300049822 Ga0501035_0038720 Ga0501035_0038720_2341_3729 458
655 3300049824 Ga0501045_0002359 Ga0501045_0002359_2708_4096 458
656 3300050492 nmdc:mga0yw44_42828_c1 nmdc:mga0yw44_42828_c1_835_2247 458
657 3300050507 nmdc:mga05p37_348_c1 nmdc:mga05p37_348_c1_46417_47808 458
658 3300050509 nmdc:mga0qj67_150851_c1 nmdc:mga0qj67_150851_c1_162_1577 458
659 3300050509 nmdc:mga0qj67_98774_c1 nmdc:mga0qj67_98774_c1_714_2099 458
660 3300050510 nmdc:mga06r32_148250_c1 nmdc:mga06r32_148250_c1_666_2081 458
661 3300050510 nmdc:mga06r32_51_c2 nmdc:mga06r32_51_c2_1049_2434 458
662 3300050511 nmdc:mga08y16_15684_c1 nmdc:mga08y16_15684_c1_141_1532 458
663 3300050511 nmdc:mga08y16_23916_c1 nmdc:mga08y16_23916_c1_3406_4794 458
664 3300050511 nmdc:mga08y16_49798_c1 nmdc:mga08y16_49798_c1_1308_2696 458
665 3300050512 nmdc:mga0n895_19353_c1 nmdc:mga0n895_19353_c1_1217_2605 458
666 3300050513 nmdc:mga0rr50_200182_c1 nmdc:mga0rr50_200182_c1_116_1495 458
667 3300050515 nmdc:mga0a205_1929_c1 nmdc:mga0a205_1929_c1_3310_4698 458
668 3300050515 nmdc:mga0a205_4612_c1 nmdc:mga0a205_4612_c1_1888_3276 458
669 3300050515 nmdc:mga0a205_9216_c1 nmdc:mga0a205_9216_c1_3087_4475 458
670 3300053096 Ga0500641_0020317 Ga0500641_0020317_1067_2488 458
671 3300053153 Ga0500616_0026581 Ga0500616_0026581_1695_3113 458
672 3300054114 Ga0501084_0003030 Ga0501084_0003030_9884_11263 458
673 3300054114 Ga0501084_0042926 Ga0501084_0042926_715_2115 458
674 3300054114 Ga0501084_0054286 Ga0501084_0054286_1034_2413 458
675 3300054114 Ga0501084_0063952 Ga0501084_0063952_1381_2769 458
676 3300060353 Ga0501082_0000148 Ga0501082_0000148_6459_7838 458
677 3300060353 Ga0501082_0012910 Ga0501082_0012910_4865_6265 458
678 3300060353 Ga0501082_0013681 Ga0501082_0013681_5030_6409 458
679 3300060353 Ga0501082_0042384 Ga0501082_0042384_591_2012 458
680 3300061734 Ga0530510_0000021 Ga0530510_0000021_15184_16563 458
681 3300061734 Ga0530510_0051544 Ga0530510_0051544_293_1681 458

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00884

Sulfatase

Sulfatase

69

416

0.89

PF01663

Phosphodiest

Type I phosphodiesterase / nucleotide pyrophosphatase

71

186

0.87

PF16347

SGSH_C

N-sulphoglucosamine sulphohydrolase, C-terminal

363

525

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hr5-assembly1.cif.gz_A structure of the s1_25 family sulfatase module of the rhamnosidase fa22250 from formosa agariphila 0.8445 4 455
6hr5-assembly1.cif.gz_A structure of the s1_25 family sulfatase module of the rhamnosidase fa22250 from formosa agariphila 0.8359 4 455
7p24-assembly1.cif.gz_AAA sulfated host glycan recognition by carbohydrate sulfatases of the human gut microbiota (bt3177_s1_11) 0.8239 4 455
5g2v-assembly1.cif.gz_A structure of bt4656 in complex with its substrate d-glucosamine-2-n, 6-o-disulfate. 0.815 4 455
7p24-assembly1.cif.gz_AAA sulfated host glycan recognition by carbohydrate sulfatases of the human gut microbiota (bt3177_s1_11) 0.8118 4 455
ID Description Score Start End Superfamily
5g2tD00 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7904 4 455 3.40.720.10
af_P0AD27_254_505_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7886 3 345 3.40.720.10
af_Q5BIL9_22_463_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7818 5 430 3.40.720.10
af_F1R152_43_489_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7777 5 430 3.40.720.10
af_F1QEE9_45_460_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7642 4 386 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A661GIY2-F1-model_v4 Acetylglucosamine-6-sulfatase 0.9511 1 457 GO:0016787
AF-A0A7C7V5S1-F1-model_v4 Sulfatase N-terminal domain-containing protein 0.9478 2 187 GO:0004065
AF-A0A661GIY2-F1-model_v4 Acetylglucosamine-6-sulfatase 0.947 1 457 GO:0016787
AF-A0A7Y3MYL4-F1-model_v4 Sulfatase-like hydrolase/transferase 0.9385 47 458 GO:0016740
GO:0016787
AF-A0A255Y9M5-F1-model_v4 Sulfatase N-terminal domain-containing protein 0.9328 4 458 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.83 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map