F474835
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 681 | 263 | 681 | 461 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10149992|Ga0157375_101499922 |
| Length | 529 |
| Sequence | VEQQLSCGQPPLVYVTNGGWGTVAADDGGAGYVVRGLTLGIVKPRQRPPVKIRNLATATAVWIRMQKRPNFLVILIDDLRYDEFGAGGHPYMKTPHVDRLAAEGALFERAFHTTPICSPNRASIVTGQYASRHGIIDNVARDAMSHRLPNYHLELQRLGYETAHIGKWHMGNDGQPRPGYDYWVSYDGHGRLHDPTLNHDGKYVEHRGYITDIMNGLAVDFLDRTHGKPWSLFFAHKAVHPDAAQAADGTLRISAQGGYVVAERHKDLYRGAIFPKKPNMLSPAEVVRRKPAWAECLSLRSSEDSRQVLVALHSMEQEEIRLRARMMAAVDEGMGQILDVLERKGELDNTFIVFLGDNGFFFGEHALGPERRFAYEEGIRSPFLVRFPKRAKAGSRRRELVICQDIAPTLIQLAGGKPGPQIQGRSLLPLFARGDTRMRAGWRKSILCEYWAEQAMPWLVGMSYKAVRTDRYKYIHWVNRGRAGELDELYDLDTDPYEIRNLNASRAMTPVRERMRRELRKLVAEALGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 181 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 198 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 199 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 200 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 201 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 202 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 203 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 204 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 205 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 247 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 248 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 249 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 260 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.47 |
| Nodule | 0 |
| Rhizoplane | 0.59 |
| Rhizosphere | 97.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10002912 | 3300005327 | Bacteria | 14194 |
| 2 | Ga0070676_10000164 | 3300005328 | Bacteria | 26774 |
| 3 | Ga0070683_100004516 | 3300005329 | Bacteria | 11485 |
| 4 | Ga0070683_100018723 | 3300005329 | Bacteria | 6137 |
| 5 | Ga0070683_100060244 | 3300005329 | Bacteria | 3527 |
| 6 | Ga0070690_100019776 | 3300005330 | Bacteria | 4095 |
| 7 | Ga0070690_100029769 | 3300005330 | Bacteria | 3389 |
| 8 | Ga0070690_100078556 | 3300005330 | Bacteria | 2156 |
| 9 | Ga0070670_100001252 | 3300005331 | Bacteria | 20207 |
| 10 | Ga0070670_100003427 | 3300005331 | Bacteria | 13164 |
| 11 | Ga0070670_100069704 | 3300005331 | Bacteria | 3019 |
| 12 | Ga0070670_100116588 | 3300005331 | Bacteria | 2303 |
| 13 | Ga0068869_100000789 | 3300005334 | Bacteria | 18065 |
| 14 | Ga0068869_100004150 | 3300005334 | Bacteria | 8986 |
| 15 | Ga0068869_100080735 | 3300005334 | Bacteria | 2427 |
| 16 | Ga0070666_10039039 | 3300005335 | Bacteria | 3162 |
| 17 | Ga0070680_100003118 | 3300005336 | Bacteria | 12307 |
| 18 | Ga0070680_100019471 | 3300005336 | Bacteria | 5377 |
| 19 | Ga0070680_100166991 | 3300005336 | Bacteria | 1851 |
| 20 | Ga0070680_100262992 | 3300005336 | Bacteria | 1460 |
| 21 | Ga0070682_100000147 | 3300005337 | Bacteria | 55841 |
| 22 | Ga0068868_100086921 | 3300005338 | Bacteria | 2514 |
| 23 | Ga0070660_100000639 | 3300005339 | Bacteria | 23237 |
| 24 | Ga0070660_100010235 | 3300005339 | Bacteria | 6618 |
| 25 | Ga0070660_100021908 | 3300005339 | Bacteria | 4720 |
| 26 | Ga0070689_100023306 | 3300005340 | Bacteria | 4633 |
| 27 | Ga0070689_100038207 | 3300005340 | Bacteria | 3672 |
| 28 | Ga0070689_100041882 | 3300005340 | Bacteria | 3515 |
| 29 | Ga0070691_10027934 | 3300005341 | Bacteria | 2633 |
| 30 | Ga0070687_100046879 | 3300005343 | Bacteria | 2215 |
| 31 | Ga0070661_100001058 | 3300005344 | Bacteria | 19513 |
| 32 | Ga0070661_100005227 | 3300005344 | Bacteria | 8938 |
| 33 | Ga0070661_100041417 | 3300005344 | Bacteria | 3362 |
| 34 | Ga0070692_10004219 | 3300005345 | Bacteria | 5961 |
| 35 | Ga0070692_10005256 | 3300005345 | Bacteria | 5496 |
| 36 | Ga0070692_10051606 | 3300005345 | Bacteria | 2140 |
| 37 | Ga0070668_100032129 | 3300005347 | Bacteria | 3995 |
| 38 | Ga0070668_100060420 | 3300005347 | Bacteria | 2935 |
| 39 | Ga0070668_100105775 | 3300005347 | Unclassified | 2235 |
| 40 | Ga0070668_100160924 | 3300005347 | Bacteria | 1822 |
| 41 | Ga0070669_100020709 | 3300005353 | Bacteria | 4698 |
| 42 | Ga0070669_100073493 | 3300005353 | Bacteria | 2533 |
| 43 | Ga0070669_100111142 | 3300005353 | Bacteria | 2079 |
| 44 | Ga0070675_100007866 | 3300005354 | Bacteria | 8261 |
| 45 | Ga0070675_100011711 | 3300005354 | Bacteria | 6873 |
| 46 | Ga0070675_100094983 | 3300005354 | Bacteria | 2503 |
| 47 | Ga0070673_100003829 | 3300005364 | Bacteria | 9436 |
| 48 | Ga0070673_100030068 | 3300005364 | Bacteria | 4059 |
| 49 | Ga0070659_100001053 | 3300005366 | Bacteria | 20154 |
| 50 | Ga0070659_100028702 | 3300005366 | Bacteria | 4299 |
| 51 | Ga0070659_100034698 | 3300005366 | Bacteria | 3925 |
| 52 | Ga0070714_100007718 | 3300005435 | Bacteria | 8381 |
| 53 | Ga0070714_100008956 | 3300005435 | Bacteria | 7833 |
| 54 | Ga0070713_100020849 | 3300005436 | Bacteria | 5030 |
| 55 | Ga0070701_10027788 | 3300005438 | Bacteria | 2775 |
| 56 | Ga0070711_100058362 | 3300005439 | Unclassified | 2676 |
| 57 | Ga0070705_100004619 | 3300005440 | Bacteria | 6702 |
| 58 | Ga0070705_100006953 | 3300005440 | Bacteria | 5559 |
| 59 | Ga0070705_100030761 | 3300005440 | Bacteria | 2966 |
| 60 | Ga0070705_100071663 | 3300005440 | Bacteria | 2097 |
| 61 | Ga0070700_100000652 | 3300005441 | Bacteria | 17149 |
| 62 | Ga0070694_100000164 | 3300005444 | Bacteria | 34180 |
| 63 | Ga0070694_100000490 | 3300005444 | Bacteria | 21700 |
| 64 | Ga0070694_100003964 | 3300005444 | Bacteria | 8856 |
| 65 | Ga0070694_100021721 | 3300005444 | Bacteria | 4106 |
| 66 | Ga0070694_100041987 | 3300005444 | Bacteria | 3053 |
| 67 | Ga0070708_100038364 | 3300005445 | Bacteria | 4185 |
| 68 | Ga0070663_100002585 | 3300005455 | Bacteria | 10224 |
| 69 | Ga0070678_100008275 | 3300005456 | Bacteria | 6223 |
| 70 | Ga0070662_100016778 | 3300005457 | Bacteria | 4922 |
| 71 | Ga0070662_100078612 | 3300005457 | Bacteria | 2451 |
| 72 | Ga0070681_10002249 | 3300005458 | Bacteria | 17621 |
| 73 | Ga0070681_10010440 | 3300005458 | Bacteria | 9172 |
| 74 | Ga0070681_10138481 | 3300005458 | Bacteria | 2364 |
| 75 | Ga0068867_100000876 | 3300005459 | Bacteria | 20334 |
| 76 | Ga0068867_100003046 | 3300005459 | Bacteria | 11818 |
| 77 | Ga0068867_100146329 | 3300005459 | Bacteria | 1852 |
| 78 | Ga0070706_100090638 | 3300005467 | Bacteria | 2835 |
| 79 | Ga0070698_100002891 | 3300005471 | Bacteria | 18906 |
| 80 | Ga0070698_100025124 | 3300005471 | Bacteria | 6209 |
| 81 | Ga0070698_100026914 | 3300005471 | Bacteria | 5980 |
| 82 | Ga0070698_100080951 | 3300005471 | Bacteria | 3242 |
| 83 | Ga0070698_100195307 | 3300005471 | Bacteria | 1961 |
| 84 | Ga0070699_100049278 | 3300005518 | Bacteria | 3646 |
| 85 | Ga0070699_100052108 | 3300005518 | Bacteria | 3543 |
| 86 | Ga0070699_100111465 | 3300005518 | Bacteria | 2402 |
| 87 | Ga0070679_100069046 | 3300005530 | Unclassified | 3525 |
| 88 | Ga0070684_100001027 | 3300005535 | Bacteria | 19891 |
| 89 | Ga0070684_100035943 | 3300005535 | Bacteria | 4243 |
| 90 | Ga0070684_100077425 | 3300005535 | Bacteria | 2937 |
| 91 | Ga0070697_100149919 | 3300005536 | Bacteria | 1965 |
| 92 | Ga0068853_100001868 | 3300005539 | Bacteria | 15488 |
| 93 | Ga0068853_100010394 | 3300005539 | Bacteria | 7530 |
| 94 | Ga0068853_100104081 | 3300005539 | Bacteria | 2513 |
| 95 | Ga0070672_100002353 | 3300005543 | Bacteria | 11956 |
| 96 | Ga0070672_100014473 | 3300005543 | Bacteria | 5592 |
| 97 | Ga0070672_100128913 | 3300005543 | Bacteria | 2077 |
| 98 | Ga0070672_100185300 | 3300005543 | Unclassified | 1736 |
| 99 | Ga0070695_100001300 | 3300005545 | Bacteria | 13785 |
| 100 | Ga0070695_100018893 | 3300005545 | Bacteria | 4190 |
| 101 | Ga0070695_100022662 | 3300005545 | Bacteria | 3854 |
| 102 | Ga0070695_100098783 | 3300005545 | Bacteria | 1962 |
| 103 | Ga0070696_100002890 | 3300005546 | Bacteria | 11426 |
| 104 | Ga0070696_100022222 | 3300005546 | Bacteria | 4309 |
| 105 | Ga0070696_100051489 | 3300005546 | Bacteria | 2864 |
| 106 | Ga0070693_100000088 | 3300005547 | Bacteria | 39090 |
| 107 | Ga0070693_100077520 | 3300005547 | Bacteria | 1973 |
| 108 | Ga0070665_100008670 | 3300005548 | Bacteria | 10290 |
| 109 | Ga0070665_100230993 | 3300005548 | Bacteria | 1850 |
| 110 | Ga0070704_100000580 | 3300005549 | Bacteria | 17578 |
| 111 | Ga0070704_100078761 | 3300005549 | Bacteria | 2419 |
| 112 | Ga0068855_100001859 | 3300005563 | Bacteria | 26255 |
| 113 | Ga0068855_100086023 | 3300005563 | Bacteria | 3636 |
| 114 | Ga0068855_100298492 | 3300005563 | Bacteria | 1784 |
| 115 | Ga0068855_100370508 | 3300005563 | Unclassified | 1574 |
| 116 | Ga0070664_100006137 | 3300005564 | Bacteria | 9720 |
| 117 | Ga0070664_100023948 | 3300005564 | Bacteria | 5045 |
| 118 | Ga0068857_100004059 | 3300005577 | Bacteria | 12325 |
| 119 | Ga0068857_100007072 | 3300005577 | Bacteria | 9664 |
| 120 | Ga0068857_100017062 | 3300005577 | Bacteria | 6359 |
| 121 | Ga0068857_100147518 | 3300005577 | Bacteria | 2129 |
| 122 | Ga0068854_100003327 | 3300005578 | Bacteria | 10015 |
| 123 | Ga0068854_100008881 | 3300005578 | Bacteria | 6469 |
| 124 | Ga0068856_100001089 | 3300005614 | Bacteria | 28646 |
| 125 | Ga0068856_100023739 | 3300005614 | Bacteria | 5964 |
| 126 | Ga0068856_100034475 | 3300005614 | Bacteria | 4957 |
| 127 | Ga0068856_100203212 | 3300005614 | Unclassified | 1996 |
| 128 | Ga0068856_100207788 | 3300005614 | Bacteria | 1972 |
| 129 | Ga0070702_100016589 | 3300005615 | Bacteria | 3781 |
| 130 | Ga0068859_100002050 | 3300005617 | Bacteria | 20585 |
| 131 | Ga0068859_100006939 | 3300005617 | Bacteria | 11501 |
| 132 | Ga0068859_100115241 | 3300005617 | Bacteria | 2752 |
| 133 | Ga0068864_100006436 | 3300005618 | Bacteria | 9625 |
| 134 | Ga0068864_100023302 | 3300005618 | Bacteria | 5198 |
| 135 | Ga0068861_100004028 | 3300005719 | Bacteria | 9839 |
| 136 | Ga0068851_10015934 | 3300005834 | Bacteria | 3588 |
| 137 | Ga0068851_10016876 | 3300005834 | Unclassified | 3499 |
| 138 | Ga0068870_10005480 | 3300005840 | Bacteria | 5545 |
| 139 | Ga0068863_100001012 | 3300005841 | Bacteria | 28130 |
| 140 | Ga0068863_100040138 | 3300005841 | Bacteria | 4450 |
| 141 | Ga0068863_100088950 | 3300005841 | Bacteria | 2927 |
| 142 | Ga0068863_100278798 | 3300005841 | Bacteria | 1619 |
| 143 | Ga0068858_100152692 | 3300005842 | Bacteria | 2172 |
| 144 | Ga0068860_100044918 | 3300005843 | Bacteria | 4211 |
| 145 | Ga0068860_100088392 | 3300005843 | Bacteria | 2949 |
| 146 | Ga0068860_100122453 | 3300005843 | Bacteria | 2492 |
| 147 | Ga0068860_100139237 | 3300005843 | Bacteria | 2331 |
| 148 | Ga0068860_100206348 | 3300005843 | Bacteria | 1906 |
| 149 | Ga0068862_100001923 | 3300005844 | Bacteria | 18860 |
| 150 | Ga0068862_100012226 | 3300005844 | Bacteria | 7097 |
| 151 | Ga0068862_100018363 | 3300005844 | Bacteria | 5823 |
| 152 | Ga0068862_100057883 | 3300005844 | Bacteria | 3325 |
| 153 | Ga0068862_100187319 | 3300005844 | Bacteria | 1860 |
| 154 | Ga0081455_10000824 | 3300005937 | Bacteria | 39882 |
| 155 | Ga0081455_10001949 | 3300005937 | Bacteria | 24788 |
| 156 | Ga0081455_10094342 | 3300005937 | Unclassified | 2417 |
| 157 | Ga0081538_10037454 | 3300005981 | Bacteria | 3146 |
| 158 | Ga0081539_10000797 | 3300005985 | Bacteria | 61227 |
| 159 | Ga0081539_10031165 | 3300005985 | Bacteria | 3293 |
| 160 | Ga0075365_10086033 | 3300006038 | Bacteria | 2136 |
| 161 | Ga0075368_10047499 | 3300006042 | Bacteria | 1699 |
| 162 | Ga0075364_10109912 | 3300006051 | Bacteria | 1839 |
| 163 | Ga0075432_10005305 | 3300006058 | Bacteria | 4388 |
| 164 | Ga0070712_100001581 | 3300006175 | Bacteria | 13929 |
| 165 | Ga0070712_100118277 | 3300006175 | Unclassified | 1990 |
| 166 | Ga0068871_100004074 | 3300006358 | Bacteria | 10110 |
| 167 | Ga0075428_100002789 | 3300006844 | Bacteria | 19006 |
| 168 | Ga0075428_100004047 | 3300006844 | Bacteria | 16112 |
| 169 | Ga0075428_100050090 | 3300006844 | Bacteria | 4581 |
| 170 | Ga0075428_100332366 | 3300006844 | Unclassified | 1632 |
| 171 | Ga0075430_100004062 | 3300006846 | Bacteria | 12352 |
| 172 | Ga0075430_100015771 | 3300006846 | Bacteria | 6436 |
| 173 | Ga0075430_100019910 | 3300006846 | Bacteria | 5709 |
| 174 | Ga0075430_100063274 | 3300006846 | Bacteria | 3108 |
| 175 | Ga0075430_100098995 | 3300006846 | Bacteria | 2435 |
| 176 | Ga0075431_100000073 | 3300006847 | Bacteria | 58648 |
| 177 | Ga0075431_100001889 | 3300006847 | Bacteria | 19868 |
| 178 | Ga0075431_100004172 | 3300006847 | Bacteria | 14132 |
| 179 | Ga0075431_100011522 | 3300006847 | Bacteria | 8918 |
| 180 | Ga0075431_100049276 | 3300006847 | Bacteria | 4343 |
| 181 | Ga0075431_100072345 | 3300006847 | Bacteria | 3558 |
| 182 | Ga0075431_100191508 | 3300006847 | Unclassified | 2095 |
| 183 | Ga0075433_10000184 | 3300006852 | Bacteria | 35069 |
| 184 | Ga0075433_10002071 | 3300006852 | Bacteria | 15163 |
| 185 | Ga0075433_10006577 | 3300006852 | Bacteria | 9202 |
| 186 | Ga0075433_10048205 | 3300006852 | Bacteria | 3705 |
| 187 | Ga0075434_100000358 | 3300006871 | Bacteria | 33110 |
| 188 | Ga0075434_100002746 | 3300006871 | Bacteria | 15560 |
| 189 | Ga0075434_100067221 | 3300006871 | Bacteria | 3571 |
| 190 | Ga0075434_100069941 | 3300006871 | Unclassified | 3499 |
| 191 | Ga0075429_100000691 | 3300006880 | Bacteria | 26282 |
| 192 | Ga0075429_100005736 | 3300006880 | Bacteria | 10714 |
| 193 | Ga0075429_100010802 | 3300006880 | Bacteria | 7897 |
| 194 | Ga0075429_100044699 | 3300006880 | Bacteria | 3852 |
| 195 | Ga0075429_100202191 | 3300006880 | Bacteria | 1741 |
| 196 | Ga0075436_100004153 | 3300006914 | Bacteria | 9938 |
| 197 | Ga0075436_100010219 | 3300006914 | Bacteria | 6428 |
| 198 | Ga0097620_100002051 | 3300006931 | Bacteria | 20585 |
| 199 | Ga0097620_100006939 | 3300006931 | Bacteria | 11501 |
| 200 | Ga0097620_100115242 | 3300006931 | Bacteria | 2752 |
| 201 | Ga0075435_100001390 | 3300007076 | Bacteria | 15588 |
| 202 | Ga0075435_100058413 | 3300007076 | Bacteria | 3124 |
| 203 | Ga0105240_10012112 | 3300009093 | Bacteria | 11945 |
| 204 | Ga0105240_10093438 | 3300009093 | Bacteria | 3671 |
| 205 | Ga0111539_10000724 | 3300009094 | Bacteria | 42942 |
| 206 | Ga0111539_10019169 | 3300009094 | Bacteria | 8451 |
| 207 | Ga0111539_10024762 | 3300009094 | Bacteria | 7361 |
| 208 | Ga0111539_10044598 | 3300009094 | Bacteria | 5312 |
| 209 | Ga0105245_10262176 | 3300009098 | Bacteria | 1682 |
| 210 | Ga0114129_10001057 | 3300009147 | Bacteria | 36115 |
| 211 | Ga0114129_10027640 | 3300009147 | Bacteria | 8033 |
| 212 | Ga0114129_10067074 | 3300009147 | Bacteria | 5004 |
| 213 | Ga0114129_10394966 | 3300009147 | Bacteria | 1823 |
| 214 | Ga0105243_10003195 | 3300009148 | Bacteria | 13424 |
| 215 | Ga0105243_10011356 | 3300009148 | Bacteria | 6742 |
| 216 | Ga0105243_10063427 | 3300009148 | Bacteria | 2961 |
| 217 | Ga0105243_10144348 | 3300009148 | Bacteria | 2035 |
| 218 | Ga0105241_10000541 | 3300009174 | Bacteria | 28474 |
| 219 | Ga0105241_10026181 | 3300009174 | Bacteria | 4337 |
| 220 | Ga0105241_10034519 | 3300009174 | Bacteria | 3801 |
| 221 | Ga0105242_10018292 | 3300009176 | Bacteria | 5476 |
| 222 | Ga0105248_10031847 | 3300009177 | Bacteria | 5892 |
| 223 | Ga0105248_10354541 | 3300009177 | Bacteria | 1652 |
| 224 | Ga0105237_10056368 | 3300009545 | Bacteria | 3934 |
| 225 | Ga0105238_10150055 | 3300009551 | Bacteria | 2306 |
| 226 | Ga0105249_10005966 | 3300009553 | Bacteria | 10557 |
| 227 | Ga0105249_10093938 | 3300009553 | Bacteria | 2810 |
| 228 | Ga0157373_10000397 | 3300013100 | Bacteria | 34902 |
| 229 | Ga0157373_10023936 | 3300013100 | Bacteria | 4425 |
| 230 | Ga0157373_10031614 | 3300013100 | Unclassified | 3809 |
| 231 | Ga0157371_10011892 | 3300013102 | Bacteria | 6679 |
| 232 | Ga0157371_10062440 | 3300013102 | Bacteria | 2641 |
| 233 | Ga0157371_10074613 | 3300013102 | Bacteria | 2402 |
| 234 | Ga0157371_10080115 | 3300013102 | Bacteria | 2313 |
| 235 | Ga0157370_10010331 | 3300013104 | Bacteria | 9849 |
| 236 | Ga0157370_10024359 | 3300013104 | Bacteria | 5993 |
| 237 | Ga0157370_10056149 | 3300013104 | Bacteria | 3748 |
| 238 | Ga0157370_10204317 | 3300013104 | Unclassified | 1832 |
| 239 | Ga0157369_10004373 | 3300013105 | Bacteria | 16684 |
| 240 | Ga0157369_10061232 | 3300013105 | Bacteria | 4058 |
| 241 | Ga0157369_10064706 | 3300013105 | Bacteria | 3938 |
| 242 | Ga0157378_10025324 | 3300013297 | Bacteria | 5225 |
| 243 | Ga0163162_10057168 | 3300013306 | Bacteria | 3928 |
| 244 | Ga0163162_10152154 | 3300013306 | Bacteria | 2432 |
| 245 | Ga0163162_10212000 | 3300013306 | Unclassified | 2067 |
| 246 | Ga0157372_10001274 | 3300013307 | Bacteria | 27269 |
| 247 | Ga0157372_10012997 | 3300013307 | Bacteria | 8883 |
| 248 | Ga0157372_10020399 | 3300013307 | Bacteria | 7150 |
| 249 | Ga0157372_10066700 | 3300013307 | Bacteria | 4043 |
| 250 | Ga0157372_10101813 | 3300013307 | Bacteria | 3280 |
| 251 | Ga0157375_10015727 | 3300013308 | Bacteria | 6779 |
| 252 | Ga0157375_10031192 | 3300013308 | Bacteria | 5034 |
| 253 | Ga0157375_10145870 | 3300013308 | Bacteria | 2498 |
| 254 | Ga0157375_10149992 | 3300013308 | Bacteria | 2466 |
| 255 | Ga0157375_10233731 | 3300013308 | Bacteria | 1997 |
| 256 | Ga0163163_10005091 | 3300014325 | Bacteria | 11327 |
| 257 | Ga0163163_10039414 | 3300014325 | Bacteria | 4611 |
| 258 | Ga0157380_10037451 | 3300014326 | Bacteria | 3758 |
| 259 | Ga0182008_10040807 | 3300014497 | Bacteria | 2315 |
| 260 | Ga0157377_10013374 | 3300014745 | Bacteria | 4152 |
| 261 | Ga0157379_10106418 | 3300014968 | Bacteria | 2518 |
| 262 | Ga0157376_10014370 | 3300014969 | Bacteria | 5941 |
| 263 | Ga0157376_10228689 | 3300014969 | Unclassified | 1726 |
| 264 | Ga0182007_10008718 | 3300015262 | Bacteria | 4141 |
| 265 | Ga0213871_10001775 | 3300021441 | Bacteria | 3754 |
| 266 | Ga0207656_10009391 | 3300025321 | Unclassified | 3633 |
| 267 | Ga0207645_10000397 | 3300025907 | Bacteria | 35935 |
| 268 | Ga0207643_10001176 | 3300025908 | Bacteria | 15533 |
| 269 | Ga0207643_10033109 | 3300025908 | Bacteria | 2891 |
| 270 | Ga0207684_10005312 | 3300025910 | Bacteria | 11919 |
| 271 | Ga0207684_10050713 | 3300025910 | Bacteria | 3521 |
| 272 | Ga0207654_10000830 | 3300025911 | Bacteria | 17023 |
| 273 | Ga0207654_10085733 | 3300025911 | Bacteria | 1907 |
| 274 | Ga0207707_10000078 | 3300025912 | Bacteria | 99871 |
| 275 | Ga0207707_10015848 | 3300025912 | Bacteria | 6573 |
| 276 | Ga0207707_10036832 | 3300025912 | Bacteria | 4275 |
| 277 | Ga0207695_10011778 | 3300025913 | Bacteria | 10565 |
| 278 | Ga0207693_10010502 | 3300025915 | Bacteria | 7515 |
| 279 | Ga0207660_10000335 | 3300025917 | Bacteria | 30334 |
| 280 | Ga0207660_10008764 | 3300025917 | Bacteria | 6538 |
| 281 | Ga0207660_10043397 | 3300025917 | Bacteria | 3160 |
| 282 | Ga0207660_10062844 | 3300025917 | Bacteria | 2676 |
| 283 | Ga0207660_10105010 | 3300025917 | Unclassified | 2116 |
| 284 | Ga0207657_10000151 | 3300025919 | Bacteria | 70697 |
| 285 | Ga0207657_10000171 | 3300025919 | Bacteria | 66690 |
| 286 | Ga0207657_10014391 | 3300025919 | Bacteria | 7724 |
| 287 | Ga0207657_10045828 | 3300025919 | Bacteria | 3833 |
| 288 | Ga0207649_10001560 | 3300025920 | Bacteria | 13400 |
| 289 | Ga0207649_10036128 | 3300025920 | Bacteria | 2973 |
| 290 | Ga0207649_10050481 | 3300025920 | Bacteria | 2573 |
| 291 | Ga0207652_10002588 | 3300025921 | Bacteria | 15175 |
| 292 | Ga0207652_10037059 | 3300025921 | Bacteria | 4126 |
| 293 | Ga0207646_10001625 | 3300025922 | Bacteria | 27437 |
| 294 | Ga0207681_10048338 | 3300025923 | Bacteria | 2871 |
| 295 | Ga0207694_10031809 | 3300025924 | Bacteria | 4033 |
| 296 | Ga0207694_10040663 | 3300025924 | Bacteria | 3581 |
| 297 | Ga0207694_10046641 | 3300025924 | Bacteria | 3349 |
| 298 | Ga0207650_10004272 | 3300025925 | Bacteria | 9751 |
| 299 | Ga0207650_10093534 | 3300025925 | Bacteria | 2301 |
| 300 | Ga0207650_10145627 | 3300025925 | Unclassified | 1865 |
| 301 | Ga0207664_10067889 | 3300025929 | Bacteria | 2862 |
| 302 | Ga0207664_10071248 | 3300025929 | Unclassified | 2799 |
| 303 | Ga0207690_10000917 | 3300025932 | Bacteria | 18837 |
| 304 | Ga0207706_10001320 | 3300025933 | Bacteria | 24841 |
| 305 | Ga0207706_10032284 | 3300025933 | Bacteria | 4663 |
| 306 | Ga0207706_10176272 | 3300025933 | Unclassified | 1878 |
| 307 | Ga0207709_10005588 | 3300025935 | Bacteria | 7115 |
| 308 | Ga0207670_10041599 | 3300025936 | Bacteria | 3023 |
| 309 | Ga0207670_10112279 | 3300025936 | Bacteria | 1966 |
| 310 | Ga0207669_10041711 | 3300025937 | Bacteria | 2674 |
| 311 | Ga0207704_10156166 | 3300025938 | Bacteria | 1617 |
| 312 | Ga0207665_10001524 | 3300025939 | Bacteria | 15580 |
| 313 | Ga0207691_10002783 | 3300025940 | Bacteria | 17058 |
| 314 | Ga0207691_10007330 | 3300025940 | Bacteria | 10639 |
| 315 | Ga0207691_10033432 | 3300025940 | Bacteria | 4787 |
| 316 | Ga0207689_10000145 | 3300025942 | Bacteria | 61402 |
| 317 | Ga0207689_10005712 | 3300025942 | Bacteria | 11064 |
| 318 | Ga0207689_10011411 | 3300025942 | Bacteria | 7615 |
| 319 | Ga0207689_10115191 | 3300025942 | Bacteria | 2209 |
| 320 | Ga0207661_10034621 | 3300025944 | Bacteria | 3930 |
| 321 | Ga0207679_10001573 | 3300025945 | Bacteria | 14272 |
| 322 | Ga0207679_10013299 | 3300025945 | Bacteria | 5393 |
| 323 | Ga0207667_10000460 | 3300025949 | Bacteria | 54739 |
| 324 | Ga0207667_10001678 | 3300025949 | Bacteria | 27885 |
| 325 | Ga0207651_10002196 | 3300025960 | Bacteria | 9238 |
| 326 | Ga0207651_10011420 | 3300025960 | Bacteria | 4974 |
| 327 | Ga0207651_10013977 | 3300025960 | Bacteria | 4619 |
| 328 | Ga0207712_10005617 | 3300025961 | Bacteria | 7910 |
| 329 | Ga0207668_10003150 | 3300025972 | Bacteria | 9657 |
| 330 | Ga0207668_10004756 | 3300025972 | Bacteria | 7990 |
| 331 | Ga0207640_10001797 | 3300025981 | Bacteria | 11519 |
| 332 | Ga0207677_10112699 | 3300026023 | Bacteria | 2029 |
| 333 | Ga0207639_10001047 | 3300026041 | Bacteria | 18785 |
| 334 | Ga0207678_10000941 | 3300026067 | Bacteria | 26550 |
| 335 | Ga0207678_10002480 | 3300026067 | Bacteria | 16774 |
| 336 | Ga0207708_10123599 | 3300026075 | Bacteria | 2018 |
| 337 | Ga0207702_10001916 | 3300026078 | Bacteria | 20332 |
| 338 | Ga0207702_10005739 | 3300026078 | Bacteria | 10812 |
| 339 | Ga0207702_10014160 | 3300026078 | Bacteria | 6624 |
| 340 | Ga0207702_10113676 | 3300026078 | Bacteria | 2411 |
| 341 | Ga0207641_10001097 | 3300026088 | Bacteria | 27224 |
| 342 | Ga0207641_10024315 | 3300026088 | Bacteria | 4993 |
| 343 | Ga0207641_10081077 | 3300026088 | Bacteria | 2817 |
| 344 | Ga0207641_10096781 | 3300026088 | Bacteria | 2593 |
| 345 | Ga0207648_10007171 | 3300026089 | Bacteria | 10989 |
| 346 | Ga0207648_10007874 | 3300026089 | Bacteria | 10396 |
| 347 | Ga0207648_10089993 | 3300026089 | Bacteria | 2681 |
| 348 | Ga0207676_10007102 | 3300026095 | Bacteria | 7936 |
| 349 | Ga0207676_10037544 | 3300026095 | Bacteria | 3692 |
| 350 | Ga0207674_10000248 | 3300026116 | Bacteria | 67145 |
| 351 | Ga0207674_10000650 | 3300026116 | Bacteria | 45189 |
| 352 | Ga0207674_10004811 | 3300026116 | Bacteria | 16172 |
| 353 | Ga0207674_10185202 | 3300026116 | Bacteria | 2033 |
| 354 | Ga0207675_100030585 | 3300026118 | Bacteria | 5016 |
| 355 | Ga0207683_10009224 | 3300026121 | Bacteria | 8408 |
| 356 | Ga0207683_10020624 | 3300026121 | Bacteria | 5639 |
| 357 | Ga0207683_10105089 | 3300026121 | Bacteria | 2524 |
| 358 | Ga0207698_10007732 | 3300026142 | Bacteria | 6746 |
| 359 | Ga0209969_1003079 | 3300027360 | Bacteria | 2303 |
| 360 | Ga0209967_1000460 | 3300027364 | Bacteria | 5365 |
| 361 | Ga0209967_1000554 | 3300027364 | Bacteria | 4917 |
| 362 | Ga0209981_1000615 | 3300027378 | Bacteria | 4507 |
| 363 | Ga0209981_1001151 | 3300027378 | Bacteria | 3353 |
| 364 | Ga0209996_1000434 | 3300027395 | Bacteria | 5044 |
| 365 | Ga0209984_1000614 | 3300027424 | Unclassified | 3863 |
| 366 | Ga0210000_1001726 | 3300027462 | Unclassified | 3087 |
| 367 | Ga0210000_1003174 | 3300027462 | Bacteria | 2364 |
| 368 | Ga0209995_1000422 | 3300027471 | Bacteria | 6567 |
| 369 | Ga0209995_1002434 | 3300027471 | Bacteria | 2939 |
| 370 | Ga0209968_1001670 | 3300027526 | Bacteria | 3351 |
| 371 | Ga0209999_1006748 | 3300027543 | Unclassified | 2066 |
| 372 | Ga0209983_1000184 | 3300027665 | Bacteria | 12117 |
| 373 | Ga0209588_1006914 | 3300027671 | Bacteria | 3320 |
| 374 | Ga0209971_1001259 | 3300027682 | Bacteria | 6321 |
| 375 | Ga0209971_1008604 | 3300027682 | Bacteria | 2422 |
| 376 | Ga0209971_1012182 | 3300027682 | Unclassified | 2036 |
| 377 | Ga0209966_1000700 | 3300027695 | Bacteria | 7235 |
| 378 | Ga0209966_1002924 | 3300027695 | Bacteria | 2862 |
| 379 | Ga0209974_10002094 | 3300027876 | Bacteria | 7305 |
| 380 | Ga0207428_10000276 | 3300027907 | Bacteria | 69031 |
| 381 | Ga0207428_10000367 | 3300027907 | Bacteria | 57765 |
| 382 | Ga0207428_10042873 | 3300027907 | Bacteria | 3658 |
| 383 | Ga0268266_10003146 | 3300028379 | Bacteria | 16766 |
| 384 | Ga0268266_10012759 | 3300028379 | Bacteria | 7261 |
| 385 | Ga0268265_10000922 | 3300028380 | Bacteria | 27196 |
| 386 | Ga0268265_10004017 | 3300028380 | Bacteria | 10358 |
| 387 | Ga0268265_10011548 | 3300028380 | Bacteria | 5971 |
| 388 | Ga0268265_10025011 | 3300028380 | Bacteria | 4232 |
| 389 | Ga0268265_10061839 | 3300028380 | Bacteria | 2875 |
| 390 | Ga0268264_10003021 | 3300028381 | Bacteria | 14584 |
| 391 | Ga0268264_10090445 | 3300028381 | Bacteria | 2638 |
| 392 | Ga0268264_10126364 | 3300028381 | Bacteria | 2260 |
| 393 | Ga0268264_10155219 | 3300028381 | Bacteria | 2056 |
| 394 | Ga0265340_10033026 | 3300031247 | Bacteria | 2579 |
| 395 | Ga0307408_100096726 | 3300031548 | Bacteria | 2241 |
| 396 | Ga0316578_10018812 | 3300031728 | Bacteria | 3793 |
| 397 | Ga0307410_10006474 | 3300031852 | Bacteria | 6323 |
| 398 | Ga0307410_10034351 | 3300031852 | Bacteria | 3284 |
| 399 | Ga0307410_10068121 | 3300031852 | Bacteria | 2457 |
| 400 | Ga0307406_10002846 | 3300031901 | Bacteria | 9425 |
| 401 | Ga0307412_10093747 | 3300031911 | Bacteria | 2107 |
| 402 | Ga0307409_100014523 | 3300031995 | Bacteria | 5128 |
| 403 | Ga0307416_100003495 | 3300032002 | Bacteria | 9240 |
| 404 | Ga0307416_100022943 | 3300032002 | Bacteria | 4518 |
| 405 | Ga0307416_100142482 | 3300032002 | Bacteria | 2181 |
| 406 | Ga0307411_10000468 | 3300032005 | Bacteria | 13997 |
| 407 | Ga0316583_10016133 | 3300032133 | Unclassified | 2689 |
| 408 | Ga0373949_0002144 | 3300035090 | Bacteria | 5184 |
| 409 | Ga0373949_0009796 | 3300035090 | Bacteria | 2098 |
| 410 | Ga0373951_0004297 | 3300035091 | Bacteria | 3393 |
| 411 | Ga0373951_0011778 | 3300035091 | Bacteria | 1966 |
| 412 | Ga0373932_0004818 | 3300035112 | Bacteria | 3180 |
| 413 | Ga0373939_0004635 | 3300035114 | Bacteria | 3257 |
| 414 | Ga0373954_0000072 | 3300035118 | Bacteria | 35827 |
| 415 | Ga0373942_0017631 | 3300035207 | Bacteria | 1763 |
| 416 | Ga0373961_0003773 | 3300035241 | Bacteria | 3703 |
| 417 | Ga0373931_0000241 | 3300035691 | Bacteria | 23316 |
| 418 | Ga0373931_0020886 | 3300035691 | Bacteria | 3280 |
| 419 | Ga0373935_0015604 | 3300035692 | Bacteria | 4594 |
| 420 | Ga0373935_0032752 | 3300035692 | Bacteria | 3231 |
| 421 | Ga0373933_0010657 | 3300035724 | Bacteria | 5040 |
| 422 | Ga0316582_0042743 | 3300036647 | Bacteria | 2840 |
| 423 | Ga0395899_0045877 | 3300037312 | Bacteria | 3256 |
| 424 | Ga0395900_0008419 | 3300037418 | Bacteria | 10610 |
| 425 | Ga0395900_0029736 | 3300037418 | Bacteria | 5606 |
| 426 | Ga0316581_0003420 | 3300037588 | Bacteria | 3950 |
| 427 | Ga0395901_0016199 | 3300038443 | Bacteria | 7595 |
| 428 | Ga0395901_0068664 | 3300038443 | Bacteria | 3692 |
| 429 | Ga0436360_0326106 | 3300039438 | Bacteria | 7096 |
| 430 | Ga0439461_0006148 | 3300041410 | Bacteria | 2082 |
| 431 | Ga0439441_000444 | 3300042001 | Bacteria | 4417 |
| 432 | Ga0439443_000977 | 3300042003 | Bacteria | 2935 |
| 433 | Ga0439448_0000598 | 3300042005 | Bacteria | 8501 |
| 434 | Ga0439448_0025415 | 3300042005 | Bacteria | 1858 |
| 435 | Ga0450888_001876 | 3300042126 | Bacteria | 2035 |
| 436 | Ga0439434_0000239 | 3300042435 | Bacteria | 15265 |
| 437 | Ga0439435_0000100 | 3300042436 | Bacteria | 10881 |
| 438 | Ga0439435_0000964 | 3300042436 | Bacteria | 5013 |
| 439 | Ga0439435_0007293 | 3300042436 | Bacteria | 2523 |
| 440 | Ga0439464_0014354 | 3300042439 | Bacteria | 2128 |
| 441 | Ga0439460_0000500 | 3300042461 | Bacteria | 8519 |
| 442 | Ga0439460_0004795 | 3300042461 | Unclassified | 3302 |
| 443 | Ga0451577_0001895 | 3300042876 | Bacteria | 26532 |
| 444 | Ga0451577_0019866 | 3300042876 | Bacteria | 6170 |
| 445 | Ga0451577_0029150 | 3300042876 | Bacteria | 4989 |
| 446 | Ga0451577_0162282 | 3300042876 | Bacteria | 2013 |
| 447 | Ga0453683_0005957 | 3300044673 | Bacteria | 8403 |
| 448 | Ga0453683_0031809 | 3300044673 | Bacteria | 3332 |
| 449 | Ga0466963_0018269 | 3300044694 | Bacteria | 4380 |
| 450 | Ga0453684_0012868 | 3300044712 | Bacteria | 13706 |
| 451 | Ga0451576_0003301 | 3300045051 | Bacteria | 22404 |
| 452 | Ga0451576_0005211 | 3300045051 | Bacteria | 16421 |
| 453 | Ga0451576_0045108 | 3300045051 | Unclassified | 4644 |
| 454 | Ga0451576_0045921 | 3300045051 | Bacteria | 4599 |
| 455 | Ga0451576_0106236 | 3300045051 | Bacteria | 2921 |
| 456 | Ga0451576_0450225 | 3300045051 | Bacteria | 1351 |
| 457 | Ga0466967_0022604 | 3300045976 | Bacteria | 5135 |
| 458 | Ga0466967_0198776 | 3300045976 | Bacteria | 1898 |
| 459 | Ga0495662_0027181 | 3300046476 | Bacteria | 2764 |
| 460 | Ga0495630_0064707 | 3300046517 | Bacteria | 2748 |
| 461 | Ga0495636_0009851 | 3300047318 | Bacteria | 3764 |
| 462 | Ga0496102_0008529 | 3300048905 | Bacteria | 8788 |
| 463 | Ga0496106_0010136 | 3300048909 | Bacteria | 6962 |
| 464 | Ga0496109_0087498 | 3300048912 | Bacteria | 2878 |
| 465 | Ga0496109_0262380 | 3300048912 | Bacteria | 1627 |
| 466 | Ga0501031_0072531 | 3300049568 | Bacteria | 2242 |
| 467 | Ga0501033_0053874 | 3300049570 | Bacteria | 2978 |
| 468 | Ga0501033_0056699 | 3300049570 | Bacteria | 2895 |
| 469 | Ga0501033_0066733 | 3300049570 | Bacteria | 2646 |
| 470 | Ga0501034_0009203 | 3300049571 | Bacteria | 10361 |
| 471 | Ga0501034_0023085 | 3300049571 | Bacteria | 6339 |
| 472 | Ga0501034_0042205 | 3300049571 | Bacteria | 4617 |
| 473 | Ga0501036_0021855 | 3300049572 | Bacteria | 5379 |
| 474 | Ga0501036_0041759 | 3300049572 | Bacteria | 3881 |
| 475 | Ga0501037_0039582 | 3300049573 | Bacteria | 3471 |
| 476 | Ga0501037_0110628 | 3300049573 | Unclassified | 1979 |
| 477 | Ga0501037_0120927 | 3300049573 | Unclassified | 1883 |
| 478 | Ga0501038_0001136 | 3300049574 | Bacteria | 24136 |
| 479 | Ga0501038_0001317 | 3300049574 | Bacteria | 22584 |
| 480 | Ga0501038_0012047 | 3300049574 | Bacteria | 7896 |
| 481 | Ga0501038_0072900 | 3300049574 | Bacteria | 2909 |
| 482 | Ga0501038_0090366 | 3300049574 | Unclassified | 2567 |
| 483 | Ga0501038_0097117 | 3300049574 | Bacteria | 2458 |
| 484 | Ga0501038_0112415 | 3300049574 | Bacteria | 2255 |
| 485 | Ga0501039_0009399 | 3300049575 | Bacteria | 7452 |
| 486 | Ga0501039_0018729 | 3300049575 | Bacteria | 5314 |
| 487 | Ga0501039_0050782 | 3300049575 | Bacteria | 3209 |
| 488 | Ga0501039_0114038 | 3300049575 | Bacteria | 2114 |
| 489 | Ga0501040_0000196 | 3300049576 | Bacteria | 35200 |
| 490 | Ga0501040_0009224 | 3300049576 | Bacteria | 6423 |
| 491 | Ga0501040_0016636 | 3300049576 | Bacteria | 4873 |
| 492 | Ga0501040_0020366 | 3300049576 | Bacteria | 4419 |
| 493 | Ga0501040_0030624 | 3300049576 | Bacteria | 3635 |
| 494 | Ga0501040_0030968 | 3300049576 | Bacteria | 3615 |
| 495 | Ga0501040_0038662 | 3300049576 | Bacteria | 3244 |
| 496 | Ga0501040_0043019 | 3300049576 | Bacteria | 3078 |
| 497 | Ga0501040_0061355 | 3300049576 | Bacteria | 2586 |
| 498 | Ga0501041_0000776 | 3300049577 | Bacteria | 17119 |
| 499 | Ga0501041_0008577 | 3300049577 | Bacteria | 6019 |
| 500 | Ga0501041_0008710 | 3300049577 | Bacteria | 5973 |
| 501 | Ga0501041_0009043 | 3300049577 | Bacteria | 5861 |
| 502 | Ga0501041_0010791 | 3300049577 | Bacteria | 5390 |
| 503 | Ga0501041_0014471 | 3300049577 | Bacteria | 4685 |
| 504 | Ga0501041_0015466 | 3300049577 | Bacteria | 4531 |
| 505 | Ga0501041_0019263 | 3300049577 | Bacteria | 4073 |
| 506 | Ga0501042_0002296 | 3300049578 | Bacteria | 11688 |
| 507 | Ga0501042_0002488 | 3300049578 | Bacteria | 11333 |
| 508 | Ga0501042_0003861 | 3300049578 | Bacteria | 9474 |
| 509 | Ga0501042_0013853 | 3300049578 | Bacteria | 5494 |
| 510 | Ga0501042_0014756 | 3300049578 | Bacteria | 5335 |
| 511 | Ga0501042_0078213 | 3300049578 | Unclassified | 2369 |
| 512 | Ga0501042_0148017 | 3300049578 | Bacteria | 1693 |
| 513 | Ga0501042_0176733 | 3300049578 | Unclassified | 1540 |
| 514 | Ga0501043_0079058 | 3300049579 | Bacteria | 2584 |
| 515 | Ga0501046_0000992 | 3300049580 | Bacteria | 27750 |
| 516 | Ga0501046_0006358 | 3300049580 | Bacteria | 10475 |
| 517 | Ga0501046_0020661 | 3300049580 | Bacteria | 5444 |
| 518 | Ga0501046_0027458 | 3300049580 | Bacteria | 4642 |
| 519 | Ga0501046_0104371 | 3300049580 | Unclassified | 2172 |
| 520 | Ga0501046_0156603 | 3300049580 | Bacteria | 1715 |
| 521 | Ga0501048_0000595 | 3300049582 | Bacteria | 25649 |
| 522 | Ga0501048_0008335 | 3300049582 | Bacteria | 7838 |
| 523 | Ga0501048_0020030 | 3300049582 | Bacteria | 4907 |
| 524 | Ga0501048_0034116 | 3300049582 | Bacteria | 3674 |
| 525 | Ga0501068_0004433 | 3300049584 | Bacteria | 7637 |
| 526 | Ga0501071_0001226 | 3300049587 | Bacteria | 14507 |
| 527 | Ga0501071_0002467 | 3300049587 | Bacteria | 11236 |
| 528 | Ga0501071_0005456 | 3300049587 | Bacteria | 8177 |
| 529 | Ga0501071_0080008 | 3300049587 | Unclassified | 2389 |
| 530 | Ga0501071_0101933 | 3300049587 | Bacteria | 2116 |
| 531 | Ga0501072_0001619 | 3300049588 | Bacteria | 16840 |
| 532 | Ga0501072_0013728 | 3300049588 | Bacteria | 6201 |
| 533 | Ga0501072_0013765 | 3300049588 | Bacteria | 6193 |
| 534 | Ga0501072_0020147 | 3300049588 | Bacteria | 5164 |
| 535 | Ga0501072_0028237 | 3300049588 | Unclassified | 4380 |
| 536 | Ga0501072_0036753 | 3300049588 | Bacteria | 3840 |
| 537 | Ga0501072_0042493 | 3300049588 | Bacteria | 3571 |
| 538 | Ga0501072_0046135 | 3300049588 | Bacteria | 3428 |
| 539 | Ga0501072_0058421 | 3300049588 | Unclassified | 3040 |
| 540 | Ga0501072_0096923 | 3300049588 | Bacteria | 2344 |
| 541 | Ga0501073_0021815 | 3300049589 | Bacteria | 4614 |
| 542 | Ga0501074_0008297 | 3300049590 | Bacteria | 7533 |
| 543 | Ga0501074_0055977 | 3300049590 | Bacteria | 2842 |
| 544 | Ga0501074_0124390 | 3300049590 | Bacteria | 1844 |
| 545 | Ga0501074_0144117 | 3300049590 | Bacteria | 1703 |
| 546 | Ga0501075_0000018 | 3300049591 | Bacteria | 68394 |
| 547 | Ga0501075_0000045 | 3300049591 | Bacteria | 50874 |
| 548 | Ga0501075_0011247 | 3300049591 | Bacteria | 6331 |
| 549 | Ga0501075_0015438 | 3300049591 | Bacteria | 5481 |
| 550 | Ga0501075_0034981 | 3300049591 | Bacteria | 3744 |
| 551 | Ga0501075_0038925 | 3300049591 | Bacteria | 3557 |
| 552 | Ga0501075_0042911 | 3300049591 | Unclassified | 3392 |
| 553 | Ga0501075_0061437 | 3300049591 | Bacteria | 2831 |
| 554 | Ga0501075_0080912 | 3300049591 | Bacteria | 2459 |
| 555 | Ga0501075_0094866 | 3300049591 | Bacteria | 2264 |
| 556 | Ga0501075_0114542 | 3300049591 | Bacteria | 2050 |
| 557 | Ga0501076_0000002 | 3300049592 | Bacteria | 165396 |
| 558 | Ga0501076_0000582 | 3300049592 | Bacteria | 23339 |
| 559 | Ga0501076_0003698 | 3300049592 | Bacteria | 10760 |
| 560 | Ga0501076_0017369 | 3300049592 | Bacteria | 5468 |
| 561 | Ga0501076_0020034 | 3300049592 | Bacteria | 5116 |
| 562 | Ga0501076_0066635 | 3300049592 | Bacteria | 2874 |
| 563 | Ga0501076_0194738 | 3300049592 | Bacteria | 1654 |
| 564 | Ga0501076_0268493 | 3300049592 | Bacteria | 1397 |
| 565 | Ga0501077_0000629 | 3300049593 | Bacteria | 21374 |
| 566 | Ga0501077_0000986 | 3300049593 | Bacteria | 17152 |
| 567 | Ga0501077_0003754 | 3300049593 | Bacteria | 9140 |
| 568 | Ga0501077_0018074 | 3300049593 | Bacteria | 4456 |
| 569 | Ga0501077_0026316 | 3300049593 | Unclassified | 3692 |
| 570 | Ga0501077_0030231 | 3300049593 | Bacteria | 3447 |
| 571 | Ga0501077_0054088 | 3300049593 | Unclassified | 2549 |
| 572 | Ga0501077_0124035 | 3300049593 | Unclassified | 1637 |
| 573 | Ga0501079_0007109 | 3300049741 | Bacteria | 8446 |
| 574 | Ga0501079_0009483 | 3300049741 | Bacteria | 7379 |
| 575 | Ga0501079_0013825 | 3300049741 | Bacteria | 6156 |
| 576 | Ga0501079_0035719 | 3300049741 | Bacteria | 3826 |
| 577 | Ga0501079_0148628 | 3300049741 | Bacteria | 1826 |
| 578 | Ga0501080_0006044 | 3300049742 | Bacteria | 10849 |
| 579 | Ga0501080_0019706 | 3300049742 | Bacteria | 6247 |
| 580 | Ga0501080_0022747 | 3300049742 | Bacteria | 5806 |
| 581 | Ga0501080_0036305 | 3300049742 | Bacteria | 4601 |
| 582 | Ga0501080_0036440 | 3300049742 | Bacteria | 4591 |
| 583 | Ga0501080_0058689 | 3300049742 | Bacteria | 3582 |
| 584 | Ga0501080_0072515 | 3300049742 | Bacteria | 3204 |
| 585 | Ga0501081_0000034 | 3300049743 | Bacteria | 50830 |
| 586 | Ga0501081_0001457 | 3300049743 | Bacteria | 14500 |
| 587 | Ga0501081_0005411 | 3300049743 | Bacteria | 8239 |
| 588 | Ga0501081_0007070 | 3300049743 | Bacteria | 7296 |
| 589 | Ga0501081_0007892 | 3300049743 | Bacteria | 6904 |
| 590 | Ga0501081_0015606 | 3300049743 | Bacteria | 5014 |
| 591 | Ga0501081_0021589 | 3300049743 | Bacteria | 4297 |
| 592 | Ga0501081_0030185 | 3300049743 | Unclassified | 3668 |
| 593 | Ga0501081_0033301 | 3300049743 | Bacteria | 3500 |
| 594 | Ga0501081_0063847 | 3300049743 | Bacteria | 2556 |
| 595 | Ga0501081_0073450 | 3300049743 | Bacteria | 2385 |
| 596 | Ga0501083_0041311 | 3300049744 | Bacteria | 3128 |
| 597 | Ga0501083_0097938 | 3300049744 | Bacteria | 1935 |
| 598 | Ga0501035_0009186 | 3300049822 | Bacteria | 9192 |
| 599 | Ga0501035_0038720 | 3300049822 | Bacteria | 4316 |
| 600 | Ga0501035_0303900 | 3300049822 | Unclassified | 1344 |
| 601 | Ga0501044_0289993 | 3300049823 | Bacteria | 1568 |
| 602 | Ga0501045_0002359 | 3300049824 | Bacteria | 12822 |
| 603 | Ga0501045_0003770 | 3300049824 | Bacteria | 10420 |
| 604 | Ga0501045_0007513 | 3300049824 | Bacteria | 7573 |
| 605 | Ga0501045_0014153 | 3300049824 | Bacteria | 5650 |
| 606 | Ga0501045_0014649 | 3300049824 | Bacteria | 5560 |
| 607 | Ga0501045_0030617 | 3300049824 | Bacteria | 3895 |
| 608 | nmdc:mga0yw44_10686_c1 | 3300050492 | Bacteria | 4701 |
| 609 | nmdc:mga0yw44_42828_c1 | 3300050492 | Bacteria | 2701 |
| 610 | nmdc:mga0k408_34614_c1 | 3300050493 | Bacteria | 2892 |
| 611 | nmdc:mga06z11_38116_c1 | 3300050494 | Bacteria | 2385 |
| 612 | nmdc:mga05p37_11225_c1 | 3300050507 | Bacteria | 10650 |
| 613 | nmdc:mga05p37_348_c1 | 3300050507 | Bacteria | 49472 |
| 614 | nmdc:mga05p37_55094_c1 | 3300050507 | Unclassified | 4892 |
| 615 | nmdc:mga05p37_639_c1 | 3300050507 | Bacteria | 38794 |
| 616 | nmdc:mga09592_154349_c1 | 3300050508 | Bacteria | 1982 |
| 617 | nmdc:mga09592_23032_c1 | 3300050508 | Bacteria | 5139 |
| 618 | nmdc:mga09592_55031_c1 | 3300050508 | Bacteria | 3362 |
| 619 | nmdc:mga0qj67_13348_c1 | 3300050509 | Bacteria | 6200 |
| 620 | nmdc:mga0qj67_150851_c1 | 3300050509 | Bacteria | 1886 |
| 621 | nmdc:mga0qj67_16106_c1 | 3300050509 | Bacteria | 5664 |
| 622 | nmdc:mga0qj67_19814_c1 | 3300050509 | Bacteria | 5145 |
| 623 | nmdc:mga0qj67_2861_c1 | 3300050509 | Bacteria | 12379 |
| 624 | nmdc:mga0qj67_98774_c1 | 3300050509 | Bacteria | 2352 |
| 625 | nmdc:mga06r32_148250_c1 | 3300050510 | Bacteria | 2324 |
| 626 | nmdc:mga06r32_15989_c1 | 3300050510 | Bacteria | 6828 |
| 627 | nmdc:mga06r32_222516_c1 | 3300050510 | Unclassified | 1876 |
| 628 | nmdc:mga06r32_270552_c1 | 3300050510 | Bacteria | 1686 |
| 629 | nmdc:mga06r32_51_c2 | 3300050510 | Bacteria | 15915 |
| 630 | nmdc:mga06r32_8310_c1 | 3300050510 | Bacteria | 9341 |
| 631 | nmdc:mga08y16_15684_c1 | 3300050511 | Bacteria | 7969 |
| 632 | nmdc:mga08y16_16747_c1 | 3300050511 | Bacteria | 7714 |
| 633 | nmdc:mga08y16_23916_c1 | 3300050511 | Bacteria | 6452 |
| 634 | nmdc:mga08y16_49798_c1 | 3300050511 | Bacteria | 4384 |
| 635 | nmdc:mga08y16_63236_c1 | 3300050511 | Bacteria | 3865 |
| 636 | nmdc:mga08y16_948_c1 | 3300050511 | Bacteria | 28184 |
| 637 | nmdc:mga0n895_1137_c1 | 3300050512 | Bacteria | 19479 |
| 638 | nmdc:mga0n895_18599_c1 | 3300050512 | Bacteria | 6434 |
| 639 | nmdc:mga0n895_191421_c1 | 3300050512 | Unclassified | 2076 |
| 640 | nmdc:mga0n895_19353_c1 | 3300050512 | Bacteria | 6326 |
| 641 | nmdc:mga0rr50_200182_c1 | 3300050513 | Bacteria | 1641 |
| 642 | nmdc:mga0rr50_3387_c1 | 3300050513 | Bacteria | 9164 |
| 643 | nmdc:mga0rr50_8575_c1 | 3300050513 | Bacteria | 6372 |
| 644 | nmdc:mga0rr50_8702_c1 | 3300050513 | Bacteria | 6330 |
| 645 | nmdc:mga0rr50_9028_c1 | 3300050513 | Bacteria | 6238 |
| 646 | nmdc:mga08x19_21784_c1 | 3300050514 | Bacteria | 3961 |
| 647 | nmdc:mga08x19_84606_c1 | 3300050514 | Bacteria | 2087 |
| 648 | nmdc:mga0a205_1929_c1 | 3300050515 | Bacteria | 18001 |
| 649 | nmdc:mga0a205_4612_c1 | 3300050515 | Bacteria | 12357 |
| 650 | nmdc:mga0a205_8497_c1 | 3300050515 | Bacteria | 9341 |
| 651 | nmdc:mga0a205_9216_c1 | 3300050515 | Bacteria | 9011 |
| 652 | nmdc:mga0a205_9854_c1 | 3300050515 | Bacteria | 8765 |
| 653 | nmdc:mga0sz30_416_c1 | 3300050516 | Bacteria | 16174 |
| 654 | Ga0500641_0020317 | 3300053096 | Bacteria | 2520 |
| 655 | Ga0500616_0026581 | 3300053153 | Bacteria | 3201 |
| 656 | Ga0501084_0000335 | 3300054114 | Bacteria | 35922 |
| 657 | Ga0501084_0003030 | 3300054114 | Bacteria | 13615 |
| 658 | Ga0501084_0004843 | 3300054114 | Bacteria | 10996 |
| 659 | Ga0501084_0027927 | 3300054114 | Bacteria | 4715 |
| 660 | Ga0501084_0042926 | 3300054114 | Bacteria | 3783 |
| 661 | Ga0501084_0048643 | 3300054114 | Bacteria | 3549 |
| 662 | Ga0501084_0054286 | 3300054114 | Bacteria | 3352 |
| 663 | Ga0501084_0055663 | 3300054114 | Unclassified | 3309 |
| 664 | Ga0501084_0063952 | 3300054114 | Bacteria | 3081 |
| 665 | Ga0501082_0000148 | 3300060353 | Bacteria | 58835 |
| 666 | Ga0501082_0002429 | 3300060353 | Bacteria | 16353 |
| 667 | Ga0501082_0012910 | 3300060353 | Bacteria | 7181 |
| 668 | Ga0501082_0013681 | 3300060353 | Bacteria | 6975 |
| 669 | Ga0501082_0016482 | 3300060353 | Bacteria | 6359 |
| 670 | Ga0501082_0023461 | 3300060353 | Bacteria | 5323 |
| 671 | Ga0501082_0031111 | 3300060353 | Bacteria | 4600 |
| 672 | Ga0501082_0039344 | 3300060353 | Bacteria | 4079 |
| 673 | Ga0501082_0042384 | 3300060353 | Bacteria | 3924 |
| 674 | Ga0501082_0083920 | 3300060353 | Bacteria | 2748 |
| 675 | Ga0530510_0000021 | 3300061734 | Bacteria | 75113 |
| 676 | Ga0530510_0000493 | 3300061734 | Bacteria | 25166 |
| 677 | Ga0530510_0000909 | 3300061734 | Bacteria | 19527 |
| 678 | Ga0530510_0003541 | 3300061734 | Bacteria | 10754 |
| 679 | Ga0530510_0036733 | 3300061734 | Bacteria | 3530 |
| 680 | Ga0530510_0051544 | 3300061734 | Bacteria | 2974 |
| 681 | Ga0530510_0053377 | 3300061734 | Bacteria | 2921 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049573 | Ga0501037_0110628 | Ga0501037_0110628_812_1969 | 381 |
| 2 | 3300049822 | Ga0501035_0303900 | Ga0501035_0303900_121_1320 | 395 |
| 3 | 3300045051 | Ga0451576_0450225 | Ga0451576_0450225_88_1293 | 398 |
| 4 | 3300049578 | Ga0501042_0078213 | Ga0501042_0078213_1137_2342 | 398 |
| 5 | 3300049588 | Ga0501072_0058421 | Ga0501072_0058421_35_1240 | 398 |
| 6 | 3300050508 | nmdc:mga09592_154349_c1 | nmdc:mga09592_154349_c1_10_1215 | 398 |
| 7 | 3300045976 | Ga0466967_0022604 | Ga0466967_0022604_14_1300 | 416 |
| 8 | 3300049592 | Ga0501076_0268493 | Ga0501076_0268493_74_1372 | 428 |
| 9 | 3300049574 | Ga0501038_0090366 | Ga0501038_0090366_1247_2551 | 431 |
| 10 | 3300031728 | Ga0316578_10018812 | Ga0316578_100188122 | 437 |
| 11 | 3300032133 | Ga0316583_10016133 | Ga0316583_100161331 | 437 |
| 12 | 3300036647 | Ga0316582_0042743 | Ga0316582_0042743_305_1675 | 437 |
| 13 | 3300037588 | Ga0316581_0003420 | Ga0316581_0003420_429_1799 | 437 |
| 14 | 3300061734 | Ga0530510_0000909 | Ga0530510_0000909_2733_4070 | 441 |
| 15 | 3300031852 | Ga0307410_10034351 | Ga0307410_100343512 | 442 |
| 16 | 3300027378 | Ga0209981_1000615 | Ga0209981_10006152 | 447 |
| 17 | 3300027462 | Ga0210000_1003174 | Ga0210000_10031742 | 447 |
| 18 | 3300027471 | Ga0209995_1002434 | Ga0209995_10024342 | 447 |
| 19 | 3300005334 | Ga0068869_100004150 | Ga0068869_1000041506 | 450 |
| 20 | 3300005347 | Ga0070668_100160924 | Ga0070668_1001609242 | 450 |
| 21 | 3300005353 | Ga0070669_100111142 | Ga0070669_1001111422 | 450 |
| 22 | 3300005456 | Ga0070678_100008275 | Ga0070678_1000082752 | 450 |
| 23 | 3300005543 | Ga0070672_100014473 | Ga0070672_1000144732 | 450 |
| 24 | 3300005844 | Ga0068862_100187319 | Ga0068862_1001873191 | 450 |
| 25 | 3300009148 | Ga0105243_10011356 | Ga0105243_100113565 | 450 |
| 26 | 3300009553 | Ga0105249_10093938 | Ga0105249_100939383 | 450 |
| 27 | 3300013306 | Ga0163162_10152154 | Ga0163162_101521541 | 450 |
| 28 | 3300025936 | Ga0207670_10041599 | Ga0207670_100415993 | 450 |
| 29 | 3300025940 | Ga0207691_10007330 | Ga0207691_100073307 | 450 |
| 30 | 3300025942 | Ga0207689_10005712 | Ga0207689_100057127 | 450 |
| 31 | 3300026089 | Ga0207648_10007171 | Ga0207648_100071719 | 450 |
| 32 | 3300026121 | Ga0207683_10009224 | Ga0207683_100092246 | 450 |
| 33 | 3300042439 | Ga0439464_0014354 | Ga0439464_0014354_749_2110 | 450 |
| 34 | 3300013297 | Ga0157378_10025324 | Ga0157378_100253243 | 451 |
| 35 | 3300005336 | Ga0070680_100166991 | Ga0070680_1001669912 | 452 |
| 36 | 3300005548 | Ga0070665_100230993 | Ga0070665_1002309932 | 452 |
| 37 | 3300005841 | Ga0068863_100278798 | Ga0068863_1002787981 | 452 |
| 38 | 3300025908 | Ga0207643_10033109 | Ga0207643_100331093 | 452 |
| 39 | 3300025938 | Ga0207704_10156166 | Ga0207704_101561661 | 452 |
| 40 | 3300047318 | Ga0495636_0009851 | Ga0495636_0009851_493_1866 | 452 |
| 41 | 3300005330 | Ga0070690_100078556 | Ga0070690_1000785562 | 453 |
| 42 | 3300005336 | Ga0070680_100019471 | Ga0070680_1000194715 | 453 |
| 43 | 3300005340 | Ga0070689_100038207 | Ga0070689_1000382072 | 453 |
| 44 | 3300005345 | Ga0070692_10004219 | Ga0070692_100042195 | 453 |
| 45 | 3300005347 | Ga0070668_100105775 | Ga0070668_1001057752 | 453 |
| 46 | 3300005354 | Ga0070675_100094983 | Ga0070675_1000949833 | 453 |
| 47 | 3300005441 | Ga0070700_100000652 | Ga0070700_10000065213 | 453 |
| 48 | 3300005459 | Ga0068867_100000876 | Ga0068867_10000087614 | 453 |
| 49 | 3300005543 | Ga0070672_100128913 | Ga0070672_1001289132 | 453 |
| 50 | 3300005719 | Ga0068861_100004028 | Ga0068861_1000040285 | 453 |
| 51 | 3300005844 | Ga0068862_100001923 | Ga0068862_1000019239 | 453 |
| 52 | 3300006852 | Ga0075433_10000184 | Ga0075433_1000018429 | 453 |
| 53 | 3300006871 | Ga0075434_100002746 | Ga0075434_10000274620 | 453 |
| 54 | 3300006914 | Ga0075436_100004153 | Ga0075436_1000041536 | 453 |
| 55 | 3300007076 | Ga0075435_100001390 | Ga0075435_10000139020 | 453 |
| 56 | 3300009094 | Ga0111539_10024762 | Ga0111539_100247623 | 453 |
| 57 | 3300009147 | Ga0114129_10027640 | Ga0114129_100276404 | 453 |
| 58 | 3300009148 | Ga0105243_10003195 | Ga0105243_1000319514 | 453 |
| 59 | 3300009553 | Ga0105249_10005966 | Ga0105249_100059667 | 453 |
| 60 | 3300014326 | Ga0157380_10037451 | Ga0157380_100374511 | 453 |
| 61 | 3300014745 | Ga0157377_10013374 | Ga0157377_100133744 | 453 |
| 62 | 3300025917 | Ga0207660_10062844 | Ga0207660_100628442 | 453 |
| 63 | 3300025935 | Ga0207709_10005588 | Ga0207709_100055885 | 453 |
| 64 | 3300025936 | Ga0207670_10112279 | Ga0207670_101122792 | 453 |
| 65 | 3300025942 | Ga0207689_10011411 | Ga0207689_100114114 | 453 |
| 66 | 3300025961 | Ga0207712_10005617 | Ga0207712_100056174 | 453 |
| 67 | 3300025972 | Ga0207668_10004756 | Ga0207668_100047565 | 453 |
| 68 | 3300027360 | Ga0209969_1003079 | Ga0209969_10030792 | 453 |
| 69 | 3300027526 | Ga0209968_1001670 | Ga0209968_10016703 | 453 |
| 70 | 3300027695 | Ga0209966_1002924 | Ga0209966_10029242 | 453 |
| 71 | 3300028380 | Ga0268265_10000922 | Ga0268265_1000092217 | 453 |
| 72 | 3300035090 | Ga0373949_0002144 | Ga0373949_0002144_591_1961 | 453 |
| 73 | 3300035091 | Ga0373951_0004297 | Ga0373951_0004297_224_1594 | 453 |
| 74 | 3300035112 | Ga0373932_0004818 | Ga0373932_0004818_1341_2711 | 453 |
| 75 | 3300035114 | Ga0373939_0004635 | Ga0373939_0004635_1226_2596 | 453 |
| 76 | 3300035241 | Ga0373961_0003773 | Ga0373961_0003773_1651_3021 | 453 |
| 77 | 3300035691 | Ga0373931_0000241 | Ga0373931_0000241_19845_21215 | 453 |
| 78 | 3300041410 | Ga0439461_0006148 | Ga0439461_0006148_17_1387 | 453 |
| 79 | 3300042435 | Ga0439434_0000239 | Ga0439434_0000239_10324_11694 | 453 |
| 80 | 3300042436 | Ga0439435_0000100 | Ga0439435_0000100_5054_6424 | 453 |
| 81 | 3300049588 | Ga0501072_0046135 | Ga0501072_0046135_577_1947 | 453 |
| 82 | 3300049589 | Ga0501073_0021815 | Ga0501073_0021815_3086_4459 | 453 |
| 83 | 3300049591 | Ga0501075_0038925 | Ga0501075_0038925_1935_3305 | 453 |
| 84 | 3300049593 | Ga0501077_0003754 | Ga0501077_0003754_1115_2485 | 453 |
| 85 | 3300050508 | nmdc:mga09592_23032_c1 | nmdc:mga09592_23032_c1_3574_4944 | 453 |
| 86 | 3300050511 | nmdc:mga08y16_16747_c1 | nmdc:mga08y16_16747_c1_5718_7088 | 453 |
| 87 | 3300050511 | nmdc:mga08y16_948_c1 | nmdc:mga08y16_948_c1_5728_7098 | 453 |
| 88 | 3300050512 | nmdc:mga0n895_18599_c1 | nmdc:mga0n895_18599_c1_3884_5254 | 453 |
| 89 | 3300050513 | nmdc:mga0rr50_3387_c1 | nmdc:mga0rr50_3387_c1_5223_6593 | 453 |
| 90 | 3300050514 | nmdc:mga08x19_84606_c1 | nmdc:mga08x19_84606_c1_312_1682 | 453 |
| 91 | 3300050515 | nmdc:mga0a205_9854_c1 | nmdc:mga0a205_9854_c1_2342_3712 | 453 |
| 92 | 3300005328 | Ga0070676_10000164 | Ga0070676_1000016421 | 454 |
| 93 | 3300005330 | Ga0070690_100029769 | Ga0070690_1000297695 | 454 |
| 94 | 3300005331 | Ga0070670_100001252 | Ga0070670_1000012529 | 454 |
| 95 | 3300005334 | Ga0068869_100000789 | Ga0068869_10000078915 | 454 |
| 96 | 3300005335 | Ga0070666_10039039 | Ga0070666_100390393 | 454 |
| 97 | 3300005336 | Ga0070680_100003118 | Ga0070680_1000031182 | 454 |
| 98 | 3300005337 | Ga0070682_100000147 | Ga0070682_10000014713 | 454 |
| 99 | 3300005338 | Ga0068868_100086921 | Ga0068868_1000869212 | 454 |
| 100 | 3300005339 | Ga0070660_100000639 | Ga0070660_10000063910 | 454 |
| 101 | 3300005340 | Ga0070689_100023306 | Ga0070689_1000233066 | 454 |
| 102 | 3300005344 | Ga0070661_100001058 | Ga0070661_10000105815 | 454 |
| 103 | 3300005345 | Ga0070692_10005256 | Ga0070692_100052563 | 454 |
| 104 | 3300005345 | Ga0070692_10051606 | Ga0070692_100516062 | 454 |
| 105 | 3300005347 | Ga0070668_100060420 | Ga0070668_1000604203 | 454 |
| 106 | 3300005353 | Ga0070669_100073493 | Ga0070669_1000734933 | 454 |
| 107 | 3300005364 | Ga0070673_100030068 | Ga0070673_1000300685 | 454 |
| 108 | 3300005366 | Ga0070659_100001053 | Ga0070659_10000105312 | 454 |
| 109 | 3300005440 | Ga0070705_100004619 | Ga0070705_1000046198 | 454 |
| 110 | 3300005440 | Ga0070705_100006953 | Ga0070705_1000069533 | 454 |
| 111 | 3300005444 | Ga0070694_100000490 | Ga0070694_10000049013 | 454 |
| 112 | 3300005444 | Ga0070694_100021721 | Ga0070694_1000217212 | 454 |
| 113 | 3300005445 | Ga0070708_100038364 | Ga0070708_1000383645 | 454 |
| 114 | 3300005457 | Ga0070662_100078612 | Ga0070662_1000786122 | 454 |
| 115 | 3300005458 | Ga0070681_10002249 | Ga0070681_1000224913 | 454 |
| 116 | 3300005459 | Ga0068867_100003046 | Ga0068867_1000030469 | 454 |
| 117 | 3300005467 | Ga0070706_100090638 | Ga0070706_1000906382 | 454 |
| 118 | 3300005471 | Ga0070698_100080951 | Ga0070698_1000809512 | 454 |
| 119 | 3300005535 | Ga0070684_100077425 | Ga0070684_1000774252 | 454 |
| 120 | 3300005539 | Ga0068853_100001868 | Ga0068853_10000186812 | 454 |
| 121 | 3300005545 | Ga0070695_100018893 | Ga0070695_1000188936 | 454 |
| 122 | 3300005546 | Ga0070696_100002890 | Ga0070696_1000028902 | 454 |
| 123 | 3300005547 | Ga0070693_100000088 | Ga0070693_10000008828 | 454 |
| 124 | 3300005549 | Ga0070704_100000580 | Ga0070704_10000058019 | 454 |
| 125 | 3300005563 | Ga0068855_100001859 | Ga0068855_10000185920 | 454 |
| 126 | 3300005577 | Ga0068857_100007072 | Ga0068857_10000707211 | 454 |
| 127 | 3300005578 | Ga0068854_100008881 | Ga0068854_1000088817 | 454 |
| 128 | 3300005614 | Ga0068856_100001089 | Ga0068856_10000108920 | 454 |
| 129 | 3300005615 | Ga0070702_100016589 | Ga0070702_1000165895 | 454 |
| 130 | 3300005617 | Ga0068859_100002050 | Ga0068859_10000205023 | 454 |
| 131 | 3300005617 | Ga0068859_100115241 | Ga0068859_1001152412 | 454 |
| 132 | 3300005618 | Ga0068864_100023302 | Ga0068864_1000233024 | 454 |
| 133 | 3300005840 | Ga0068870_10005480 | Ga0068870_100054803 | 454 |
| 134 | 3300005841 | Ga0068863_100040138 | Ga0068863_1000401383 | 454 |
| 135 | 3300005841 | Ga0068863_100088950 | Ga0068863_1000889501 | 454 |
| 136 | 3300005842 | Ga0068858_100152692 | Ga0068858_1001526921 | 454 |
| 137 | 3300005843 | Ga0068860_100044918 | Ga0068860_1000449182 | 454 |
| 138 | 3300005843 | Ga0068860_100122453 | Ga0068860_1001224532 | 454 |
| 139 | 3300006358 | Ga0068871_100004074 | Ga0068871_1000040743 | 454 |
| 140 | 3300006931 | Ga0097620_100002051 | Ga0097620_10000205123 | 454 |
| 141 | 3300006931 | Ga0097620_100115242 | Ga0097620_1001152422 | 454 |
| 142 | 3300009174 | Ga0105241_10000541 | Ga0105241_1000054133 | 454 |
| 143 | 3300013100 | Ga0157373_10000397 | Ga0157373_1000039728 | 454 |
| 144 | 3300013102 | Ga0157371_10074613 | Ga0157371_100746132 | 454 |
| 145 | 3300013105 | Ga0157369_10004373 | Ga0157369_1000437319 | 454 |
| 146 | 3300013307 | Ga0157372_10001274 | Ga0157372_1000127413 | 454 |
| 147 | 3300013308 | Ga0157375_10031192 | Ga0157375_100311927 | 454 |
| 148 | 3300014325 | Ga0163163_10039414 | Ga0163163_100394143 | 454 |
| 149 | 3300015262 | Ga0182007_10008718 | Ga0182007_100087182 | 454 |
| 150 | 3300025907 | Ga0207645_10000397 | Ga0207645_1000039721 | 454 |
| 151 | 3300025908 | Ga0207643_10001176 | Ga0207643_1000117614 | 454 |
| 152 | 3300025910 | Ga0207684_10050713 | Ga0207684_100507131 | 454 |
| 153 | 3300025911 | Ga0207654_10000830 | Ga0207654_1000083013 | 454 |
| 154 | 3300025912 | Ga0207707_10000078 | Ga0207707_1000007858 | 454 |
| 155 | 3300025917 | Ga0207660_10000335 | Ga0207660_1000033526 | 454 |
| 156 | 3300025917 | Ga0207660_10043397 | Ga0207660_100433971 | 454 |
| 157 | 3300025919 | Ga0207657_10000171 | Ga0207657_1000017157 | 454 |
| 158 | 3300025920 | Ga0207649_10001560 | Ga0207649_100015601 | 454 |
| 159 | 3300025921 | Ga0207652_10002588 | Ga0207652_1000258814 | 454 |
| 160 | 3300025922 | Ga0207646_10001625 | Ga0207646_1000162529 | 454 |
| 161 | 3300025932 | Ga0207690_10000917 | Ga0207690_1000091711 | 454 |
| 162 | 3300025933 | Ga0207706_10001320 | Ga0207706_1000132018 | 454 |
| 163 | 3300025942 | Ga0207689_10000145 | Ga0207689_1000014534 | 454 |
| 164 | 3300025945 | Ga0207679_10001573 | Ga0207679_100015734 | 454 |
| 165 | 3300025949 | Ga0207667_10001678 | Ga0207667_100016789 | 454 |
| 166 | 3300025960 | Ga0207651_10002196 | Ga0207651_100021962 | 454 |
| 167 | 3300025972 | Ga0207668_10003150 | Ga0207668_100031508 | 454 |
| 168 | 3300025981 | Ga0207640_10001797 | Ga0207640_1000179713 | 454 |
| 169 | 3300026023 | Ga0207677_10112699 | Ga0207677_101126991 | 454 |
| 170 | 3300026041 | Ga0207639_10001047 | Ga0207639_100010479 | 454 |
| 171 | 3300026067 | Ga0207678_10002480 | Ga0207678_1000248014 | 454 |
| 172 | 3300026078 | Ga0207702_10001916 | Ga0207702_1000191614 | 454 |
| 173 | 3300026088 | Ga0207641_10024315 | Ga0207641_100243153 | 454 |
| 174 | 3300026088 | Ga0207641_10096781 | Ga0207641_100967812 | 454 |
| 175 | 3300026089 | Ga0207648_10007874 | Ga0207648_1000787410 | 454 |
| 176 | 3300026095 | Ga0207676_10037544 | Ga0207676_100375444 | 454 |
| 177 | 3300026116 | Ga0207674_10000650 | Ga0207674_1000065028 | 454 |
| 178 | 3300026118 | Ga0207675_100030585 | Ga0207675_1000305853 | 454 |
| 179 | 3300026121 | Ga0207683_10105089 | Ga0207683_101050891 | 454 |
| 180 | 3300028379 | Ga0268266_10012759 | Ga0268266_100127594 | 454 |
| 181 | 3300028380 | Ga0268265_10011548 | Ga0268265_100115486 | 454 |
| 182 | 3300028381 | Ga0268264_10003021 | Ga0268264_100030216 | 454 |
| 183 | 3300028381 | Ga0268264_10090445 | Ga0268264_100904452 | 454 |
| 184 | 3300028381 | Ga0268264_10126364 | Ga0268264_101263641 | 454 |
| 185 | 3300035091 | Ga0373951_0011778 | Ga0373951_0011778_342_1724 | 454 |
| 186 | 3300042005 | Ga0439448_0000598 | Ga0439448_0000598_4252_5634 | 454 |
| 187 | 3300042876 | Ga0451577_0019866 | Ga0451577_0019866_3657_5039 | 454 |
| 188 | 3300042876 | Ga0451577_0029150 | Ga0451577_0029150_35_1411 | 454 |
| 189 | 3300044673 | Ga0453683_0005957 | Ga0453683_0005957_1140_2516 | 454 |
| 190 | 3300045051 | Ga0451576_0106236 | Ga0451576_0106236_140_1522 | 454 |
| 191 | 3300048905 | Ga0496102_0008529 | Ga0496102_0008529_2636_4018 | 454 |
| 192 | 3300048909 | Ga0496106_0010136 | Ga0496106_0010136_5129_6511 | 454 |
| 193 | 3300048912 | Ga0496109_0262380 | Ga0496109_0262380_204_1586 | 454 |
| 194 | 3300049577 | Ga0501041_0015466 | Ga0501041_0015466_1765_3138 | 454 |
| 195 | 3300049824 | Ga0501045_0030617 | Ga0501045_0030617_2406_3779 | 454 |
| 196 | 3300005330 | Ga0070690_100019776 | Ga0070690_1000197762 | 455 |
| 197 | 3300005331 | Ga0070670_100003427 | Ga0070670_1000034276 | 455 |
| 198 | 3300005331 | Ga0070670_100069704 | Ga0070670_1000697042 | 455 |
| 199 | 3300005334 | Ga0068869_100080735 | Ga0068869_1000807352 | 455 |
| 200 | 3300005340 | Ga0070689_100041882 | Ga0070689_1000418824 | 455 |
| 201 | 3300005341 | Ga0070691_10027934 | Ga0070691_100279342 | 455 |
| 202 | 3300005343 | Ga0070687_100046879 | Ga0070687_1000468792 | 455 |
| 203 | 3300005353 | Ga0070669_100020709 | Ga0070669_1000207092 | 455 |
| 204 | 3300005354 | Ga0070675_100007866 | Ga0070675_1000078666 | 455 |
| 205 | 3300005354 | Ga0070675_100011711 | Ga0070675_1000117115 | 455 |
| 206 | 3300005364 | Ga0070673_100003829 | Ga0070673_1000038297 | 455 |
| 207 | 3300005438 | Ga0070701_10027788 | Ga0070701_100277883 | 455 |
| 208 | 3300005440 | Ga0070705_100030761 | Ga0070705_1000307612 | 455 |
| 209 | 3300005444 | Ga0070694_100000164 | Ga0070694_10000016416 | 455 |
| 210 | 3300005444 | Ga0070694_100041987 | Ga0070694_1000419873 | 455 |
| 211 | 3300005457 | Ga0070662_100016778 | Ga0070662_1000167782 | 455 |
| 212 | 3300005471 | Ga0070698_100026914 | Ga0070698_1000269147 | 455 |
| 213 | 3300005471 | Ga0070698_100195307 | Ga0070698_1001953072 | 455 |
| 214 | 3300005518 | Ga0070699_100111465 | Ga0070699_1001114653 | 455 |
| 215 | 3300005536 | Ga0070697_100149919 | Ga0070697_1001499192 | 455 |
| 216 | 3300005543 | Ga0070672_100002353 | Ga0070672_1000023536 | 455 |
| 217 | 3300005543 | Ga0070672_100185300 | Ga0070672_1001853001 | 455 |
| 218 | 3300005545 | Ga0070695_100001300 | Ga0070695_1000013005 | 455 |
| 219 | 3300005545 | Ga0070695_100022662 | Ga0070695_1000226622 | 455 |
| 220 | 3300005545 | Ga0070695_100098783 | Ga0070695_1000987832 | 455 |
| 221 | 3300005546 | Ga0070696_100022222 | Ga0070696_1000222223 | 455 |
| 222 | 3300005546 | Ga0070696_100051489 | Ga0070696_1000514893 | 455 |
| 223 | 3300005547 | Ga0070693_100077520 | Ga0070693_1000775202 | 455 |
| 224 | 3300005549 | Ga0070704_100078761 | Ga0070704_1000787612 | 455 |
| 225 | 3300005577 | Ga0068857_100147518 | Ga0068857_1001475183 | 455 |
| 226 | 3300005618 | Ga0068864_100006436 | Ga0068864_1000064366 | 455 |
| 227 | 3300005841 | Ga0068863_100001012 | Ga0068863_1000010126 | 455 |
| 228 | 3300005843 | Ga0068860_100088392 | Ga0068860_1000883922 | 455 |
| 229 | 3300005843 | Ga0068860_100139237 | Ga0068860_1001392372 | 455 |
| 230 | 3300006846 | Ga0075430_100015771 | Ga0075430_1000157716 | 455 |
| 231 | 3300006847 | Ga0075431_100049276 | Ga0075431_1000492766 | 455 |
| 232 | 3300006847 | Ga0075431_100072345 | Ga0075431_1000723452 | 455 |
| 233 | 3300006852 | Ga0075433_10006577 | Ga0075433_100065776 | 455 |
| 234 | 3300006914 | Ga0075436_100010219 | Ga0075436_1000102193 | 455 |
| 235 | 3300009094 | Ga0111539_10044598 | Ga0111539_100445983 | 455 |
| 236 | 3300009098 | Ga0105245_10262176 | Ga0105245_102621761 | 455 |
| 237 | 3300009148 | Ga0105243_10063427 | Ga0105243_100634272 | 455 |
| 238 | 3300009177 | Ga0105248_10031847 | Ga0105248_100318479 | 455 |
| 239 | 3300013306 | Ga0163162_10057168 | Ga0163162_100571683 | 455 |
| 240 | 3300013306 | Ga0163162_10212000 | Ga0163162_102120002 | 455 |
| 241 | 3300013308 | Ga0157375_10015727 | Ga0157375_100157272 | 455 |
| 242 | 3300013308 | Ga0157375_10145870 | Ga0157375_101458701 | 455 |
| 243 | 3300013308 | Ga0157375_10233731 | Ga0157375_102337311 | 455 |
| 244 | 3300014325 | Ga0163163_10005091 | Ga0163163_100050916 | 455 |
| 245 | 3300014969 | Ga0157376_10014370 | Ga0157376_100143702 | 455 |
| 246 | 3300025910 | Ga0207684_10005312 | Ga0207684_1000531210 | 455 |
| 247 | 3300025923 | Ga0207681_10048338 | Ga0207681_100483383 | 455 |
| 248 | 3300025925 | Ga0207650_10004272 | Ga0207650_100042726 | 455 |
| 249 | 3300025925 | Ga0207650_10145627 | Ga0207650_101456272 | 455 |
| 250 | 3300025939 | Ga0207665_10001524 | Ga0207665_1000152417 | 455 |
| 251 | 3300025940 | Ga0207691_10033432 | Ga0207691_100334322 | 455 |
| 252 | 3300025942 | Ga0207689_10115191 | Ga0207689_101151912 | 455 |
| 253 | 3300025960 | Ga0207651_10011420 | Ga0207651_100114204 | 455 |
| 254 | 3300025960 | Ga0207651_10013977 | Ga0207651_100139774 | 455 |
| 255 | 3300026075 | Ga0207708_10123599 | Ga0207708_101235992 | 455 |
| 256 | 3300026088 | Ga0207641_10001097 | Ga0207641_1000109714 | 455 |
| 257 | 3300026089 | Ga0207648_10089993 | Ga0207648_100899932 | 455 |
| 258 | 3300026095 | Ga0207676_10007102 | Ga0207676_100071026 | 455 |
| 259 | 3300026116 | Ga0207674_10185202 | Ga0207674_101852022 | 455 |
| 260 | 3300027671 | Ga0209588_1006914 | Ga0209588_10069142 | 455 |
| 261 | 3300027695 | Ga0209966_1000700 | Ga0209966_10007009 | 455 |
| 262 | 3300028380 | Ga0268265_10061839 | Ga0268265_100618391 | 455 |
| 263 | 3300028381 | Ga0268264_10155219 | Ga0268264_101552192 | 455 |
| 264 | 3300031548 | Ga0307408_100096726 | Ga0307408_1000967262 | 455 |
| 265 | 3300035090 | Ga0373949_0009796 | Ga0373949_0009796_292_1683 | 455 |
| 266 | 3300042003 | Ga0439443_000977 | Ga0439443_000977_1446_2852 | 455 |
| 267 | 3300042436 | Ga0439435_0000964 | Ga0439435_0000964_2015_3421 | 455 |
| 268 | 3300042436 | Ga0439435_0007293 | Ga0439435_0007293_703_2085 | 455 |
| 269 | 3300042461 | Ga0439460_0000500 | Ga0439460_0000500_1955_3361 | 455 |
| 270 | 3300045051 | Ga0451576_0003301 | Ga0451576_0003301_8763_10154 | 455 |
| 271 | 3300045051 | Ga0451576_0045921 | Ga0451576_0045921_2556_3944 | 455 |
| 272 | 3300049568 | Ga0501031_0072531 | Ga0501031_0072531_796_2175 | 455 |
| 273 | 3300049570 | Ga0501033_0056699 | Ga0501033_0056699_1029_2408 | 455 |
| 274 | 3300049570 | Ga0501033_0066733 | Ga0501033_0066733_871_2259 | 455 |
| 275 | 3300049572 | Ga0501036_0021855 | Ga0501036_0021855_2317_3696 | 455 |
| 276 | 3300049574 | Ga0501038_0012047 | Ga0501038_0012047_854_2233 | 455 |
| 277 | 3300049574 | Ga0501038_0097117 | Ga0501038_0097117_580_1962 | 455 |
| 278 | 3300049575 | Ga0501039_0018729 | Ga0501039_0018729_136_1515 | 455 |
| 279 | 3300049575 | Ga0501039_0050782 | Ga0501039_0050782_1229_2614 | 455 |
| 280 | 3300049576 | Ga0501040_0009224 | Ga0501040_0009224_272_1651 | 455 |
| 281 | 3300049576 | Ga0501040_0043019 | Ga0501040_0043019_1218_2600 | 455 |
| 282 | 3300049577 | Ga0501041_0009043 | Ga0501041_0009043_4277_5656 | 455 |
| 283 | 3300049577 | Ga0501041_0010791 | Ga0501041_0010791_3105_4490 | 455 |
| 284 | 3300049577 | Ga0501041_0019263 | Ga0501041_0019263_674_2056 | 455 |
| 285 | 3300049578 | Ga0501042_0003861 | Ga0501042_0003861_1854_3233 | 455 |
| 286 | 3300049578 | Ga0501042_0148017 | Ga0501042_0148017_75_1454 | 455 |
| 287 | 3300049579 | Ga0501043_0079058 | Ga0501043_0079058_914_2293 | 455 |
| 288 | 3300049580 | Ga0501046_0027458 | Ga0501046_0027458_164_1543 | 455 |
| 289 | 3300049580 | Ga0501046_0156603 | Ga0501046_0156603_137_1516 | 455 |
| 290 | 3300049582 | Ga0501048_0000595 | Ga0501048_0000595_2474_3853 | 455 |
| 291 | 3300049584 | Ga0501068_0004433 | Ga0501068_0004433_3958_5337 | 455 |
| 292 | 3300049587 | Ga0501071_0005456 | Ga0501071_0005456_5830_7209 | 455 |
| 293 | 3300049588 | Ga0501072_0013728 | Ga0501072_0013728_664_2046 | 455 |
| 294 | 3300049588 | Ga0501072_0036753 | Ga0501072_0036753_1979_3358 | 455 |
| 295 | 3300049588 | Ga0501072_0096923 | Ga0501072_0096923_601_1989 | 455 |
| 296 | 3300049590 | Ga0501074_0008297 | Ga0501074_0008297_488_1867 | 455 |
| 297 | 3300049590 | Ga0501074_0055977 | Ga0501074_0055977_869_2257 | 455 |
| 298 | 3300049591 | Ga0501075_0034981 | Ga0501075_0034981_2310_3689 | 455 |
| 299 | 3300049591 | Ga0501075_0094866 | Ga0501075_0094866_207_1589 | 455 |
| 300 | 3300049592 | Ga0501076_0000582 | Ga0501076_0000582_15392_16771 | 455 |
| 301 | 3300049592 | Ga0501076_0066635 | Ga0501076_0066635_982_2370 | 455 |
| 302 | 3300049593 | Ga0501077_0000986 | Ga0501077_0000986_9383_10762 | 455 |
| 303 | 3300049593 | Ga0501077_0030231 | Ga0501077_0030231_1315_2694 | 455 |
| 304 | 3300049741 | Ga0501079_0007109 | Ga0501079_0007109_644_2023 | 455 |
| 305 | 3300049741 | Ga0501079_0013825 | Ga0501079_0013825_2622_4010 | 455 |
| 306 | 3300049741 | Ga0501079_0035719 | Ga0501079_0035719_586_1968 | 455 |
| 307 | 3300049742 | Ga0501080_0022747 | Ga0501080_0022747_3937_5316 | 455 |
| 308 | 3300049742 | Ga0501080_0036305 | Ga0501080_0036305_627_2015 | 455 |
| 309 | 3300049742 | Ga0501080_0058689 | Ga0501080_0058689_1098_2477 | 455 |
| 310 | 3300049743 | Ga0501081_0007070 | Ga0501081_0007070_398_1777 | 455 |
| 311 | 3300049743 | Ga0501081_0015606 | Ga0501081_0015606_1098_2477 | 455 |
| 312 | 3300049743 | Ga0501081_0021589 | Ga0501081_0021589_2552_3940 | 455 |
| 313 | 3300049743 | Ga0501081_0073450 | Ga0501081_0073450_662_2044 | 455 |
| 314 | 3300049744 | Ga0501083_0041311 | Ga0501083_0041311_1259_2638 | 455 |
| 315 | 3300049822 | Ga0501035_0009186 | Ga0501035_0009186_995_2374 | 455 |
| 316 | 3300049824 | Ga0501045_0007513 | Ga0501045_0007513_5798_7177 | 455 |
| 317 | 3300050507 | nmdc:mga05p37_11225_c1 | nmdc:mga05p37_11225_c1_4866_6257 | 455 |
| 318 | 3300050509 | nmdc:mga0qj67_13348_c1 | nmdc:mga0qj67_13348_c1_3566_4948 | 455 |
| 319 | 3300050509 | nmdc:mga0qj67_19814_c1 | nmdc:mga0qj67_19814_c1_1064_2446 | 455 |
| 320 | 3300050510 | nmdc:mga06r32_270552_c1 | nmdc:mga06r32_270552_c1_155_1561 | 455 |
| 321 | 3300050511 | nmdc:mga08y16_63236_c1 | nmdc:mga08y16_63236_c1_1178_2560 | 455 |
| 322 | 3300050512 | nmdc:mga0n895_191421_c1 | nmdc:mga0n895_191421_c1_505_1881 | 455 |
| 323 | 3300050513 | nmdc:mga0rr50_8575_c1 | nmdc:mga0rr50_8575_c1_4900_6291 | 455 |
| 324 | 3300050513 | nmdc:mga0rr50_8702_c1 | nmdc:mga0rr50_8702_c1_805_2196 | 455 |
| 325 | 3300050514 | nmdc:mga08x19_21784_c1 | nmdc:mga08x19_21784_c1_805_2196 | 455 |
| 326 | 3300050515 | nmdc:mga0a205_8497_c1 | nmdc:mga0a205_8497_c1_4129_5520 | 455 |
| 327 | 3300054114 | Ga0501084_0004843 | Ga0501084_0004843_5904_7283 | 455 |
| 328 | 3300054114 | Ga0501084_0048643 | Ga0501084_0048643_437_1825 | 455 |
| 329 | 3300060353 | Ga0501082_0023461 | Ga0501082_0023461_2402_3790 | 455 |
| 330 | 3300060353 | Ga0501082_0031111 | Ga0501082_0031111_1495_2874 | 455 |
| 331 | 3300060353 | Ga0501082_0039344 | Ga0501082_0039344_682_2064 | 455 |
| 332 | 3300060353 | Ga0501082_0083920 | Ga0501082_0083920_1235_2623 | 455 |
| 333 | 3300061734 | Ga0530510_0000493 | Ga0530510_0000493_646_2028 | 455 |
| 334 | 3300061734 | Ga0530510_0003541 | Ga0530510_0003541_7322_8701 | 455 |
| 335 | 3300005329 | Ga0070683_100060244 | Ga0070683_1000602444 | 456 |
| 336 | 3300005339 | Ga0070660_100010235 | Ga0070660_1000102352 | 456 |
| 337 | 3300005344 | Ga0070661_100005227 | Ga0070661_1000052278 | 456 |
| 338 | 3300005347 | Ga0070668_100032129 | Ga0070668_1000321294 | 456 |
| 339 | 3300005366 | Ga0070659_100028702 | Ga0070659_1000287022 | 456 |
| 340 | 3300005435 | Ga0070714_100008956 | Ga0070714_1000089567 | 456 |
| 341 | 3300005440 | Ga0070705_100071663 | Ga0070705_1000716632 | 456 |
| 342 | 3300005458 | Ga0070681_10138481 | Ga0070681_101384812 | 456 |
| 343 | 3300005535 | Ga0070684_100035943 | Ga0070684_1000359432 | 456 |
| 344 | 3300005539 | Ga0068853_100104081 | Ga0068853_1001040812 | 456 |
| 345 | 3300005564 | Ga0070664_100023948 | Ga0070664_1000239485 | 456 |
| 346 | 3300005577 | Ga0068857_100004059 | Ga0068857_1000040595 | 456 |
| 347 | 3300005834 | Ga0068851_10015934 | Ga0068851_100159344 | 456 |
| 348 | 3300005844 | Ga0068862_100057883 | Ga0068862_1000578834 | 456 |
| 349 | 3300006846 | Ga0075430_100004062 | Ga0075430_1000040623 | 456 |
| 350 | 3300006847 | Ga0075431_100011522 | Ga0075431_1000115224 | 456 |
| 351 | 3300006880 | Ga0075429_100005736 | Ga0075429_1000057362 | 456 |
| 352 | 3300009093 | Ga0105240_10012112 | Ga0105240_100121126 | 456 |
| 353 | 3300009093 | Ga0105240_10093438 | Ga0105240_100934382 | 456 |
| 354 | 3300009174 | Ga0105241_10034519 | Ga0105241_100345192 | 456 |
| 355 | 3300009177 | Ga0105248_10354541 | Ga0105248_103545411 | 456 |
| 356 | 3300009545 | Ga0105237_10056368 | Ga0105237_100563684 | 456 |
| 357 | 3300009551 | Ga0105238_10150055 | Ga0105238_101500551 | 456 |
| 358 | 3300013100 | Ga0157373_10023936 | Ga0157373_100239364 | 456 |
| 359 | 3300013102 | Ga0157371_10062440 | Ga0157371_100624402 | 456 |
| 360 | 3300013104 | Ga0157370_10204317 | Ga0157370_102043172 | 456 |
| 361 | 3300025911 | Ga0207654_10085733 | Ga0207654_100857333 | 456 |
| 362 | 3300025919 | Ga0207657_10045828 | Ga0207657_100458284 | 456 |
| 363 | 3300025920 | Ga0207649_10036128 | Ga0207649_100361282 | 456 |
| 364 | 3300025924 | Ga0207694_10046641 | Ga0207694_100466413 | 456 |
| 365 | 3300025929 | Ga0207664_10067889 | Ga0207664_100678892 | 456 |
| 366 | 3300025940 | Ga0207691_10002783 | Ga0207691_100027836 | 456 |
| 367 | 3300026116 | Ga0207674_10004811 | Ga0207674_100048119 | 456 |
| 368 | 3300046476 | Ga0495662_0027181 | Ga0495662_0027181_232_1617 | 456 |
| 369 | 3300046517 | Ga0495630_0064707 | Ga0495630_0064707_213_1598 | 456 |
| 370 | 3300049574 | Ga0501038_0112415 | Ga0501038_0112415_101_1480 | 456 |
| 371 | 3300049575 | Ga0501039_0114038 | Ga0501039_0114038_125_1504 | 456 |
| 372 | 3300049577 | Ga0501041_0014471 | Ga0501041_0014471_2688_4067 | 456 |
| 373 | 3300049578 | Ga0501042_0176733 | Ga0501042_0176733_122_1504 | 456 |
| 374 | 3300049587 | Ga0501071_0002467 | Ga0501071_0002467_3412_4791 | 456 |
| 375 | 3300049587 | Ga0501071_0101933 | Ga0501071_0101933_575_1954 | 456 |
| 376 | 3300049590 | Ga0501074_0144117 | Ga0501074_0144117_178_1557 | 456 |
| 377 | 3300049591 | Ga0501075_0015438 | Ga0501075_0015438_321_1700 | 456 |
| 378 | 3300049591 | Ga0501075_0114542 | Ga0501075_0114542_220_1596 | 456 |
| 379 | 3300049742 | Ga0501080_0006044 | Ga0501080_0006044_6821_8200 | 456 |
| 380 | 3300049742 | Ga0501080_0019706 | Ga0501080_0019706_3807_5186 | 456 |
| 381 | 3300049743 | Ga0501081_0033301 | Ga0501081_0033301_1431_2810 | 456 |
| 382 | 3300049824 | Ga0501045_0014649 | Ga0501045_0014649_3874_5253 | 456 |
| 383 | 3300050509 | nmdc:mga0qj67_2861_c1 | nmdc:mga0qj67_2861_c1_3253_4632 | 456 |
| 384 | 3300054114 | Ga0501084_0027927 | Ga0501084_0027927_84_1463 | 456 |
| 385 | 3300061734 | Ga0530510_0036733 | Ga0530510_0036733_1229_2608 | 456 |
| 386 | 3300005548 | Ga0070665_100008670 | Ga0070665_1000086701 | 457 |
| 387 | 3300005563 | Ga0068855_100370508 | Ga0068855_1003705081 | 457 |
| 388 | 3300005937 | Ga0081455_10000824 | Ga0081455_1000082439 | 457 |
| 389 | 3300005985 | Ga0081539_10000797 | Ga0081539_1000079738 | 457 |
| 390 | 3300006038 | Ga0075365_10086033 | Ga0075365_100860332 | 457 |
| 391 | 3300006042 | Ga0075368_10047499 | Ga0075368_100474992 | 457 |
| 392 | 3300006844 | Ga0075428_100002789 | Ga0075428_1000027895 | 457 |
| 393 | 3300006844 | Ga0075428_100332366 | Ga0075428_1003323661 | 457 |
| 394 | 3300006846 | Ga0075430_100019910 | Ga0075430_1000199102 | 457 |
| 395 | 3300006847 | Ga0075431_100001889 | Ga0075431_1000018895 | 457 |
| 396 | 3300006847 | Ga0075431_100004172 | Ga0075431_1000041728 | 457 |
| 397 | 3300006871 | Ga0075434_100000358 | Ga0075434_10000035831 | 457 |
| 398 | 3300006880 | Ga0075429_100000691 | Ga0075429_10000069113 | 457 |
| 399 | 3300006880 | Ga0075429_100010802 | Ga0075429_1000108023 | 457 |
| 400 | 3300007076 | Ga0075435_100058413 | Ga0075435_1000584132 | 457 |
| 401 | 3300009147 | Ga0114129_10001057 | Ga0114129_1000105726 | 457 |
| 402 | 3300009147 | Ga0114129_10067074 | Ga0114129_100670743 | 457 |
| 403 | 3300009147 | Ga0114129_10394966 | Ga0114129_103949662 | 457 |
| 404 | 3300014969 | Ga0157376_10228689 | Ga0157376_102286891 | 457 |
| 405 | 3300025933 | Ga0207706_10176272 | Ga0207706_101762722 | 457 |
| 406 | 3300026121 | Ga0207683_10020624 | Ga0207683_100206243 | 457 |
| 407 | 3300027364 | Ga0209967_1000460 | Ga0209967_10004602 | 457 |
| 408 | 3300027378 | Ga0209981_1001151 | Ga0209981_10011513 | 457 |
| 409 | 3300027395 | Ga0209996_1000434 | Ga0209996_10004342 | 457 |
| 410 | 3300027424 | Ga0209984_1000614 | Ga0209984_10006142 | 457 |
| 411 | 3300027462 | Ga0210000_1001726 | Ga0210000_10017262 | 457 |
| 412 | 3300027471 | Ga0209995_1000422 | Ga0209995_10004222 | 457 |
| 413 | 3300027543 | Ga0209999_1006748 | Ga0209999_10067482 | 457 |
| 414 | 3300027665 | Ga0209983_1000184 | Ga0209983_10001842 | 457 |
| 415 | 3300028379 | Ga0268266_10003146 | Ga0268266_100031466 | 457 |
| 416 | 3300031852 | Ga0307410_10006474 | Ga0307410_100064744 | 457 |
| 417 | 3300031852 | Ga0307410_10068121 | Ga0307410_100681212 | 457 |
| 418 | 3300031901 | Ga0307406_10002846 | Ga0307406_100028465 | 457 |
| 419 | 3300031911 | Ga0307412_10093747 | Ga0307412_100937472 | 457 |
| 420 | 3300031995 | Ga0307409_100014523 | Ga0307409_1000145232 | 457 |
| 421 | 3300032002 | Ga0307416_100003495 | Ga0307416_1000034958 | 457 |
| 422 | 3300032002 | Ga0307416_100022943 | Ga0307416_1000229435 | 457 |
| 423 | 3300032002 | Ga0307416_100142482 | Ga0307416_1001424822 | 457 |
| 424 | 3300032005 | Ga0307411_10000468 | Ga0307411_100004684 | 457 |
| 425 | 3300035118 | Ga0373954_0000072 | Ga0373954_0000072_33465_34850 | 457 |
| 426 | 3300035207 | Ga0373942_0017631 | Ga0373942_0017631_362_1744 | 457 |
| 427 | 3300035691 | Ga0373931_0020886 | Ga0373931_0020886_1786_3168 | 457 |
| 428 | 3300035724 | Ga0373933_0010657 | Ga0373933_0010657_2800_4185 | 457 |
| 429 | 3300038443 | Ga0395901_0016199 | Ga0395901_0016199_805_2220 | 457 |
| 430 | 3300044694 | Ga0466963_0018269 | Ga0466963_0018269_1063_2478 | 457 |
| 431 | 3300049570 | Ga0501033_0053874 | Ga0501033_0053874_1519_2901 | 457 |
| 432 | 3300049571 | Ga0501034_0009203 | Ga0501034_0009203_3150_4550 | 457 |
| 433 | 3300049571 | Ga0501034_0042205 | Ga0501034_0042205_3077_4477 | 457 |
| 434 | 3300049573 | Ga0501037_0120927 | Ga0501037_0120927_428_1810 | 457 |
| 435 | 3300049574 | Ga0501038_0072900 | Ga0501038_0072900_1322_2704 | 457 |
| 436 | 3300049576 | Ga0501040_0016636 | Ga0501040_0016636_725_2107 | 457 |
| 437 | 3300049576 | Ga0501040_0030624 | Ga0501040_0030624_1152_2534 | 457 |
| 438 | 3300049578 | Ga0501042_0002488 | Ga0501042_0002488_7162_8544 | 457 |
| 439 | 3300049578 | Ga0501042_0014756 | Ga0501042_0014756_1914_3296 | 457 |
| 440 | 3300049580 | Ga0501046_0006358 | Ga0501046_0006358_3448_4830 | 457 |
| 441 | 3300049580 | Ga0501046_0104371 | Ga0501046_0104371_161_1543 | 457 |
| 442 | 3300049582 | Ga0501048_0008335 | Ga0501048_0008335_6301_7683 | 457 |
| 443 | 3300049587 | Ga0501071_0080008 | Ga0501071_0080008_288_1670 | 457 |
| 444 | 3300049588 | Ga0501072_0013765 | Ga0501072_0013765_4376_5758 | 457 |
| 445 | 3300049588 | Ga0501072_0028237 | Ga0501072_0028237_2461_3843 | 457 |
| 446 | 3300049588 | Ga0501072_0042493 | Ga0501072_0042493_217_1599 | 457 |
| 447 | 3300049591 | Ga0501075_0011247 | Ga0501075_0011247_1106_2488 | 457 |
| 448 | 3300049591 | Ga0501075_0042911 | Ga0501075_0042911_1002_2384 | 457 |
| 449 | 3300049591 | Ga0501075_0061437 | Ga0501075_0061437_277_1659 | 457 |
| 450 | 3300049592 | Ga0501076_0017369 | Ga0501076_0017369_1880_3262 | 457 |
| 451 | 3300049592 | Ga0501076_0194738 | Ga0501076_0194738_247_1629 | 457 |
| 452 | 3300049593 | Ga0501077_0026316 | Ga0501077_0026316_201_1583 | 457 |
| 453 | 3300049593 | Ga0501077_0054088 | Ga0501077_0054088_544_1926 | 457 |
| 454 | 3300049743 | Ga0501081_0007892 | Ga0501081_0007892_3738_5120 | 457 |
| 455 | 3300049743 | Ga0501081_0030185 | Ga0501081_0030185_1281_2663 | 457 |
| 456 | 3300049743 | Ga0501081_0063847 | Ga0501081_0063847_399_1781 | 457 |
| 457 | 3300049823 | Ga0501044_0289993 | Ga0501044_0289993_31_1431 | 457 |
| 458 | 3300049824 | Ga0501045_0003770 | Ga0501045_0003770_7488_8870 | 457 |
| 459 | 3300049824 | Ga0501045_0014153 | Ga0501045_0014153_2661_4043 | 457 |
| 460 | 3300050492 | nmdc:mga0yw44_10686_c1 | nmdc:mga0yw44_10686_c1_2778_4172 | 457 |
| 461 | 3300050493 | nmdc:mga0k408_34614_c1 | nmdc:mga0k408_34614_c1_323_1717 | 457 |
| 462 | 3300050494 | nmdc:mga06z11_38116_c1 | nmdc:mga06z11_38116_c1_633_2027 | 457 |
| 463 | 3300050507 | nmdc:mga05p37_55094_c1 | nmdc:mga05p37_55094_c1_1225_2607 | 457 |
| 464 | 3300050507 | nmdc:mga05p37_639_c1 | nmdc:mga05p37_639_c1_17612_18994 | 457 |
| 465 | 3300050508 | nmdc:mga09592_55031_c1 | nmdc:mga09592_55031_c1_1853_3241 | 457 |
| 466 | 3300050509 | nmdc:mga0qj67_16106_c1 | nmdc:mga0qj67_16106_c1_4140_5528 | 457 |
| 467 | 3300050510 | nmdc:mga06r32_15989_c1 | nmdc:mga06r32_15989_c1_5331_6713 | 457 |
| 468 | 3300050510 | nmdc:mga06r32_222516_c1 | nmdc:mga06r32_222516_c1_110_1492 | 457 |
| 469 | 3300050510 | nmdc:mga06r32_8310_c1 | nmdc:mga06r32_8310_c1_4231_5619 | 457 |
| 470 | 3300050512 | nmdc:mga0n895_1137_c1 | nmdc:mga0n895_1137_c1_10543_11928 | 457 |
| 471 | 3300050513 | nmdc:mga0rr50_9028_c1 | nmdc:mga0rr50_9028_c1_519_1904 | 457 |
| 472 | 3300050516 | nmdc:mga0sz30_416_c1 | nmdc:mga0sz30_416_c1_205_1599 | 457 |
| 473 | 3300054114 | Ga0501084_0000335 | Ga0501084_0000335_12508_13890 | 457 |
| 474 | 3300054114 | Ga0501084_0055663 | Ga0501084_0055663_1053_2435 | 457 |
| 475 | 3300060353 | Ga0501082_0002429 | Ga0501082_0002429_8314_9696 | 457 |
| 476 | 3300060353 | Ga0501082_0016482 | Ga0501082_0016482_3910_5292 | 457 |
| 477 | 3300061734 | Ga0530510_0053377 | Ga0530510_0053377_1394_2776 | 457 |
| 478 | 3300005327 | Ga0070658_10002912 | Ga0070658_100029122 | 458 |
| 479 | 3300005329 | Ga0070683_100004516 | Ga0070683_1000045167 | 458 |
| 480 | 3300005329 | Ga0070683_100018723 | Ga0070683_1000187232 | 458 |
| 481 | 3300005331 | Ga0070670_100116588 | Ga0070670_1001165882 | 458 |
| 482 | 3300005336 | Ga0070680_100262992 | Ga0070680_1002629921 | 458 |
| 483 | 3300005339 | Ga0070660_100021908 | Ga0070660_1000219085 | 458 |
| 484 | 3300005344 | Ga0070661_100041417 | Ga0070661_1000414173 | 458 |
| 485 | 3300005366 | Ga0070659_100034698 | Ga0070659_1000346983 | 458 |
| 486 | 3300005435 | Ga0070714_100007718 | Ga0070714_1000077189 | 458 |
| 487 | 3300005436 | Ga0070713_100020849 | Ga0070713_1000208494 | 458 |
| 488 | 3300005439 | Ga0070711_100058362 | Ga0070711_1000583621 | 458 |
| 489 | 3300005444 | Ga0070694_100003964 | Ga0070694_1000039645 | 458 |
| 490 | 3300005455 | Ga0070663_100002585 | Ga0070663_1000025858 | 458 |
| 491 | 3300005458 | Ga0070681_10010440 | Ga0070681_1001044010 | 458 |
| 492 | 3300005459 | Ga0068867_100146329 | Ga0068867_1001463292 | 458 |
| 493 | 3300005471 | Ga0070698_100002891 | Ga0070698_1000028914 | 458 |
| 494 | 3300005471 | Ga0070698_100025124 | Ga0070698_1000251248 | 458 |
| 495 | 3300005518 | Ga0070699_100049278 | Ga0070699_1000492782 | 458 |
| 496 | 3300005518 | Ga0070699_100052108 | Ga0070699_1000521083 | 458 |
| 497 | 3300005530 | Ga0070679_100069046 | Ga0070679_1000690463 | 458 |
| 498 | 3300005535 | Ga0070684_100001027 | Ga0070684_1000010278 | 458 |
| 499 | 3300005539 | Ga0068853_100010394 | Ga0068853_1000103948 | 458 |
| 500 | 3300005563 | Ga0068855_100086023 | Ga0068855_1000860232 | 458 |
| 501 | 3300005563 | Ga0068855_100298492 | Ga0068855_1002984922 | 458 |
| 502 | 3300005564 | Ga0070664_100006137 | Ga0070664_10000613711 | 458 |
| 503 | 3300005577 | Ga0068857_100017062 | Ga0068857_1000170624 | 458 |
| 504 | 3300005578 | Ga0068854_100003327 | Ga0068854_1000033275 | 458 |
| 505 | 3300005614 | Ga0068856_100023739 | Ga0068856_1000237394 | 458 |
| 506 | 3300005614 | Ga0068856_100034475 | Ga0068856_1000344752 | 458 |
| 507 | 3300005614 | Ga0068856_100203212 | Ga0068856_1002032122 | 458 |
| 508 | 3300005614 | Ga0068856_100207788 | Ga0068856_1002077882 | 458 |
| 509 | 3300005617 | Ga0068859_100006939 | Ga0068859_1000069397 | 458 |
| 510 | 3300005834 | Ga0068851_10016876 | Ga0068851_100168763 | 458 |
| 511 | 3300005843 | Ga0068860_100206348 | Ga0068860_1002063482 | 458 |
| 512 | 3300005844 | Ga0068862_100012226 | Ga0068862_1000122261 | 458 |
| 513 | 3300005844 | Ga0068862_100018363 | Ga0068862_1000183633 | 458 |
| 514 | 3300005937 | Ga0081455_10001949 | Ga0081455_1000194917 | 458 |
| 515 | 3300005937 | Ga0081455_10094342 | Ga0081455_100943422 | 458 |
| 516 | 3300005981 | Ga0081538_10037454 | Ga0081538_100374543 | 458 |
| 517 | 3300005985 | Ga0081539_10031165 | Ga0081539_100311652 | 458 |
| 518 | 3300006051 | Ga0075364_10109912 | Ga0075364_101099122 | 458 |
| 519 | 3300006058 | Ga0075432_10005305 | Ga0075432_100053053 | 458 |
| 520 | 3300006175 | Ga0070712_100001581 | Ga0070712_10000158122 | 458 |
| 521 | 3300006175 | Ga0070712_100118277 | Ga0070712_1001182772 | 458 |
| 522 | 3300006844 | Ga0075428_100004047 | Ga0075428_1000040474 | 458 |
| 523 | 3300006844 | Ga0075428_100050090 | Ga0075428_1000500903 | 458 |
| 524 | 3300006846 | Ga0075430_100063274 | Ga0075430_1000632743 | 458 |
| 525 | 3300006846 | Ga0075430_100098995 | Ga0075430_1000989952 | 458 |
| 526 | 3300006847 | Ga0075431_100000073 | Ga0075431_10000007344 | 458 |
| 527 | 3300006847 | Ga0075431_100191508 | Ga0075431_1001915082 | 458 |
| 528 | 3300006852 | Ga0075433_10002071 | Ga0075433_1000207110 | 458 |
| 529 | 3300006852 | Ga0075433_10048205 | Ga0075433_100482052 | 458 |
| 530 | 3300006871 | Ga0075434_100067221 | Ga0075434_1000672213 | 458 |
| 531 | 3300006871 | Ga0075434_100069941 | Ga0075434_1000699411 | 458 |
| 532 | 3300006880 | Ga0075429_100044699 | Ga0075429_1000446994 | 458 |
| 533 | 3300006880 | Ga0075429_100202191 | Ga0075429_1002021911 | 458 |
| 534 | 3300006931 | Ga0097620_100006939 | Ga0097620_1000069397 | 458 |
| 535 | 3300009094 | Ga0111539_10000724 | Ga0111539_1000072430 | 458 |
| 536 | 3300009094 | Ga0111539_10019169 | Ga0111539_100191692 | 458 |
| 537 | 3300009148 | Ga0105243_10144348 | Ga0105243_101443481 | 458 |
| 538 | 3300009174 | Ga0105241_10026181 | Ga0105241_100261814 | 458 |
| 539 | 3300009176 | Ga0105242_10018292 | Ga0105242_100182923 | 458 |
| 540 | 3300013100 | Ga0157373_10031614 | Ga0157373_100316143 | 458 |
| 541 | 3300013102 | Ga0157371_10011892 | Ga0157371_100118928 | 458 |
| 542 | 3300013102 | Ga0157371_10080115 | Ga0157371_100801152 | 458 |
| 543 | 3300013104 | Ga0157370_10010331 | Ga0157370_100103319 | 458 |
| 544 | 3300013104 | Ga0157370_10024359 | Ga0157370_100243594 | 458 |
| 545 | 3300013104 | Ga0157370_10056149 | Ga0157370_100561493 | 458 |
| 546 | 3300013105 | Ga0157369_10061232 | Ga0157369_100612323 | 458 |
| 547 | 3300013105 | Ga0157369_10064706 | Ga0157369_100647063 | 458 |
| 548 | 3300013307 | Ga0157372_10012997 | Ga0157372_100129976 | 458 |
| 549 | 3300013307 | Ga0157372_10020399 | Ga0157372_100203993 | 458 |
| 550 | 3300013307 | Ga0157372_10066700 | Ga0157372_100667004 | 458 |
| 551 | 3300013307 | Ga0157372_10101813 | Ga0157372_101018133 | 458 |
| 552 | 3300013308 | Ga0157375_10149992 | Ga0157375_101499922 | 458 |
| 553 | 3300014497 | Ga0182008_10040807 | Ga0182008_100408072 | 458 |
| 554 | 3300014968 | Ga0157379_10106418 | Ga0157379_101064182 | 458 |
| 555 | 3300021441 | Ga0213871_10001775 | Ga0213871_100017752 | 458 |
| 556 | 3300025321 | Ga0207656_10009391 | Ga0207656_100093913 | 458 |
| 557 | 3300025912 | Ga0207707_10015848 | Ga0207707_100158482 | 458 |
| 558 | 3300025912 | Ga0207707_10036832 | Ga0207707_100368323 | 458 |
| 559 | 3300025913 | Ga0207695_10011778 | Ga0207695_1001177811 | 458 |
| 560 | 3300025915 | Ga0207693_10010502 | Ga0207693_1001050211 | 458 |
| 561 | 3300025917 | Ga0207660_10008764 | Ga0207660_100087643 | 458 |
| 562 | 3300025917 | Ga0207660_10105010 | Ga0207660_101050103 | 458 |
| 563 | 3300025919 | Ga0207657_10000151 | Ga0207657_1000015167 | 458 |
| 564 | 3300025919 | Ga0207657_10014391 | Ga0207657_100143918 | 458 |
| 565 | 3300025920 | Ga0207649_10050481 | Ga0207649_100504812 | 458 |
| 566 | 3300025921 | Ga0207652_10037059 | Ga0207652_100370593 | 458 |
| 567 | 3300025924 | Ga0207694_10031809 | Ga0207694_100318093 | 458 |
| 568 | 3300025924 | Ga0207694_10040663 | Ga0207694_100406632 | 458 |
| 569 | 3300025925 | Ga0207650_10093534 | Ga0207650_100935342 | 458 |
| 570 | 3300025929 | Ga0207664_10071248 | Ga0207664_100712482 | 458 |
| 571 | 3300025933 | Ga0207706_10032284 | Ga0207706_100322845 | 458 |
| 572 | 3300025937 | Ga0207669_10041711 | Ga0207669_100417112 | 458 |
| 573 | 3300025944 | Ga0207661_10034621 | Ga0207661_100346212 | 458 |
| 574 | 3300025945 | Ga0207679_10013299 | Ga0207679_100132993 | 458 |
| 575 | 3300025949 | Ga0207667_10000460 | Ga0207667_100004608 | 458 |
| 576 | 3300026067 | Ga0207678_10000941 | Ga0207678_1000094116 | 458 |
| 577 | 3300026078 | Ga0207702_10005739 | Ga0207702_100057392 | 458 |
| 578 | 3300026078 | Ga0207702_10014160 | Ga0207702_100141605 | 458 |
| 579 | 3300026078 | Ga0207702_10113676 | Ga0207702_101136762 | 458 |
| 580 | 3300026088 | Ga0207641_10081077 | Ga0207641_100810773 | 458 |
| 581 | 3300026116 | Ga0207674_10000248 | Ga0207674_1000024845 | 458 |
| 582 | 3300026142 | Ga0207698_10007732 | Ga0207698_100077328 | 458 |
| 583 | 3300027364 | Ga0209967_1000554 | Ga0209967_10005547 | 458 |
| 584 | 3300027682 | Ga0209971_1001259 | Ga0209971_10012596 | 458 |
| 585 | 3300027682 | Ga0209971_1008604 | Ga0209971_10086041 | 458 |
| 586 | 3300027682 | Ga0209971_1012182 | Ga0209971_10121821 | 458 |
| 587 | 3300027876 | Ga0209974_10002094 | Ga0209974_100020945 | 458 |
| 588 | 3300027907 | Ga0207428_10000276 | Ga0207428_1000027664 | 458 |
| 589 | 3300027907 | Ga0207428_10000367 | Ga0207428_1000036731 | 458 |
| 590 | 3300027907 | Ga0207428_10042873 | Ga0207428_100428732 | 458 |
| 591 | 3300028380 | Ga0268265_10004017 | Ga0268265_1000401711 | 458 |
| 592 | 3300028380 | Ga0268265_10025011 | Ga0268265_100250114 | 458 |
| 593 | 3300031247 | Ga0265340_10033026 | Ga0265340_100330262 | 458 |
| 594 | 3300035692 | Ga0373935_0015604 | Ga0373935_0015604_3046_4437 | 458 |
| 595 | 3300035692 | Ga0373935_0032752 | Ga0373935_0032752_248_1648 | 458 |
| 596 | 3300037312 | Ga0395899_0045877 | Ga0395899_0045877_281_1702 | 458 |
| 597 | 3300037418 | Ga0395900_0008419 | Ga0395900_0008419_7575_8996 | 458 |
| 598 | 3300037418 | Ga0395900_0029736 | Ga0395900_0029736_154_1530 | 458 |
| 599 | 3300038443 | Ga0395901_0068664 | Ga0395901_0068664_560_1936 | 458 |
| 600 | 3300039438 | Ga0436360_0326106 | Ga0436360_0326106_5349_6749 | 458 |
| 601 | 3300042001 | Ga0439441_000444 | Ga0439441_000444_2014_3402 | 458 |
| 602 | 3300042005 | Ga0439448_0025415 | Ga0439448_0025415_96_1544 | 458 |
| 603 | 3300042126 | Ga0450888_001876 | Ga0450888_001876_390_1811 | 458 |
| 604 | 3300042461 | Ga0439460_0004795 | Ga0439460_0004795_350_1798 | 458 |
| 605 | 3300042876 | Ga0451577_0001895 | Ga0451577_0001895_21717_23105 | 458 |
| 606 | 3300042876 | Ga0451577_0162282 | Ga0451577_0162282_275_1723 | 458 |
| 607 | 3300044673 | Ga0453683_0031809 | Ga0453683_0031809_329_1717 | 458 |
| 608 | 3300044712 | Ga0453684_0012868 | Ga0453684_0012868_1786_3174 | 458 |
| 609 | 3300045051 | Ga0451576_0005211 | Ga0451576_0005211_9422_10810 | 458 |
| 610 | 3300045051 | Ga0451576_0045108 | Ga0451576_0045108_3171_4619 | 458 |
| 611 | 3300045976 | Ga0466967_0198776 | Ga0466967_0198776_307_1683 | 458 |
| 612 | 3300048912 | Ga0496109_0087498 | Ga0496109_0087498_1208_2587 | 458 |
| 613 | 3300049571 | Ga0501034_0023085 | Ga0501034_0023085_1465_2865 | 458 |
| 614 | 3300049572 | Ga0501036_0041759 | Ga0501036_0041759_1984_3363 | 458 |
| 615 | 3300049573 | Ga0501037_0039582 | Ga0501037_0039582_690_2078 | 458 |
| 616 | 3300049574 | Ga0501038_0001136 | Ga0501038_0001136_7566_8954 | 458 |
| 617 | 3300049574 | Ga0501038_0001317 | Ga0501038_0001317_6975_8354 | 458 |
| 618 | 3300049575 | Ga0501039_0009399 | Ga0501039_0009399_1661_3049 | 458 |
| 619 | 3300049576 | Ga0501040_0000196 | Ga0501040_0000196_3136_4524 | 458 |
| 620 | 3300049576 | Ga0501040_0020366 | Ga0501040_0020366_771_2171 | 458 |
| 621 | 3300049576 | Ga0501040_0030968 | Ga0501040_0030968_429_1808 | 458 |
| 622 | 3300049576 | Ga0501040_0038662 | Ga0501040_0038662_1471_2850 | 458 |
| 623 | 3300049576 | Ga0501040_0061355 | Ga0501040_0061355_1014_2411 | 458 |
| 624 | 3300049577 | Ga0501041_0000776 | Ga0501041_0000776_13948_15336 | 458 |
| 625 | 3300049577 | Ga0501041_0008577 | Ga0501041_0008577_3611_4990 | 458 |
| 626 | 3300049577 | Ga0501041_0008710 | Ga0501041_0008710_3013_4413 | 458 |
| 627 | 3300049578 | Ga0501042_0002296 | Ga0501042_0002296_3154_4533 | 458 |
| 628 | 3300049578 | Ga0501042_0013853 | Ga0501042_0013853_261_1661 | 458 |
| 629 | 3300049580 | Ga0501046_0000992 | Ga0501046_0000992_12433_13821 | 458 |
| 630 | 3300049580 | Ga0501046_0020661 | Ga0501046_0020661_3724_5103 | 458 |
| 631 | 3300049582 | Ga0501048_0020030 | Ga0501048_0020030_1856_3244 | 458 |
| 632 | 3300049582 | Ga0501048_0034116 | Ga0501048_0034116_231_1610 | 458 |
| 633 | 3300049587 | Ga0501071_0001226 | Ga0501071_0001226_7037_8425 | 458 |
| 634 | 3300049588 | Ga0501072_0001619 | Ga0501072_0001619_252_1640 | 458 |
| 635 | 3300049588 | Ga0501072_0020147 | Ga0501072_0020147_1480_2880 | 458 |
| 636 | 3300049590 | Ga0501074_0124390 | Ga0501074_0124390_114_1502 | 458 |
| 637 | 3300049591 | Ga0501075_0000018 | Ga0501075_0000018_38895_40274 | 458 |
| 638 | 3300049591 | Ga0501075_0000045 | Ga0501075_0000045_22978_24366 | 458 |
| 639 | 3300049591 | Ga0501075_0080912 | Ga0501075_0080912_633_2030 | 458 |
| 640 | 3300049592 | Ga0501076_0000002 | Ga0501076_0000002_89750_91129 | 458 |
| 641 | 3300049592 | Ga0501076_0003698 | Ga0501076_0003698_8960_10360 | 458 |
| 642 | 3300049592 | Ga0501076_0020034 | Ga0501076_0020034_1411_2799 | 458 |
| 643 | 3300049593 | Ga0501077_0000629 | Ga0501077_0000629_632_2020 | 458 |
| 644 | 3300049593 | Ga0501077_0018074 | Ga0501077_0018074_1029_2429 | 458 |
| 645 | 3300049593 | Ga0501077_0124035 | Ga0501077_0124035_190_1611 | 458 |
| 646 | 3300049741 | Ga0501079_0009483 | Ga0501079_0009483_2255_3643 | 458 |
| 647 | 3300049741 | Ga0501079_0148628 | Ga0501079_0148628_437_1816 | 458 |
| 648 | 3300049742 | Ga0501080_0036440 | Ga0501080_0036440_1986_3374 | 458 |
| 649 | 3300049742 | Ga0501080_0072515 | Ga0501080_0072515_685_2106 | 458 |
| 650 | 3300049743 | Ga0501081_0000034 | Ga0501081_0000034_4209_5588 | 458 |
| 651 | 3300049743 | Ga0501081_0001457 | Ga0501081_0001457_12677_14077 | 458 |
| 652 | 3300049743 | Ga0501081_0005411 | Ga0501081_0005411_4035_5423 | 458 |
| 653 | 3300049744 | Ga0501083_0097938 | Ga0501083_0097938_485_1873 | 458 |
| 654 | 3300049822 | Ga0501035_0038720 | Ga0501035_0038720_2341_3729 | 458 |
| 655 | 3300049824 | Ga0501045_0002359 | Ga0501045_0002359_2708_4096 | 458 |
| 656 | 3300050492 | nmdc:mga0yw44_42828_c1 | nmdc:mga0yw44_42828_c1_835_2247 | 458 |
| 657 | 3300050507 | nmdc:mga05p37_348_c1 | nmdc:mga05p37_348_c1_46417_47808 | 458 |
| 658 | 3300050509 | nmdc:mga0qj67_150851_c1 | nmdc:mga0qj67_150851_c1_162_1577 | 458 |
| 659 | 3300050509 | nmdc:mga0qj67_98774_c1 | nmdc:mga0qj67_98774_c1_714_2099 | 458 |
| 660 | 3300050510 | nmdc:mga06r32_148250_c1 | nmdc:mga06r32_148250_c1_666_2081 | 458 |
| 661 | 3300050510 | nmdc:mga06r32_51_c2 | nmdc:mga06r32_51_c2_1049_2434 | 458 |
| 662 | 3300050511 | nmdc:mga08y16_15684_c1 | nmdc:mga08y16_15684_c1_141_1532 | 458 |
| 663 | 3300050511 | nmdc:mga08y16_23916_c1 | nmdc:mga08y16_23916_c1_3406_4794 | 458 |
| 664 | 3300050511 | nmdc:mga08y16_49798_c1 | nmdc:mga08y16_49798_c1_1308_2696 | 458 |
| 665 | 3300050512 | nmdc:mga0n895_19353_c1 | nmdc:mga0n895_19353_c1_1217_2605 | 458 |
| 666 | 3300050513 | nmdc:mga0rr50_200182_c1 | nmdc:mga0rr50_200182_c1_116_1495 | 458 |
| 667 | 3300050515 | nmdc:mga0a205_1929_c1 | nmdc:mga0a205_1929_c1_3310_4698 | 458 |
| 668 | 3300050515 | nmdc:mga0a205_4612_c1 | nmdc:mga0a205_4612_c1_1888_3276 | 458 |
| 669 | 3300050515 | nmdc:mga0a205_9216_c1 | nmdc:mga0a205_9216_c1_3087_4475 | 458 |
| 670 | 3300053096 | Ga0500641_0020317 | Ga0500641_0020317_1067_2488 | 458 |
| 671 | 3300053153 | Ga0500616_0026581 | Ga0500616_0026581_1695_3113 | 458 |
| 672 | 3300054114 | Ga0501084_0003030 | Ga0501084_0003030_9884_11263 | 458 |
| 673 | 3300054114 | Ga0501084_0042926 | Ga0501084_0042926_715_2115 | 458 |
| 674 | 3300054114 | Ga0501084_0054286 | Ga0501084_0054286_1034_2413 | 458 |
| 675 | 3300054114 | Ga0501084_0063952 | Ga0501084_0063952_1381_2769 | 458 |
| 676 | 3300060353 | Ga0501082_0000148 | Ga0501082_0000148_6459_7838 | 458 |
| 677 | 3300060353 | Ga0501082_0012910 | Ga0501082_0012910_4865_6265 | 458 |
| 678 | 3300060353 | Ga0501082_0013681 | Ga0501082_0013681_5030_6409 | 458 |
| 679 | 3300060353 | Ga0501082_0042384 | Ga0501082_0042384_591_2012 | 458 |
| 680 | 3300061734 | Ga0530510_0000021 | Ga0530510_0000021_15184_16563 | 458 |
| 681 | 3300061734 | Ga0530510_0051544 | Ga0530510_0051544_293_1681 | 458 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hr5-assembly1.cif.gz_A | structure of the s1_25 family sulfatase module of the rhamnosidase fa22250 from formosa agariphila | 0.8445 | 4 | 455 |
| 6hr5-assembly1.cif.gz_A | structure of the s1_25 family sulfatase module of the rhamnosidase fa22250 from formosa agariphila | 0.8359 | 4 | 455 |
| 7p24-assembly1.cif.gz_AAA | sulfated host glycan recognition by carbohydrate sulfatases of the human gut microbiota (bt3177_s1_11) | 0.8239 | 4 | 455 |
| 5g2v-assembly1.cif.gz_A | structure of bt4656 in complex with its substrate d-glucosamine-2-n, 6-o-disulfate. | 0.815 | 4 | 455 |
| 7p24-assembly1.cif.gz_AAA | sulfated host glycan recognition by carbohydrate sulfatases of the human gut microbiota (bt3177_s1_11) | 0.8118 | 4 | 455 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5g2tD00 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7904 | 4 | 455 | 3.40.720.10 |
| af_P0AD27_254_505_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7886 | 3 | 345 | 3.40.720.10 |
| af_Q5BIL9_22_463_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7818 | 5 | 430 | 3.40.720.10 |
| af_F1R152_43_489_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7777 | 5 | 430 | 3.40.720.10 |
| af_F1QEE9_45_460_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7642 | 4 | 386 | 3.40.720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661GIY2-F1-model_v4 | Acetylglucosamine-6-sulfatase | 0.9511 | 1 | 457 |
GO:0016787
|
| AF-A0A7C7V5S1-F1-model_v4 | Sulfatase N-terminal domain-containing protein | 0.9478 | 2 | 187 |
GO:0004065
|
| AF-A0A661GIY2-F1-model_v4 | Acetylglucosamine-6-sulfatase | 0.947 | 1 | 457 |
GO:0016787
|
| AF-A0A7Y3MYL4-F1-model_v4 | Sulfatase-like hydrolase/transferase | 0.9385 | 47 | 458 |
GO:0016740
GO:0016787 |
| AF-A0A255Y9M5-F1-model_v4 | Sulfatase N-terminal domain-containing protein | 0.9328 | 4 | 458 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar