F474872
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 681 | 350 | 654 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300053140|Ga0500573_0000004|Ga0500573_0000004_270792_271697 |
| Length | 301 |
| Sequence | LIWFFQHEFEGRLSDHIEASRHSSSGVDTDTRNAGAQPVRRAQTPASQNQDGVGFFAGRFSGRAAVVTGGASGLGFLTAERIVKEGGTVSLWDINEASLNVAAQKLGGVHTHKVHVGRHPDVADAARKSLEALGKIDVLVNCAGITGATVPVQDFPVDNWLQVMDVNLNGIFYCCREVVPAMLAQGYGRIVNIASVAGKEGNPKASAYSASKAGVIGFTKSLGKELATSGILVNCITPATFESPILDQLPQSQIDYMRSRIPMGRLGHAEECAALVCWLASQECSFSTAATFDISGGRTTY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 4 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 5 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 6 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 7 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 8 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 9 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 10 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 11 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 12 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 13 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 14 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 15 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 16 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 17 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 18 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 19 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 20 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 21 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 22 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 23 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 28 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 29 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 30 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 31 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 32 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 33 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 34 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 35 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 36 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 39 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 225 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 226 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 228 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 229 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 230 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 231 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 232 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 233 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 234 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 235 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 236 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 293 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 296 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 331 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 332 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 337 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 338 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 339 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 343 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 345 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 346 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 347 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 348 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.04 |
| Metatranscriptomes | 0 |
| Isolates | 3.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.44 |
| Bulb | 0 |
| Endosphere | 10.28 |
| Nodule | 0.15 |
| Rhizoplane | 2.06 |
| Rhizosphere | 78.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_290893 | 2162886007 | Bacteria | 3591 |
| 2 | JGI24736J21556_1000900 | 3300001904 | Bacteria | 5490 |
| 3 | JGI24741J21665_1000596 | 3300001915 | Bacteria | 10951 |
| 4 | JGI24740J21852_10000043 | 3300001979 | Bacteria | 41252 |
| 5 | JGI24740J21852_10000580 | 3300001979 | Bacteria | 15718 |
| 6 | JGI24739J22299_10028024 | 3300001989 | Bacteria | 1966 |
| 7 | JGI24737J22298_10000054 | 3300001990 | Bacteria | 33923 |
| 8 | JGI24737J22298_10000952 | 3300001990 | Bacteria | 10265 |
| 9 | JGI24737J22298_10031451 | 3300001990 | Bacteria | 1657 |
| 10 | JGI24735J21928_10002076 | 3300002067 | Bacteria | 7062 |
| 11 | JGI24735J21928_10008827 | 3300002067 | Bacteria | 3251 |
| 12 | JGI24735J21928_10012443 | 3300002067 | Bacteria | 2689 |
| 13 | JGI24750J21931_1000088 | 3300002070 | Bacteria | 13881 |
| 14 | JGI24748J21848_1000065 | 3300002074 | Bacteria | 40176 |
| 15 | JGI24738J21930_10012066 | 3300002075 | Bacteria | 1890 |
| 16 | JGI24749J21850_1003606 | 3300002076 | Bacteria | 2163 |
| 17 | JGI24034J26672_10000008 | 3300002239 | Bacteria | 200986 |
| 18 | JGI24742J22300_10010079 | 3300002244 | Bacteria | 1561 |
| 19 | JGI24751J29686_10001254 | 3300002459 | Bacteria | 5362 |
| 20 | JGI25150J39212_1000472 | 3300002774 | Bacteria | 17386 |
| 21 | JGI25151J46595_10028399 | 3300003187 | Bacteria | 2229 |
| 22 | JGI25153J46596_10000038 | 3300003215 | Bacteria | 178190 |
| 23 | JGI25153J46596_10020495 | 3300003215 | Bacteria | 2498 |
| 24 | rootH1_10001301 | 3300003323 | Bacteria | 5199 |
| 25 | rootH1_10064589 | 3300003323 | Bacteria | 2704 |
| 26 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 27 | Ga0055524_1000598 | 3300003775 | Bacteria | 26071 |
| 28 | Ga0055536_1003677 | 3300003781 | Bacteria | 8154 |
| 29 | Ga0055530_10000131 | 3300003791 | Bacteria | 65535 |
| 30 | Ga0055530_10002644 | 3300003791 | Bacteria | 11209 |
| 31 | Ga0055530_10011719 | 3300003791 | Bacteria | 3124 |
| 32 | Ga0055531_10000617 | 3300003794 | Bacteria | 30689 |
| 33 | Ga0055531_10016551 | 3300003794 | Bacteria | 3173 |
| 34 | Ga0065165_1000906 | 3300005262 | Bacteria | 38225 |
| 35 | Ga0065165_1006868 | 3300005262 | Bacteria | 5788 |
| 36 | Ga0065704_10001326 | 3300005289 | Bacteria | 14211 |
| 37 | Ga0070658_10001045 | 3300005327 | Bacteria | 23669 |
| 38 | Ga0070658_10066526 | 3300005327 | Bacteria | 2944 |
| 39 | Ga0070658_10220152 | 3300005327 | Bacteria | 1605 |
| 40 | Ga0070676_10000469 | 3300005328 | Bacteria | 19353 |
| 41 | Ga0070676_10091733 | 3300005328 | Bacteria | 1862 |
| 42 | Ga0070676_10616292 | 3300005328 | Bacteria | 784 |
| 43 | Ga0070683_100021868 | 3300005329 | Bacteria | 5710 |
| 44 | Ga0070683_100123397 | 3300005329 | Bacteria | 2448 |
| 45 | Ga0070683_100321491 | 3300005329 | Bacteria | 1473 |
| 46 | Ga0070690_100000006 | 3300005330 | Bacteria | 132992 |
| 47 | Ga0070690_100090469 | 3300005330 | Bacteria | 2015 |
| 48 | Ga0070670_100022090 | 3300005331 | Bacteria | 5477 |
| 49 | Ga0070670_100085356 | 3300005331 | Bacteria | 2712 |
| 50 | Ga0070677_10024855 | 3300005333 | Bacteria | 2231 |
| 51 | Ga0068869_100003327 | 3300005334 | Bacteria | 9820 |
| 52 | Ga0070666_10000004 | 3300005335 | Bacteria | 372098 |
| 53 | Ga0070680_100000337 | 3300005336 | Bacteria | 31413 |
| 54 | Ga0070680_100213456 | 3300005336 | Bacteria | 1628 |
| 55 | Ga0070680_100279561 | 3300005336 | Bacteria | 1414 |
| 56 | Ga0068868_100000228 | 3300005338 | Bacteria | 38192 |
| 57 | Ga0068868_100018762 | 3300005338 | Bacteria | 5174 |
| 58 | Ga0068868_100021029 | 3300005338 | Bacteria | 4912 |
| 59 | Ga0068868_100491033 | 3300005338 | Bacteria | 1074 |
| 60 | Ga0070660_100015201 | 3300005339 | Bacteria | 5552 |
| 61 | Ga0070660_100128642 | 3300005339 | Bacteria | 2025 |
| 62 | Ga0070689_100003505 | 3300005340 | Bacteria | 10439 |
| 63 | Ga0070689_100146496 | 3300005340 | Bacteria | 1902 |
| 64 | Ga0070661_100000754 | 3300005344 | Bacteria | 23327 |
| 65 | Ga0070661_100034420 | 3300005344 | Bacteria | 3673 |
| 66 | Ga0070661_100090366 | 3300005344 | Bacteria | 2268 |
| 67 | Ga0070668_100062113 | 3300005347 | Bacteria | 2894 |
| 68 | Ga0070668_100721845 | 3300005347 | Bacteria | 880 |
| 69 | Ga0070668_100887166 | 3300005347 | Bacteria | 796 |
| 70 | Ga0070669_100000183 | 3300005353 | Bacteria | 54573 |
| 71 | Ga0070669_100171483 | 3300005353 | Bacteria | 1692 |
| 72 | Ga0070675_100087864 | 3300005354 | Bacteria | 2600 |
| 73 | Ga0070675_100215307 | 3300005354 | Bacteria | 1671 |
| 74 | Ga0070674_100000446 | 3300005356 | Bacteria | 20838 |
| 75 | Ga0070674_100000533 | 3300005356 | Bacteria | 19178 |
| 76 | Ga0070673_100000011 | 3300005364 | Bacteria | 145332 |
| 77 | Ga0070673_100155276 | 3300005364 | Bacteria | 1942 |
| 78 | Ga0070688_100000425 | 3300005365 | Bacteria | 21388 |
| 79 | Ga0070688_100182617 | 3300005365 | Bacteria | 1456 |
| 80 | Ga0070659_100038286 | 3300005366 | Bacteria | 3739 |
| 81 | Ga0070659_100691089 | 3300005366 | Bacteria | 882 |
| 82 | Ga0070667_100051825 | 3300005367 | Bacteria | 3461 |
| 83 | Ga0070667_100384848 | 3300005367 | Bacteria | 1274 |
| 84 | Ga0070663_100000513 | 3300005455 | Bacteria | 20457 |
| 85 | Ga0070663_100002383 | 3300005455 | Bacteria | 10566 |
| 86 | Ga0070678_100002168 | 3300005456 | Bacteria | 10661 |
| 87 | Ga0070678_100034974 | 3300005456 | Bacteria | 3503 |
| 88 | Ga0070678_100154879 | 3300005456 | Bacteria | 1850 |
| 89 | Ga0070662_100001493 | 3300005457 | Bacteria | 14389 |
| 90 | Ga0070662_100411331 | 3300005457 | Bacteria | 1118 |
| 91 | Ga0070681_10180235 | 3300005458 | Bacteria | 2034 |
| 92 | Ga0070681_10453471 | 3300005458 | Bacteria | 1195 |
| 93 | Ga0068867_100002153 | 3300005459 | Bacteria | 13818 |
| 94 | Ga0070685_10000268 | 3300005466 | Bacteria | 33580 |
| 95 | Ga0070685_10055233 | 3300005466 | Bacteria | 2307 |
| 96 | Ga0070679_100065430 | 3300005530 | Bacteria | 3624 |
| 97 | Ga0070679_100113545 | 3300005530 | Bacteria | 2694 |
| 98 | Ga0070684_100061718 | 3300005535 | Bacteria | 3281 |
| 99 | Ga0068853_100046728 | 3300005539 | Bacteria | 3713 |
| 100 | Ga0068853_100056738 | 3300005539 | Unclassified | 3378 |
| 101 | Ga0070672_100038223 | 3300005543 | Bacteria | 3666 |
| 102 | Ga0070686_100000036 | 3300005544 | Bacteria | 108117 |
| 103 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 104 | Ga0070665_100000226 | 3300005548 | Bacteria | 94176 |
| 105 | Ga0070665_100000912 | 3300005548 | Bacteria | 37939 |
| 106 | Ga0070665_100023704 | 3300005548 | Bacteria | 6181 |
| 107 | Ga0070665_100024558 | 3300005548 | Bacteria | 6072 |
| 108 | Ga0070665_100074160 | 3300005548 | Bacteria | 3408 |
| 109 | Ga0070665_100074684 | 3300005548 | Bacteria | 3396 |
| 110 | Ga0070665_100202758 | 3300005548 | Bacteria | 1984 |
| 111 | Ga0070665_100363231 | 3300005548 | Bacteria | 1454 |
| 112 | Ga0070665_100520817 | 3300005548 | Bacteria | 1201 |
| 113 | Ga0068855_100019306 | 3300005563 | Bacteria | 8190 |
| 114 | Ga0068855_100065616 | 3300005563 | Bacteria | 4232 |
| 115 | Ga0068855_100083990 | 3300005563 | Bacteria | 3688 |
| 116 | Ga0068855_100133324 | 3300005563 | Bacteria | 2835 |
| 117 | Ga0068855_100329526 | 3300005563 | Unclassified | 1686 |
| 118 | Ga0070664_100007015 | 3300005564 | Bacteria | 9091 |
| 119 | Ga0068857_100067958 | 3300005577 | Bacteria | 3172 |
| 120 | Ga0068854_100007205 | 3300005578 | Bacteria | 7100 |
| 121 | Ga0068854_100024487 | 3300005578 | Bacteria | 4133 |
| 122 | Ga0068854_100173152 | 3300005578 | Bacteria | 1681 |
| 123 | Ga0068856_100089983 | 3300005614 | Bacteria | 3053 |
| 124 | Ga0068852_100117209 | 3300005616 | Bacteria | 2431 |
| 125 | Ga0068852_100279853 | 3300005616 | Bacteria | 1608 |
| 126 | Ga0068859_100006326 | 3300005617 | Bacteria | 12011 |
| 127 | Ga0068864_100000243 | 3300005618 | Bacteria | 48752 |
| 128 | Ga0068864_100370777 | 3300005618 | Bacteria | 1355 |
| 129 | Ga0068861_100001448 | 3300005719 | Bacteria | 15011 |
| 130 | Ga0068851_10014560 | 3300005834 | Bacteria | 3736 |
| 131 | Ga0068870_10223815 | 3300005840 | Bacteria | 1153 |
| 132 | Ga0068870_10324476 | 3300005840 | Bacteria | 979 |
| 133 | Ga0068863_100000013 | 3300005841 | Bacteria | 220357 |
| 134 | Ga0068858_100002184 | 3300005842 | Bacteria | 19828 |
| 135 | Ga0068858_100007209 | 3300005842 | Bacteria | 10778 |
| 136 | Ga0068860_100000009 | 3300005843 | Bacteria | 372089 |
| 137 | Ga0068860_100025256 | 3300005843 | Bacteria | 5734 |
| 138 | Ga0068862_100000029 | 3300005844 | Bacteria | 182708 |
| 139 | Ga0070712_100546858 | 3300006175 | Bacteria | 975 |
| 140 | Ga0075367_10000744 | 3300006178 | Bacteria | 12671 |
| 141 | Ga0097621_100460226 | 3300006237 | Bacteria | 1147 |
| 142 | Ga0075370_10006824 | 3300006353 | Bacteria | 5772 |
| 143 | Ga0075370_10020630 | 3300006353 | Bacteria | 3605 |
| 144 | Ga0075370_10136210 | 3300006353 | Bacteria | 1435 |
| 145 | Ga0068871_100046319 | 3300006358 | Bacteria | 3503 |
| 146 | Ga0068871_100191209 | 3300006358 | Bacteria | 1763 |
| 147 | Ga0068865_100000012 | 3300006881 | Bacteria | 145314 |
| 148 | Ga0068865_100096656 | 3300006881 | Bacteria | 2154 |
| 149 | Ga0068865_100310106 | 3300006881 | Bacteria | 1266 |
| 150 | Ga0097620_100006326 | 3300006931 | Bacteria | 12011 |
| 151 | Ga0079104_1036655 | 3300006946 | Bacteria | 1175 |
| 152 | Ga0105251_10000041 | 3300009011 | Bacteria | 115207 |
| 153 | Ga0105251_10026323 | 3300009011 | Bacteria | 2962 |
| 154 | Ga0105240_10003013 | 3300009093 | Bacteria | 26500 |
| 155 | Ga0105240_10003693 | 3300009093 | Bacteria | 23672 |
| 156 | Ga0105240_10005249 | 3300009093 | Bacteria | 19347 |
| 157 | Ga0105240_10102371 | 3300009093 | Bacteria | 3480 |
| 158 | Ga0105240_10416779 | 3300009093 | Bacteria | 1510 |
| 159 | Ga0105240_10418413 | 3300009093 | Bacteria | 1506 |
| 160 | Ga0105245_10000097 | 3300009098 | Bacteria | 84528 |
| 161 | Ga0105245_10001089 | 3300009098 | Bacteria | 24632 |
| 162 | Ga0105245_10041161 | 3300009098 | Bacteria | 4119 |
| 163 | Ga0105243_10000850 | 3300009148 | Bacteria | 28978 |
| 164 | Ga0105243_10000958 | 3300009148 | Bacteria | 26973 |
| 165 | Ga0105243_10048017 | 3300009148 | Bacteria | 3364 |
| 166 | Ga0105243_10198778 | 3300009148 | Bacteria | 1757 |
| 167 | Ga0105241_10003989 | 3300009174 | Bacteria | 10909 |
| 168 | Ga0105241_10007570 | 3300009174 | Bacteria | 7985 |
| 169 | Ga0105241_10108146 | 3300009174 | Bacteria | 2222 |
| 170 | Ga0105242_10000486 | 3300009176 | Bacteria | 31546 |
| 171 | Ga0105248_10013870 | 3300009177 | Bacteria | 8867 |
| 172 | Ga0105248_10076503 | 3300009177 | Bacteria | 3762 |
| 173 | Ga0105237_10076519 | 3300009545 | Bacteria | 3337 |
| 174 | Ga0105237_10088523 | 3300009545 | Bacteria | 3086 |
| 175 | Ga0105237_10105976 | 3300009545 | Bacteria | 2803 |
| 176 | Ga0105237_10611870 | 3300009545 | Bacteria | 1096 |
| 177 | Ga0105238_10046240 | 3300009551 | Bacteria | 4393 |
| 178 | Ga0105238_10064733 | 3300009551 | Bacteria | 3656 |
| 179 | Ga0105238_10090258 | 3300009551 | Bacteria | 3052 |
| 180 | Ga0105238_10124587 | 3300009551 | Unclassified | 2556 |
| 181 | Ga0105238_10213095 | 3300009551 | Bacteria | 1908 |
| 182 | Ga0105238_10583715 | 3300009551 | Bacteria | 1124 |
| 183 | Ga0105249_10000006 | 3300009553 | Bacteria | 354449 |
| 184 | Ga0105249_10005913 | 3300009553 | Bacteria | 10596 |
| 185 | Ga0105239_10015105 | 3300010375 | Bacteria | 8561 |
| 186 | Ga0105239_10040388 | 3300010375 | Bacteria | 5112 |
| 187 | Ga0105239_10112652 | 3300010375 | Bacteria | 3016 |
| 188 | Ga0105239_10142058 | 3300010375 | Bacteria | 2676 |
| 189 | Ga0105239_10250566 | 3300010375 | Bacteria | 1989 |
| 190 | Ga0105239_10353957 | 3300010375 | Bacteria | 1658 |
| 191 | Ga0105239_10407565 | 3300010375 | Bacteria | 1539 |
| 192 | Ga0105246_10000113 | 3300011119 | Bacteria | 36243 |
| 193 | Ga0105246_10096750 | 3300011119 | Bacteria | 2140 |
| 194 | Ga0157373_10033509 | 3300013100 | Bacteria | 3695 |
| 195 | Ga0157373_10304930 | 3300013100 | Bacteria | 1131 |
| 196 | Ga0157371_10000757 | 3300013102 | Bacteria | 37321 |
| 197 | Ga0157371_10014187 | 3300013102 | Bacteria | 6024 |
| 198 | Ga0157370_10002465 | 3300013104 | Bacteria | 22320 |
| 199 | Ga0157370_10194756 | 3300013104 | Bacteria | 1881 |
| 200 | Ga0157370_10382631 | 3300013104 | Bacteria | 1296 |
| 201 | Ga0157369_10062533 | 3300013105 | Bacteria | 4011 |
| 202 | Ga0157369_10329648 | 3300013105 | Bacteria | 1586 |
| 203 | Ga0157374_10000132 | 3300013296 | Bacteria | 68144 |
| 204 | Ga0157374_10147671 | 3300013296 | Bacteria | 2285 |
| 205 | Ga0157374_10261406 | 3300013296 | Bacteria | 1705 |
| 206 | Ga0157374_10487193 | 3300013296 | Bacteria | 1237 |
| 207 | Ga0157378_10000341 | 3300013297 | Bacteria | 45974 |
| 208 | Ga0157378_10139889 | 3300013297 | Bacteria | 2247 |
| 209 | Ga0157378_10679719 | 3300013297 | Bacteria | 1047 |
| 210 | Ga0163162_10005444 | 3300013306 | Bacteria | 12300 |
| 211 | Ga0163162_10229260 | 3300013306 | Bacteria | 1988 |
| 212 | Ga0163162_10946254 | 3300013306 | Bacteria | 973 |
| 213 | Ga0157372_10001644 | 3300013307 | Bacteria | 24283 |
| 214 | Ga0157372_10019482 | 3300013307 | Bacteria | 7315 |
| 215 | Ga0157375_10000872 | 3300013308 | Bacteria | 26252 |
| 216 | Ga0163163_10000033 | 3300014325 | Bacteria | 166801 |
| 217 | Ga0163163_10003094 | 3300014325 | Bacteria | 14108 |
| 218 | Ga0163163_10015128 | 3300014325 | Bacteria | 7121 |
| 219 | Ga0163163_10119893 | 3300014325 | Bacteria | 2664 |
| 220 | Ga0163163_10692710 | 3300014325 | Bacteria | 1082 |
| 221 | Ga0157380_10000786 | 3300014326 | Bacteria | 19924 |
| 222 | Ga0157380_10021232 | 3300014326 | Bacteria | 4867 |
| 223 | Ga0157380_10278955 | 3300014326 | Bacteria | 1528 |
| 224 | Ga0163161_10000029 | 3300017792 | Bacteria | 193416 |
| 225 | Ga0163161_10009039 | 3300017792 | Bacteria | 6891 |
| 226 | Ga0163161_10020467 | 3300017792 | Bacteria | 4642 |
| 227 | Ga0163161_10056323 | 3300017792 | Bacteria | 2855 |
| 228 | Ga0207672_1001409 | 3300025223 | Bacteria | 1884 |
| 229 | Ga0209147_100748 | 3300025229 | Bacteria | 16056 |
| 230 | Ga0207425_1000016 | 3300025245 | Bacteria | 428169 |
| 231 | Ga0207425_1004891 | 3300025245 | Bacteria | 3921 |
| 232 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 233 | Ga0209129_1002879 | 3300025258 | Bacteria | 7931 |
| 234 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 235 | Ga0209673_1001790 | 3300025273 | Bacteria | 17757 |
| 236 | Ga0209676_1000046 | 3300025292 | Bacteria | 409173 |
| 237 | Ga0209676_1000413 | 3300025292 | Bacteria | 76892 |
| 238 | Ga0209025_1000396 | 3300025294 | Bacteria | 89775 |
| 239 | Ga0209564_1002536 | 3300025295 | Bacteria | 14094 |
| 240 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 241 | Ga0209758_1000995 | 3300025297 | Bacteria | 37746 |
| 242 | Ga0209050_1000057 | 3300025298 | Bacteria | 326289 |
| 243 | Ga0209050_1000347 | 3300025298 | Bacteria | 90767 |
| 244 | Ga0209050_1003694 | 3300025298 | Bacteria | 11026 |
| 245 | Ga0209050_1005329 | 3300025298 | Bacteria | 8149 |
| 246 | Ga0209050_1063271 | 3300025298 | Bacteria | 863 |
| 247 | Ga0209256_1000851 | 3300025299 | Bacteria | 38114 |
| 248 | Ga0209051_1007363 | 3300025303 | Bacteria | 6031 |
| 249 | Ga0209051_1088170 | 3300025303 | Bacteria | 872 |
| 250 | Ga0209257_1000191 | 3300025304 | Bacteria | 152659 |
| 251 | Ga0209257_1000371 | 3300025304 | Bacteria | 90767 |
| 252 | Ga0209257_1000506 | 3300025304 | Bacteria | 68402 |
| 253 | Ga0209257_1001875 | 3300025304 | Bacteria | 22766 |
| 254 | Ga0209257_1005118 | 3300025304 | Bacteria | 9497 |
| 255 | Ga0209257_1012086 | 3300025304 | Bacteria | 4049 |
| 256 | Ga0207697_10023401 | 3300025315 | Bacteria | 2529 |
| 257 | Ga0207656_10070900 | 3300025321 | Bacteria | 1548 |
| 258 | Ga0207713_1000798 | 3300025735 | Bacteria | 29158 |
| 259 | Ga0207713_1025055 | 3300025735 | Bacteria | 2763 |
| 260 | Ga0207682_10013464 | 3300025893 | Bacteria | 3187 |
| 261 | Ga0207688_10310724 | 3300025901 | Bacteria | 965 |
| 262 | Ga0207680_10000010 | 3300025903 | Bacteria | 414170 |
| 263 | Ga0207680_10020755 | 3300025903 | Bacteria | 3544 |
| 264 | Ga0207680_10079100 | 3300025903 | Bacteria | 2061 |
| 265 | Ga0207647_10001047 | 3300025904 | Bacteria | 21386 |
| 266 | Ga0207647_10012153 | 3300025904 | Bacteria | 6007 |
| 267 | Ga0207647_10030584 | 3300025904 | Bacteria | 3471 |
| 268 | Ga0207647_10088389 | 3300025904 | Bacteria | 1851 |
| 269 | Ga0207645_10001643 | 3300025907 | Bacteria | 18212 |
| 270 | Ga0207645_10209951 | 3300025907 | Bacteria | 1282 |
| 271 | Ga0207643_10185251 | 3300025908 | Bacteria | 1261 |
| 272 | Ga0207705_10000718 | 3300025909 | Bacteria | 27269 |
| 273 | Ga0207705_10130675 | 3300025909 | Bacteria | 1869 |
| 274 | Ga0207705_10610569 | 3300025909 | Bacteria | 848 |
| 275 | Ga0207654_10000732 | 3300025911 | Bacteria | 18264 |
| 276 | Ga0207654_10010982 | 3300025911 | Bacteria | 4610 |
| 277 | Ga0207654_10053448 | 3300025911 | Bacteria | 2331 |
| 278 | Ga0207707_10099537 | 3300025912 | Bacteria | 2541 |
| 279 | Ga0207707_10110313 | 3300025912 | Unclassified | 2404 |
| 280 | Ga0207695_10002546 | 3300025913 | Bacteria | 26780 |
| 281 | Ga0207695_10005914 | 3300025913 | Bacteria | 16042 |
| 282 | Ga0207695_10006892 | 3300025913 | Bacteria | 14616 |
| 283 | Ga0207695_10057230 | 3300025913 | Bacteria | 4051 |
| 284 | Ga0207695_10082352 | 3300025913 | Bacteria | 3254 |
| 285 | Ga0207695_10135058 | 3300025913 | Unclassified | 2421 |
| 286 | Ga0207695_10140950 | 3300025913 | Bacteria | 2359 |
| 287 | Ga0207695_10305928 | 3300025913 | Bacteria | 1480 |
| 288 | Ga0207695_10498228 | 3300025913 | Bacteria | 1100 |
| 289 | Ga0207671_10059804 | 3300025914 | Bacteria | 2826 |
| 290 | Ga0207671_10246317 | 3300025914 | Bacteria | 1405 |
| 291 | Ga0207671_10319384 | 3300025914 | Bacteria | 1229 |
| 292 | Ga0207663_10533993 | 3300025916 | Bacteria | 915 |
| 293 | Ga0207660_10004779 | 3300025917 | Bacteria | 8810 |
| 294 | Ga0207660_10006982 | 3300025917 | Bacteria | 7313 |
| 295 | Ga0207660_10105032 | 3300025917 | Unclassified | 2116 |
| 296 | Ga0207657_10011730 | 3300025919 | Bacteria | 8682 |
| 297 | Ga0207657_10362268 | 3300025919 | Bacteria | 1143 |
| 298 | Ga0207649_10000371 | 3300025920 | Bacteria | 33543 |
| 299 | Ga0207649_10378924 | 3300025920 | Bacteria | 1054 |
| 300 | Ga0207652_10052761 | 3300025921 | Bacteria | 3491 |
| 301 | Ga0207652_10324655 | 3300025921 | Bacteria | 1390 |
| 302 | Ga0207681_10000047 | 3300025923 | Bacteria | 127446 |
| 303 | Ga0207681_10015211 | 3300025923 | Bacteria | 4798 |
| 304 | Ga0207681_10209152 | 3300025923 | Bacteria | 1503 |
| 305 | Ga0207694_10018283 | 3300025924 | Bacteria | 5297 |
| 306 | Ga0207694_10135382 | 3300025924 | Bacteria | 1978 |
| 307 | Ga0207650_10019160 | 3300025925 | Bacteria | 4808 |
| 308 | Ga0207650_10318522 | 3300025925 | Bacteria | 1273 |
| 309 | Ga0207659_10164160 | 3300025926 | Bacteria | 1746 |
| 310 | Ga0207659_10177509 | 3300025926 | Bacteria | 1685 |
| 311 | Ga0207687_10000547 | 3300025927 | Bacteria | 25260 |
| 312 | Ga0207687_10013082 | 3300025927 | Bacteria | 5423 |
| 313 | Ga0207687_10017874 | 3300025927 | Bacteria | 4678 |
| 314 | Ga0207687_10036971 | 3300025927 | Bacteria | 3329 |
| 315 | Ga0207644_10018443 | 3300025931 | Bacteria | 4720 |
| 316 | Ga0207690_10001913 | 3300025932 | Bacteria | 12788 |
| 317 | Ga0207690_10042395 | 3300025932 | Bacteria | 2988 |
| 318 | Ga0207706_10002790 | 3300025933 | Bacteria | 16968 |
| 319 | Ga0207686_10000148 | 3300025934 | Bacteria | 53751 |
| 320 | Ga0207686_10517784 | 3300025934 | Bacteria | 928 |
| 321 | Ga0207709_10000059 | 3300025935 | Bacteria | 211914 |
| 322 | Ga0207709_10131149 | 3300025935 | Bacteria | 1708 |
| 323 | Ga0207670_10179692 | 3300025936 | Bacteria | 1593 |
| 324 | Ga0207669_10000749 | 3300025937 | Bacteria | 14044 |
| 325 | Ga0207704_10000021 | 3300025938 | Bacteria | 148508 |
| 326 | Ga0207704_10195215 | 3300025938 | Bacteria | 1476 |
| 327 | Ga0207704_10271374 | 3300025938 | Bacteria | 1285 |
| 328 | Ga0207691_10123002 | 3300025940 | Bacteria | 2297 |
| 329 | Ga0207691_10148038 | 3300025940 | Bacteria | 2066 |
| 330 | Ga0207691_10268732 | 3300025940 | Bacteria | 1469 |
| 331 | Ga0207711_10008674 | 3300025941 | Bacteria | 8505 |
| 332 | Ga0207711_10026097 | 3300025941 | Bacteria | 4901 |
| 333 | Ga0207711_10042948 | 3300025941 | Bacteria | 3854 |
| 334 | Ga0207689_10000686 | 3300025942 | Bacteria | 32336 |
| 335 | Ga0207661_10032090 | 3300025944 | Bacteria | 4066 |
| 336 | Ga0207661_10139228 | 3300025944 | Bacteria | 2087 |
| 337 | Ga0207661_10386573 | 3300025944 | Unclassified | 1267 |
| 338 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 339 | Ga0207667_10070960 | 3300025949 | Bacteria | 3624 |
| 340 | Ga0207667_10286854 | 3300025949 | Bacteria | 1682 |
| 341 | Ga0207651_10000012 | 3300025960 | Bacteria | 189928 |
| 342 | Ga0207651_10102163 | 3300025960 | Bacteria | 2130 |
| 343 | Ga0207651_10303634 | 3300025960 | Bacteria | 1328 |
| 344 | Ga0207712_10000014 | 3300025961 | Bacteria | 375393 |
| 345 | Ga0207712_10010198 | 3300025961 | Bacteria | 5959 |
| 346 | Ga0207668_10040020 | 3300025972 | Bacteria | 3159 |
| 347 | Ga0207668_10435408 | 3300025972 | Bacteria | 1116 |
| 348 | Ga0207640_10001209 | 3300025981 | Bacteria | 14089 |
| 349 | Ga0207640_10002063 | 3300025981 | Bacteria | 10833 |
| 350 | Ga0207658_10001340 | 3300025986 | Bacteria | 19288 |
| 351 | Ga0207677_10000058 | 3300026023 | Bacteria | 95751 |
| 352 | Ga0207677_10063621 | 3300026023 | Bacteria | 2565 |
| 353 | Ga0207703_10000613 | 3300026035 | Bacteria | 36130 |
| 354 | Ga0207703_10177650 | 3300026035 | Bacteria | 1877 |
| 355 | Ga0207639_10014822 | 3300026041 | Bacteria | 5490 |
| 356 | Ga0207639_10026520 | 3300026041 | Bacteria | 4211 |
| 357 | Ga0207639_10030031 | 3300026041 | Bacteria | 3984 |
| 358 | Ga0207639_10031910 | 3300026041 | Bacteria | 3874 |
| 359 | Ga0207678_10000545 | 3300026067 | Bacteria | 34437 |
| 360 | Ga0207678_10001731 | 3300026067 | Bacteria | 19965 |
| 361 | Ga0207702_10002024 | 3300026078 | Bacteria | 19642 |
| 362 | Ga0207702_10014590 | 3300026078 | Bacteria | 6521 |
| 363 | Ga0207641_10000116 | 3300026088 | Bacteria | 117850 |
| 364 | Ga0207648_10000051 | 3300026089 | Bacteria | 108363 |
| 365 | Ga0207648_10337674 | 3300026089 | Bacteria | 1356 |
| 366 | Ga0207676_10000331 | 3300026095 | Bacteria | 40710 |
| 367 | Ga0207676_10003373 | 3300026095 | Bacteria | 11292 |
| 368 | Ga0207674_10001654 | 3300026116 | Bacteria | 28679 |
| 369 | Ga0207674_10027324 | 3300026116 | Bacteria | 6039 |
| 370 | Ga0207675_100000262 | 3300026118 | Bacteria | 50134 |
| 371 | Ga0207683_10006818 | 3300026121 | Bacteria | 9779 |
| 372 | Ga0207683_10081300 | 3300026121 | Bacteria | 2876 |
| 373 | Ga0207683_10087307 | 3300026121 | Bacteria | 2774 |
| 374 | Ga0207683_10166382 | 3300026121 | Bacteria | 1995 |
| 375 | Ga0207698_10017674 | 3300026142 | Bacteria | 4845 |
| 376 | Ga0207698_10234617 | 3300026142 | Bacteria | 1668 |
| 377 | Ga0209813_10000077 | 3300027866 | Bacteria | 36660 |
| 378 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 379 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 380 | Ga0268266_10000768 | 3300028379 | Bacteria | 42899 |
| 381 | Ga0268266_10027727 | 3300028379 | Bacteria | 4815 |
| 382 | Ga0268266_10028256 | 3300028379 | Bacteria | 4768 |
| 383 | Ga0268266_10052347 | 3300028379 | Bacteria | 3506 |
| 384 | Ga0268266_10179985 | 3300028379 | Bacteria | 1924 |
| 385 | Ga0268266_10187424 | 3300028379 | Bacteria | 1887 |
| 386 | Ga0268266_10303796 | 3300028379 | Bacteria | 1489 |
| 387 | Ga0268265_10000283 | 3300028380 | Bacteria | 57566 |
| 388 | Ga0268265_10603668 | 3300028380 | Bacteria | 1049 |
| 389 | Ga0268264_10000023 | 3300028381 | Bacteria | 471408 |
| 390 | Ga0268264_10097231 | 3300028381 | Bacteria | 2552 |
| 391 | Ga0265318_10009288 | 3300028577 | Bacteria | 4331 |
| 392 | Ga0265325_10002784 | 3300031241 | Bacteria | 11672 |
| 393 | Ga0265339_10055217 | 3300031249 | Bacteria | 2155 |
| 394 | Ga0265331_10005913 | 3300031250 | Bacteria | 7315 |
| 395 | Ga0265331_10032729 | 3300031250 | Bacteria | 2575 |
| 396 | Ga0265316_10122323 | 3300031344 | Bacteria | 1965 |
| 397 | Ga0307513_10059066 | 3300031456 | Bacteria | 4072 |
| 398 | Ga0307408_100008127 | 3300031548 | Bacteria | 6933 |
| 399 | Ga0265313_10003810 | 3300031595 | Bacteria | 11920 |
| 400 | Ga0265313_10008369 | 3300031595 | Bacteria | 6882 |
| 401 | Ga0265314_10087716 | 3300031711 | Bacteria | 2034 |
| 402 | Ga0265314_10249442 | 3300031711 | Bacteria | 1020 |
| 403 | Ga0307405_10039971 | 3300031731 | Bacteria | 2838 |
| 404 | Ga0307410_10002590 | 3300031852 | Bacteria | 8781 |
| 405 | Ga0307406_10002019 | 3300031901 | Bacteria | 11074 |
| 406 | Ga0307412_10035072 | 3300031911 | Bacteria | 3202 |
| 407 | Ga0307412_10149881 | 3300031911 | Bacteria | 1719 |
| 408 | Ga0307409_100038474 | 3300031995 | Bacteria | 3539 |
| 409 | Ga0307414_10040948 | 3300032004 | Bacteria | 3133 |
| 410 | Ga0307414_10112600 | 3300032004 | Bacteria | 2075 |
| 411 | Ga0307414_10114496 | 3300032004 | Bacteria | 2060 |
| 412 | Ga0307414_10363185 | 3300032004 | Bacteria | 1246 |
| 413 | Ga0307415_100265599 | 3300032126 | Bacteria | 1403 |
| 414 | Ga0373936_0247516 | 3300035113 | Bacteria | 795 |
| 415 | Ga0373943_0147357 | 3300035170 | Bacteria | 1273 |
| 416 | Ga0373955_0058693 | 3300035172 | Bacteria | 2118 |
| 417 | Ga0373935_0273237 | 3300035692 | Bacteria | 1188 |
| 418 | Ga0395899_0000674 | 3300037312 | Bacteria | 34563 |
| 419 | Ga0395900_0000075 | 3300037418 | Bacteria | 183525 |
| 420 | Ga0395900_0121430 | 3300037418 | Bacteria | 2680 |
| 421 | Ga0395898_0000055 | 3300037466 | Bacteria | 278557 |
| 422 | Ga0395898_0235657 | 3300037466 | Bacteria | 1745 |
| 423 | Ga0395905_0000067 | 3300037471 | Bacteria | 181887 |
| 424 | Ga0395901_0000648 | 3300038443 | Bacteria | 40227 |
| 425 | Ga0395901_0064369 | 3300038443 | Bacteria | 3817 |
| 426 | Ga0439439_0044389 | 3300041406 | Bacteria | 1157 |
| 427 | Ga0439461_0008099 | 3300041410 | Bacteria | 1877 |
| 428 | Ga0451800_1383254 | 3300041459 | Bacteria | 1354 |
| 429 | Ga0451841_1047927 | 3300041498 | Bacteria | 1115 |
| 430 | Ga0439431_0007189 | 3300041997 | Bacteria | 2480 |
| 431 | Ga0439443_009276 | 3300042003 | Bacteria | 1408 |
| 432 | Ga0439445_0019503 | 3300042004 | Bacteria | 1691 |
| 433 | Ga0439448_0029180 | 3300042005 | Bacteria | 1745 |
| 434 | Ga0439452_020802 | 3300042010 | Bacteria | 1717 |
| 435 | Ga0439455_0000718 | 3300042012 | Bacteria | 4916 |
| 436 | Ga0439462_0067201 | 3300042015 | Bacteria | 972 |
| 437 | Ga0439458_0000567 | 3300042157 | Bacteria | 9515 |
| 438 | Ga0439435_0004964 | 3300042436 | Bacteria | 2897 |
| 439 | Ga0466966_0310567 | 3300044684 | Bacteria | 948 |
| 440 | Ga0466963_0300141 | 3300044694 | Bacteria | 1130 |
| 441 | Ga0466968_0021934 | 3300044735 | Bacteria | 2590 |
| 442 | Ga0466957_0086150 | 3300044842 | Bacteria | 1963 |
| 443 | Ga0466959_0245630 | 3300045049 | Bacteria | 1235 |
| 444 | Ga0451576_0877091 | 3300045051 | Bacteria | 942 |
| 445 | Ga0466967_0111054 | 3300045976 | Bacteria | 2519 |
| 446 | Ga0466967_0388609 | 3300045976 | Bacteria | 1356 |
| 447 | Ga0495627_000260 | 3300046453 | Bacteria | 54170 |
| 448 | Ga0495627_000295 | 3300046453 | Bacteria | 49392 |
| 449 | Ga0495638_0012858 | 3300046460 | Bacteria | 5719 |
| 450 | Ga0495653_0407100 | 3300046463 | Bacteria | 863 |
| 451 | Ga0495650_0001200 | 3300046471 | Bacteria | 27305 |
| 452 | Ga0495584_0048051 | 3300046491 | Bacteria | 2152 |
| 453 | Ga0495585_0193727 | 3300046492 | Bacteria | 1038 |
| 454 | Ga0495607_0038043 | 3300046501 | Bacteria | 2885 |
| 455 | Ga0495583_0000023 | 3300046506 | Bacteria | 280019 |
| 456 | Ga0495583_0000087 | 3300046506 | Bacteria | 164974 |
| 457 | Ga0495583_0014188 | 3300046506 | Bacteria | 4407 |
| 458 | Ga0495583_0025567 | 3300046506 | Bacteria | 2947 |
| 459 | Ga0495583_0096401 | 3300046506 | Bacteria | 1267 |
| 460 | Ga0495610_0000034 | 3300046512 | Bacteria | 201408 |
| 461 | Ga0495610_0000102 | 3300046512 | Bacteria | 98985 |
| 462 | Ga0495610_0101354 | 3300046512 | Bacteria | 1289 |
| 463 | Ga0495620_0052963 | 3300046515 | Bacteria | 1720 |
| 464 | Ga0495631_0130961 | 3300046518 | Bacteria | 1078 |
| 465 | Ga0495632_0000013 | 3300046519 | Bacteria | 247879 |
| 466 | Ga0495632_0000918 | 3300046519 | Bacteria | 25891 |
| 467 | Ga0495632_0083888 | 3300046519 | Bacteria | 1517 |
| 468 | Ga0495637_0000229 | 3300046520 | Bacteria | 43471 |
| 469 | Ga0495637_0010298 | 3300046520 | Bacteria | 4529 |
| 470 | Ga0495637_0150077 | 3300046520 | Bacteria | 880 |
| 471 | Ga0495643_0000010 | 3300046522 | Bacteria | 341431 |
| 472 | Ga0495643_0000434 | 3300046522 | Bacteria | 54356 |
| 473 | Ga0495648_0001360 | 3300046524 | Bacteria | 24162 |
| 474 | Ga0495648_0005640 | 3300046524 | Bacteria | 10360 |
| 475 | Ga0495648_0006463 | 3300046524 | Bacteria | 9563 |
| 476 | Ga0495648_0158220 | 3300046524 | Bacteria | 1174 |
| 477 | Ga0495663_0000004 | 3300046525 | Bacteria | 355166 |
| 478 | Ga0495663_0003013 | 3300046525 | Bacteria | 4946 |
| 479 | Ga0495654_0064020 | 3300046530 | Bacteria | 1759 |
| 480 | Ga0495587_0037590 | 3300046536 | Bacteria | 2906 |
| 481 | Ga0495587_0081093 | 3300046536 | Bacteria | 1880 |
| 482 | Ga0495609_0006670 | 3300046538 | Bacteria | 5859 |
| 483 | Ga0495622_0012205 | 3300046557 | Bacteria | 3973 |
| 484 | Ga0495633_0000092 | 3300046558 | Bacteria | 121446 |
| 485 | Ga0495633_0000427 | 3300046558 | Bacteria | 43836 |
| 486 | Ga0495633_0000765 | 3300046558 | Bacteria | 28937 |
| 487 | Ga0495633_0002661 | 3300046558 | Bacteria | 12438 |
| 488 | Ga0495633_0008652 | 3300046558 | Bacteria | 5715 |
| 489 | Ga0495633_0051812 | 3300046558 | Bacteria | 1933 |
| 490 | Ga0495633_0150453 | 3300046558 | Bacteria | 1075 |
| 491 | Ga0495633_0167776 | 3300046558 | Bacteria | 1012 |
| 492 | Ga0495667_0270410 | 3300046559 | Bacteria | 1080 |
| 493 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 494 | Ga0495611_0035397 | 3300046648 | Bacteria | 2212 |
| 495 | Ga0495611_0135451 | 3300046648 | Bacteria | 1150 |
| 496 | Ga0495611_0234590 | 3300046648 | Bacteria | 852 |
| 497 | Ga0495625_0000106 | 3300046660 | Bacteria | 125985 |
| 498 | Ga0495625_0048616 | 3300046660 | Bacteria | 3053 |
| 499 | Ga0495669_0000052 | 3300046684 | Bacteria | 79328 |
| 500 | Ga0495670_0004750 | 3300046691 | Bacteria | 6673 |
| 501 | Ga0495670_0030902 | 3300046691 | Bacteria | 2661 |
| 502 | Ga0495670_0066077 | 3300046691 | Bacteria | 1824 |
| 503 | Ga0495671_0000014 | 3300046692 | Bacteria | 341431 |
| 504 | Ga0495671_0000042 | 3300046692 | Bacteria | 165201 |
| 505 | Ga0495671_0024350 | 3300046692 | Bacteria | 3153 |
| 506 | Ga0495671_0258742 | 3300046692 | Bacteria | 840 |
| 507 | Ga0495649_0005210 | 3300046694 | Bacteria | 8320 |
| 508 | Ga0495660_0001451 | 3300046810 | Bacteria | 16207 |
| 509 | Ga0495636_0016743 | 3300047318 | Bacteria | 2931 |
| 510 | Ga0495672_0063688 | 3300047320 | Bacteria | 2115 |
| 511 | Ga0495683_0007315 | 3300047323 | Bacteria | 5984 |
| 512 | Ga0495683_0016176 | 3300047323 | Bacteria | 3874 |
| 513 | Ga0495687_000068 | 3300047443 | Bacteria | 161081 |
| 514 | Ga0495687_000335 | 3300047443 | Bacteria | 60311 |
| 515 | Ga0495675_0187475 | 3300047444 | Bacteria | 1264 |
| 516 | Ga0495677_0133457 | 3300047445 | Bacteria | 951 |
| 517 | Ga0495673_0000111 | 3300047469 | Bacteria | 164974 |
| 518 | Ga0495673_0080399 | 3300047469 | Bacteria | 1351 |
| 519 | Ga0495681_0000049 | 3300047470 | Bacteria | 109650 |
| 520 | Ga0495681_0000104 | 3300047470 | Bacteria | 74261 |
| 521 | Ga0495681_0001853 | 3300047470 | Bacteria | 15548 |
| 522 | Ga0495686_0001248 | 3300047472 | Bacteria | 28936 |
| 523 | Ga0495686_0024028 | 3300047472 | Bacteria | 4009 |
| 524 | Ga0495686_0062797 | 3300047472 | Bacteria | 2303 |
| 525 | Ga0495602_0051585 | 3300048088 | Bacteria | 3662 |
| 526 | Ga0496104_0008454 | 3300048907 | Bacteria | 9151 |
| 527 | Ga0496104_0046791 | 3300048907 | Bacteria | 4075 |
| 528 | Ga0496104_0051009 | 3300048907 | Bacteria | 3904 |
| 529 | Ga0496105_0003263 | 3300048908 | Bacteria | 11954 |
| 530 | Ga0496105_0010189 | 3300048908 | Bacteria | 7386 |
| 531 | Ga0496105_0078474 | 3300048908 | Bacteria | 2726 |
| 532 | Ga0496110_0084811 | 3300048913 | Bacteria | 2828 |
| 533 | Ga0496110_0108041 | 3300048913 | Bacteria | 2498 |
| 534 | Ga0496111_0015746 | 3300048914 | Bacteria | 5200 |
| 535 | Ga0496111_0073449 | 3300048914 | Bacteria | 2491 |
| 536 | Ga0496115_0001186 | 3300048918 | Bacteria | 18684 |
| 537 | Ga0496115_0082816 | 3300048918 | Bacteria | 2614 |
| 538 | Ga0496116_0011033 | 3300048919 | Bacteria | 7515 |
| 539 | Ga0496116_0029623 | 3300048919 | Bacteria | 3943 |
| 540 | Ga0496116_0071550 | 3300048919 | Bacteria | 2195 |
| 541 | Ga0496116_0200504 | 3300048919 | Bacteria | 1045 |
| 542 | Ga0496117_0001833 | 3300048920 | Bacteria | 28776 |
| 543 | Ga0496117_0008474 | 3300048920 | Bacteria | 9761 |
| 544 | Ga0496117_0009240 | 3300048920 | Bacteria | 9217 |
| 545 | Ga0496117_0070508 | 3300048920 | Bacteria | 2347 |
| 546 | Ga0496118_0004463 | 3300048921 | Bacteria | 16596 |
| 547 | Ga0496118_0006864 | 3300048921 | Bacteria | 12334 |
| 548 | Ga0496118_0009510 | 3300048921 | Bacteria | 9797 |
| 549 | Ga0496118_0011452 | 3300048921 | Bacteria | 8655 |
| 550 | Ga0496119_0000140 | 3300048922 | Bacteria | 101373 |
| 551 | Ga0496119_0045445 | 3300048922 | Bacteria | 2753 |
| 552 | Ga0496120_0000011 | 3300048923 | Bacteria | 365549 |
| 553 | Ga0496120_0110363 | 3300048923 | Bacteria | 1438 |
| 554 | Ga0496121_0000112 | 3300048924 | Bacteria | 183480 |
| 555 | Ga0496121_0000170 | 3300048924 | Bacteria | 144547 |
| 556 | Ga0496121_0000734 | 3300048924 | Bacteria | 60436 |
| 557 | Ga0496121_0000997 | 3300048924 | Bacteria | 50601 |
| 558 | Ga0496121_0044825 | 3300048924 | Bacteria | 3809 |
| 559 | Ga0496121_0210174 | 3300048924 | Bacteria | 1379 |
| 560 | Ga0496122_0000253 | 3300048925 | Bacteria | 120534 |
| 561 | Ga0496122_0001355 | 3300048925 | Bacteria | 39961 |
| 562 | Ga0496122_0074202 | 3300048925 | Bacteria | 2408 |
| 563 | Ga0496123_0000206 | 3300048926 | Bacteria | 120598 |
| 564 | Ga0496123_0002426 | 3300048926 | Bacteria | 23191 |
| 565 | Ga0496123_0167173 | 3300048926 | Bacteria | 1165 |
| 566 | Ga0496124_0000148 | 3300048927 | Bacteria | 144782 |
| 567 | Ga0496124_0009107 | 3300048927 | Bacteria | 10264 |
| 568 | Ga0496124_0057234 | 3300048927 | Bacteria | 3286 |
| 569 | Ga0496124_0151453 | 3300048927 | Bacteria | 1818 |
| 570 | Ga0496124_0174671 | 3300048927 | Bacteria | 1660 |
| 571 | Ga0496125_0000387 | 3300048928 | Bacteria | 82001 |
| 572 | Ga0496125_0025013 | 3300048928 | Bacteria | 5478 |
| 573 | Ga0496126_0003603 | 3300048929 | Bacteria | 19386 |
| 574 | Ga0496126_0047094 | 3300048929 | Bacteria | 3949 |
| 575 | Ga0496126_0051469 | 3300048929 | Bacteria | 3749 |
| 576 | Ga0496126_0097037 | 3300048929 | Bacteria | 2583 |
| 577 | Ga0496126_0150433 | 3300048929 | Unclassified | 1996 |
| 578 | Ga0496126_0164775 | 3300048929 | Bacteria | 1892 |
| 579 | Ga0495678_106501 | 3300049459 | Bacteria | 963 |
| 580 | Ga0495682_0008927 | 3300049460 | Bacteria | 3932 |
| 581 | Ga0501031_0027991 | 3300049568 | Bacteria | 3673 |
| 582 | Ga0501032_0005428 | 3300049569 | Bacteria | 9471 |
| 583 | Ga0501033_0004813 | 3300049570 | Bacteria | 10785 |
| 584 | Ga0501033_0008295 | 3300049570 | Bacteria | 8047 |
| 585 | Ga0501033_0020152 | 3300049570 | Bacteria | 5042 |
| 586 | Ga0501033_0062110 | 3300049570 | Bacteria | 2751 |
| 587 | Ga0501034_0003706 | 3300049571 | Bacteria | 17261 |
| 588 | Ga0501034_0004672 | 3300049571 | Bacteria | 15163 |
| 589 | Ga0501034_0236105 | 3300049571 | Bacteria | 1776 |
| 590 | Ga0501036_0000882 | 3300049572 | Bacteria | 22405 |
| 591 | Ga0501038_0186271 | 3300049574 | Bacteria | 1672 |
| 592 | Ga0501039_0002562 | 3300049575 | Bacteria | 13562 |
| 593 | Ga0501040_0002512 | 3300049576 | Bacteria | 11813 |
| 594 | Ga0501042_0013815 | 3300049578 | Bacteria | 5500 |
| 595 | Ga0501042_0059481 | 3300049578 | Bacteria | 2728 |
| 596 | Ga0501043_0059164 | 3300049579 | Bacteria | 3007 |
| 597 | Ga0501043_0101116 | 3300049579 | Bacteria | 2266 |
| 598 | Ga0501046_0004326 | 3300049580 | Bacteria | 12928 |
| 599 | Ga0501047_0001026 | 3300049581 | Bacteria | 28057 |
| 600 | Ga0501047_0006093 | 3300049581 | Bacteria | 11334 |
| 601 | Ga0501047_0010083 | 3300049581 | Bacteria | 8932 |
| 602 | Ga0501047_0040118 | 3300049581 | Bacteria | 4528 |
| 603 | Ga0501047_0185553 | 3300049581 | Bacteria | 1945 |
| 604 | Ga0501047_0254683 | 3300049581 | Bacteria | 1604 |
| 605 | Ga0501047_0324529 | 3300049581 | Bacteria | 1379 |
| 606 | Ga0501067_0021187 | 3300049583 | Bacteria | 3596 |
| 607 | Ga0501068_0037223 | 3300049584 | Bacteria | 2913 |
| 608 | Ga0501069_0138890 | 3300049585 | Bacteria | 1393 |
| 609 | Ga0501070_0027633 | 3300049586 | Bacteria | 4759 |
| 610 | Ga0501073_0002008 | 3300049589 | Bacteria | 15184 |
| 611 | Ga0501073_0187084 | 3300049589 | Bacteria | 1433 |
| 612 | Ga0501073_0293637 | 3300049589 | Bacteria | 1121 |
| 613 | Ga0501076_0626278 | 3300049592 | Bacteria | 888 |
| 614 | Ga0501238_000094 | 3300049671 | Bacteria | 14176 |
| 615 | Ga0501079_0009177 | 3300049741 | Bacteria | 7490 |
| 616 | Ga0501080_0067296 | 3300049742 | Bacteria | 3331 |
| 617 | Ga0501080_0304856 | 3300049742 | Bacteria | 1444 |
| 618 | Ga0501080_0506773 | 3300049742 | Bacteria | 1078 |
| 619 | Ga0501083_0013559 | 3300049744 | Bacteria | 5699 |
| 620 | Ga0501035_0277499 | 3300049822 | Bacteria | 1417 |
| 621 | Ga0501044_0000796 | 3300049823 | Bacteria | 38157 |
| 622 | Ga0501044_0000921 | 3300049823 | Bacteria | 35420 |
| 623 | Ga0501044_0025454 | 3300049823 | Bacteria | 6272 |
| 624 | Ga0501044_0081857 | 3300049823 | Bacteria | 3267 |
| 625 | Ga0501044_0088160 | 3300049823 | Bacteria | 3133 |
| 626 | Ga0501044_0124384 | 3300049823 | Bacteria | 2577 |
| 627 | Ga0501044_0136781 | 3300049823 | Bacteria | 2441 |
| 628 | nmdc:mga06z11_90_c1 | 3300050494 | Bacteria | 38500 |
| 629 | nmdc:mga04h51_299_c1 | 3300050495 | Bacteria | 12655 |
| 630 | nmdc:mga07m45_35718_c1 | 3300050496 | Bacteria | 2765 |
| 631 | Ga0500610_0000131 | 3300053079 | Bacteria | 22564 |
| 632 | Ga0500635_0021268 | 3300053080 | Bacteria | 1997 |
| 633 | Ga0500651_0009693 | 3300053093 | Bacteria | 5740 |
| 634 | Ga0500566_0000347 | 3300053094 | Bacteria | 25160 |
| 635 | Ga0500641_0013243 | 3300053096 | Bacteria | 3028 |
| 636 | Ga0500555_000042 | 3300053103 | Bacteria | 65300 |
| 637 | Ga0500556_0000128 | 3300053104 | Bacteria | 65099 |
| 638 | Ga0500594_0001896 | 3300053118 | Bacteria | 4524 |
| 639 | Ga0500626_027420 | 3300053128 | Bacteria | 2567 |
| 640 | Ga0500642_0000599 | 3300053130 | Bacteria | 10789 |
| 641 | Ga0500658_0000477 | 3300053134 | Bacteria | 17107 |
| 642 | Ga0500559_0002516 | 3300053136 | Bacteria | 9415 |
| 643 | Ga0500559_0008943 | 3300053136 | Bacteria | 4359 |
| 644 | Ga0500559_0039329 | 3300053136 | Bacteria | 2057 |
| 645 | Ga0500568_0000345 | 3300053139 | Bacteria | 36283 |
| 646 | Ga0500573_0000004 | 3300053140 | Bacteria | 341236 |
| 647 | Ga0500616_0000119 | 3300053153 | Bacteria | 143264 |
| 648 | Ga0500624_000107 | 3300053157 | Bacteria | 39921 |
| 649 | Ga0500637_0111301 | 3300053178 | Bacteria | 1588 |
| 650 | Ga0500611_003038 | 3300053727 | Bacteria | 2098 |
| 651 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 652 | Ga0501084_0006391 | 3300054114 | Bacteria | 9684 |
| 653 | Ga0501082_0251933 | 3300060353 | Bacteria | 1536 |
| 654 | Ga0466962_0104017 | 3300061719 | Bacteria | 1364 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005354 | Ga0070675_100215307 | Ga0070675_1002153072 | 233 |
| 2 | 3300005456 | Ga0070678_100154879 | Ga0070678_1001548791 | 233 |
| 3 | 3300006237 | Ga0097621_100460226 | Ga0097621_1004602261 | 233 |
| 4 | 3300006881 | Ga0068865_100096656 | Ga0068865_1000966562 | 233 |
| 5 | 3300009098 | Ga0105245_10041161 | Ga0105245_100411612 | 233 |
| 6 | 3300013296 | Ga0157374_10487193 | Ga0157374_104871932 | 233 |
| 7 | 3300025926 | Ga0207659_10177509 | Ga0207659_101775092 | 233 |
| 8 | 3300025927 | Ga0207687_10017874 | Ga0207687_100178742 | 233 |
| 9 | 3300025938 | Ga0207704_10195215 | Ga0207704_101952151 | 233 |
| 10 | 3300025940 | Ga0207691_10148038 | Ga0207691_101480382 | 233 |
| 11 | 3300025960 | Ga0207651_10102163 | Ga0207651_101021632 | 233 |
| 12 | 3300026121 | Ga0207683_10166382 | Ga0207683_101663822 | 233 |
| 13 | 3300042003 | Ga0439443_009276 | Ga0439443_009276_573_1328 | 236 |
| 14 | 3300048929 | Ga0496126_0164775 | Ga0496126_0164775_1082_1837 | 237 |
| 15 | 3300049576 | Ga0501040_0002512 | Ga0501040_0002512_6193_6963 | 237 |
| 16 | 3300049578 | Ga0501042_0059481 | Ga0501042_0059481_1708_2478 | 237 |
| 17 | 3300006353 | Ga0075370_10136210 | Ga0075370_101362101 | 240 |
| 18 | 3300025304 | Ga0209257_1000506 | Ga0209257_10005065 | 241 |
| 19 | 3300035170 | Ga0373943_0147357 | Ga0373943_0147357_58_792 | 241 |
| 20 | 3300046501 | Ga0495607_0038043 | Ga0495607_0038043_2085_2834 | 241 |
| 21 | 3300046506 | Ga0495583_0000087 | Ga0495583_0000087_8760_9509 | 241 |
| 22 | 3300046519 | Ga0495632_0000918 | Ga0495632_0000918_491_1240 | 241 |
| 23 | 3300046558 | Ga0495633_0008652 | Ga0495633_0008652_4481_5230 | 241 |
| 24 | 3300046692 | Ga0495671_0000042 | Ga0495671_0000042_8987_9736 | 241 |
| 25 | 3300047469 | Ga0495673_0000111 | Ga0495673_0000111_155466_156215 | 241 |
| 26 | 3300003215 | JGI25153J46596_10020495 | JGI25153J46596_100204952 | 242 |
| 27 | 3300005548 | Ga0070665_100000226 | Ga0070665_10000022692 | 242 |
| 28 | 3300005840 | Ga0068870_10223815 | Ga0068870_102238152 | 242 |
| 29 | 3300025245 | Ga0207425_1004891 | Ga0207425_10048914 | 242 |
| 30 | 3300025297 | Ga0209758_1000995 | Ga0209758_100099519 | 242 |
| 31 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022885 | 242 |
| 32 | 3300049671 | Ga0501238_000094 | Ga0501238_000094_6684_7436 | 242 |
| 33 | 3300053136 | Ga0500559_0002516 | Ga0500559_0002516_7568_8332 | 242 |
| 34 | iso_pu_bacteria | 2582581280 | 2585155377 | 242 |
| 35 | iso_pu_bacteria | 2582581280 | 2585155612 | 242 |
| 36 | iso_pu_bacteria | 2582581293 | 2585198941 | 242 |
| 37 | iso_pu_bacteria | 2582581293 | 2585199378 | 242 |
| 38 | 3300005539 | Ga0068853_100046728 | Ga0068853_1000467284 | 243 |
| 39 | 3300005548 | Ga0070665_100520817 | Ga0070665_1005208171 | 243 |
| 40 | 3300026041 | Ga0207639_10026520 | Ga0207639_100265202 | 243 |
| 41 | 3300001979 | JGI24740J21852_10000043 | JGI24740J21852_1000004335 | 244 |
| 42 | 3300005344 | Ga0070661_100090366 | Ga0070661_1000903662 | 244 |
| 43 | 3300005455 | Ga0070663_100000513 | Ga0070663_1000005134 | 244 |
| 44 | 3300025920 | Ga0207649_10378924 | Ga0207649_103789242 | 244 |
| 45 | 3300026067 | Ga0207678_10001731 | Ga0207678_1000173116 | 244 |
| 46 | 3300031250 | Ga0265331_10032729 | Ga0265331_100327293 | 244 |
| 47 | 3300042436 | Ga0439435_0004964 | Ga0439435_0004964_1055_1810 | 244 |
| 48 | iso_pu_bacteria | 2830075706 | 2830077990 | 244 |
| 49 | 3300005328 | Ga0070676_10000469 | Ga0070676_1000046912 | 245 |
| 50 | 3300005334 | Ga0068869_100003327 | Ga0068869_1000033274 | 245 |
| 51 | 3300005338 | Ga0068868_100000228 | Ga0068868_1000002285 | 245 |
| 52 | 3300005364 | Ga0070673_100000011 | Ga0070673_10000001173 | 245 |
| 53 | 3300005459 | Ga0068867_100002153 | Ga0068867_1000021535 | 245 |
| 54 | 3300006881 | Ga0068865_100000012 | Ga0068865_10000001251 | 245 |
| 55 | 3300009098 | Ga0105245_10000097 | Ga0105245_1000009751 | 245 |
| 56 | 3300009148 | Ga0105243_10000958 | Ga0105243_1000095814 | 245 |
| 57 | 3300009176 | Ga0105242_10000486 | Ga0105242_100004868 | 245 |
| 58 | 3300011119 | Ga0105246_10000113 | Ga0105246_1000011313 | 245 |
| 59 | 3300013296 | Ga0157374_10000132 | Ga0157374_1000013234 | 245 |
| 60 | 3300013297 | Ga0157378_10000341 | Ga0157378_1000034113 | 245 |
| 61 | 3300013308 | Ga0157375_10000872 | Ga0157375_1000087211 | 245 |
| 62 | 3300025907 | Ga0207645_10001643 | Ga0207645_100016433 | 245 |
| 63 | 3300025927 | Ga0207687_10013082 | Ga0207687_100130823 | 245 |
| 64 | 3300025934 | Ga0207686_10000148 | Ga0207686_1000014828 | 245 |
| 65 | 3300025938 | Ga0207704_10000021 | Ga0207704_1000002173 | 245 |
| 66 | 3300025942 | Ga0207689_10000686 | Ga0207689_1000068613 | 245 |
| 67 | 3300025960 | Ga0207651_10000012 | Ga0207651_1000001249 | 245 |
| 68 | 3300026023 | Ga0207677_10000058 | Ga0207677_1000005849 | 245 |
| 69 | 3300026089 | Ga0207648_10000051 | Ga0207648_1000005120 | 245 |
| 70 | iso_pu_bacteria | 2512564014 | 2512643255 | 245 |
| 71 | iso_pu_bacteria | 2524023250 | 2524613865 | 245 |
| 72 | iso_pu_bacteria | 2599185354 | 2600203255 | 245 |
| 73 | iso_pu_bacteria | 2751185897 | 2753766781 | 245 |
| 74 | iso_pu_bacteria | 2849560528 | 2849560733 | 245 |
| 75 | iso_pu_bacteria | 2849573788 | 2849574254 | 245 |
| 76 | iso_pu_bacteria | 2851153111 | 2851158120 | 245 |
| 77 | iso_pu_bacteria | 2928027323 | 2928028101 | 245 |
| 78 | iso_pu_bacteria | 2928972540 | 2928973689 | 245 |
| 79 | iso_pu_bacteria | 2941485952 | 2941489154 | 245 |
| 80 | iso_pu_bacteria | 2977240413 | 2977241356 | 245 |
| 81 | iso_pu_bacteria | 2984555340 | 2984558430 | 245 |
| 82 | iso_pu_bacteria | 2984564862 | 2984567163 | 245 |
| 83 | iso_pu_bacteria | 2993356040 | 2993358254 | 245 |
| 84 | 3300013104 | Ga0157370_10382631 | Ga0157370_103826311 | 246 |
| 85 | iso_pu_bacteria | 2818991435 | 2819539566 | 246 |
| 86 | iso_pu_bacteria | 2818991454 | 2819648774 | 246 |
| 87 | iso_pu_bacteria | 2851153111 | 2851156501 | 246 |
| 88 | 3300002067 | JGI24735J21928_10008827 | JGI24735J21928_100088273 | 247 |
| 89 | 3300005329 | Ga0070683_100021868 | Ga0070683_1000218682 | 247 |
| 90 | 3300005336 | Ga0070680_100213456 | Ga0070680_1002134562 | 247 |
| 91 | 3300005347 | Ga0070668_100721845 | Ga0070668_1007218451 | 247 |
| 92 | 3300005548 | Ga0070665_100000912 | Ga0070665_10000091222 | 247 |
| 93 | 3300005548 | Ga0070665_100074684 | Ga0070665_1000746842 | 247 |
| 94 | 3300005618 | Ga0068864_100000243 | Ga0068864_10000024325 | 247 |
| 95 | 3300005842 | Ga0068858_100002184 | Ga0068858_10000218422 | 247 |
| 96 | 3300009177 | Ga0105248_10076503 | Ga0105248_100765033 | 247 |
| 97 | 3300013306 | Ga0163162_10005444 | Ga0163162_100054444 | 247 |
| 98 | 3300014325 | Ga0163163_10119893 | Ga0163163_101198932 | 247 |
| 99 | 3300025315 | Ga0207697_10023401 | Ga0207697_100234013 | 247 |
| 100 | 3300025914 | Ga0207671_10319384 | Ga0207671_103193842 | 247 |
| 101 | 3300025917 | Ga0207660_10006982 | Ga0207660_100069826 | 247 |
| 102 | 3300025941 | Ga0207711_10026097 | Ga0207711_100260973 | 247 |
| 103 | 3300025944 | Ga0207661_10032090 | Ga0207661_100320903 | 247 |
| 104 | 3300026035 | Ga0207703_10177650 | Ga0207703_101776501 | 247 |
| 105 | 3300026095 | Ga0207676_10000331 | Ga0207676_1000033129 | 247 |
| 106 | 3300028379 | Ga0268266_10000768 | Ga0268266_100007686 | 247 |
| 107 | 3300028379 | Ga0268266_10052347 | Ga0268266_100523472 | 247 |
| 108 | 3300031250 | Ga0265331_10005913 | Ga0265331_100059136 | 247 |
| 109 | 3300032126 | Ga0307415_100265599 | Ga0307415_1002655992 | 247 |
| 110 | 3300045051 | Ga0451576_0877091 | Ga0451576_0877091_83_826 | 247 |
| 111 | 3300046453 | Ga0495627_000260 | Ga0495627_000260_15545_16288 | 247 |
| 112 | 3300046471 | Ga0495650_0001200 | Ga0495650_0001200_11016_11759 | 247 |
| 113 | 3300046559 | Ga0495667_0270410 | Ga0495667_0270410_282_1025 | 247 |
| 114 | 3300047470 | Ga0495681_0000049 | Ga0495681_0000049_93363_94106 | 247 |
| 115 | 3300048924 | Ga0496121_0000170 | Ga0496121_0000170_56150_56893 | 247 |
| 116 | 3300048929 | Ga0496126_0003603 | Ga0496126_0003603_1168_1911 | 247 |
| 117 | 3300049592 | Ga0501076_0626278 | Ga0501076_0626278_124_867 | 247 |
| 118 | 3300053178 | Ga0500637_0111301 | Ga0500637_0111301_341_1087 | 247 |
| 119 | 3300001990 | JGI24737J22298_10031451 | JGI24737J22298_100314512 | 248 |
| 120 | 3300002067 | JGI24735J21928_10012443 | JGI24735J21928_100124433 | 248 |
| 121 | 3300002070 | JGI24750J21931_1000088 | JGI24750J21931_100008811 | 248 |
| 122 | 3300002074 | JGI24748J21848_1000065 | JGI24748J21848_100006540 | 248 |
| 123 | 3300002076 | JGI24749J21850_1003606 | JGI24749J21850_10036062 | 248 |
| 124 | 3300002239 | JGI24034J26672_10000008 | JGI24034J26672_10000008201 | 248 |
| 125 | 3300002459 | JGI24751J29686_10001254 | JGI24751J29686_100012544 | 248 |
| 126 | 3300005330 | Ga0070690_100000006 | Ga0070690_10000000690 | 248 |
| 127 | 3300005331 | Ga0070670_100085356 | Ga0070670_1000853562 | 248 |
| 128 | 3300005335 | Ga0070666_10000004 | Ga0070666_1000000491 | 248 |
| 129 | 3300005340 | Ga0070689_100003505 | Ga0070689_1000035056 | 248 |
| 130 | 3300005353 | Ga0070669_100000183 | Ga0070669_1000001832 | 248 |
| 131 | 3300005365 | Ga0070688_100000425 | Ga0070688_1000004255 | 248 |
| 132 | 3300005366 | Ga0070659_100038286 | Ga0070659_1000382863 | 248 |
| 133 | 3300005466 | Ga0070685_10000268 | Ga0070685_1000026819 | 248 |
| 134 | 3300005544 | Ga0070686_100000036 | Ga0070686_10000003691 | 248 |
| 135 | 3300005548 | Ga0070665_100000004 | Ga0070665_100000004467 | 248 |
| 136 | 3300005617 | Ga0068859_100006326 | Ga0068859_1000063267 | 248 |
| 137 | 3300005719 | Ga0068861_100001448 | Ga0068861_1000014486 | 248 |
| 138 | 3300005841 | Ga0068863_100000013 | Ga0068863_10000001314 | 248 |
| 139 | 3300005842 | Ga0068858_100007209 | Ga0068858_1000072097 | 248 |
| 140 | 3300005843 | Ga0068860_100000009 | Ga0068860_10000000991 | 248 |
| 141 | 3300005844 | Ga0068862_100000029 | Ga0068862_100000029102 | 248 |
| 142 | 3300006353 | Ga0075370_10006824 | Ga0075370_100068242 | 248 |
| 143 | 3300006931 | Ga0097620_100006326 | Ga0097620_1000063267 | 248 |
| 144 | 3300009177 | Ga0105248_10013870 | Ga0105248_100138704 | 248 |
| 145 | 3300009553 | Ga0105249_10000006 | Ga0105249_10000006273 | 248 |
| 146 | 3300010375 | Ga0105239_10015105 | Ga0105239_100151054 | 248 |
| 147 | 3300013306 | Ga0163162_10229260 | Ga0163162_102292602 | 248 |
| 148 | 3300013307 | Ga0157372_10019482 | Ga0157372_100194826 | 248 |
| 149 | 3300014325 | Ga0163163_10003094 | Ga0163163_1000309411 | 248 |
| 150 | 3300014326 | Ga0157380_10000786 | Ga0157380_100007866 | 248 |
| 151 | 3300017792 | Ga0163161_10000029 | Ga0163161_1000002996 | 248 |
| 152 | 3300025223 | Ga0207672_1001409 | Ga0207672_10014092 | 248 |
| 153 | 3300025903 | Ga0207680_10000010 | Ga0207680_10000010316 | 248 |
| 154 | 3300025904 | Ga0207647_10012153 | Ga0207647_100121533 | 248 |
| 155 | 3300025909 | Ga0207705_10130675 | Ga0207705_101306753 | 248 |
| 156 | 3300025919 | Ga0207657_10362268 | Ga0207657_103622682 | 248 |
| 157 | 3300025923 | Ga0207681_10000047 | Ga0207681_1000004722 | 248 |
| 158 | 3300025925 | Ga0207650_10318522 | Ga0207650_103185222 | 248 |
| 159 | 3300025931 | Ga0207644_10018443 | Ga0207644_100184433 | 248 |
| 160 | 3300025932 | Ga0207690_10042395 | Ga0207690_100423952 | 248 |
| 161 | 3300025936 | Ga0207670_10179692 | Ga0207670_101796922 | 248 |
| 162 | 3300025940 | Ga0207691_10268732 | Ga0207691_102687322 | 248 |
| 163 | 3300025941 | Ga0207711_10042948 | Ga0207711_100429484 | 248 |
| 164 | 3300025961 | Ga0207712_10000014 | Ga0207712_1000001491 | 248 |
| 165 | 3300025986 | Ga0207658_10001340 | Ga0207658_100013405 | 248 |
| 166 | 3300026035 | Ga0207703_10000613 | Ga0207703_1000061311 | 248 |
| 167 | 3300026088 | Ga0207641_10000116 | Ga0207641_1000011615 | 248 |
| 168 | 3300026095 | Ga0207676_10003373 | Ga0207676_1000337310 | 248 |
| 169 | 3300026118 | Ga0207675_100000262 | Ga0207675_10000026223 | 248 |
| 170 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009333 | 248 |
| 171 | 3300028380 | Ga0268265_10000283 | Ga0268265_1000028356 | 248 |
| 172 | 3300028381 | Ga0268264_10000023 | Ga0268264_10000023274 | 248 |
| 173 | 3300042005 | Ga0439448_0029180 | Ga0439448_0029180_914_1660 | 248 |
| 174 | 3300042012 | Ga0439455_0000718 | Ga0439455_0000718_109_855 | 248 |
| 175 | 3300042157 | Ga0439458_0000567 | Ga0439458_0000567_141_887 | 248 |
| 176 | 3300046463 | Ga0495653_0407100 | Ga0495653_0407100_56_802 | 248 |
| 177 | 3300046558 | Ga0495633_0051812 | Ga0495633_0051812_205_954 | 248 |
| 178 | 3300048907 | Ga0496104_0051009 | Ga0496104_0051009_1799_2554 | 248 |
| 179 | 3300048908 | Ga0496105_0078474 | Ga0496105_0078474_1631_2386 | 248 |
| 180 | 3300048914 | Ga0496111_0015746 | Ga0496111_0015746_1008_1754 | 248 |
| 181 | 3300048914 | Ga0496111_0073449 | Ga0496111_0073449_1521_2276 | 248 |
| 182 | 3300048919 | Ga0496116_0071550 | Ga0496116_0071550_433_1188 | 248 |
| 183 | 3300048920 | Ga0496117_0008474 | Ga0496117_0008474_873_1628 | 248 |
| 184 | 3300048921 | Ga0496118_0009510 | Ga0496118_0009510_1257_2012 | 248 |
| 185 | 3300048925 | Ga0496122_0001355 | Ga0496122_0001355_7250_7996 | 248 |
| 186 | 3300048926 | Ga0496123_0002426 | Ga0496123_0002426_10621_11367 | 248 |
| 187 | 3300048927 | Ga0496124_0057234 | Ga0496124_0057234_1803_2549 | 248 |
| 188 | 3300049571 | Ga0501034_0003706 | Ga0501034_0003706_8095_8841 | 248 |
| 189 | 3300049581 | Ga0501047_0254683 | Ga0501047_0254683_706_1452 | 248 |
| 190 | 3300049822 | Ga0501035_0277499 | Ga0501035_0277499_275_1021 | 248 |
| 191 | 3300050496 | nmdc:mga07m45_35718_c1 | nmdc:mga07m45_35718_c1_1488_2234 | 248 |
| 192 | 3300053139 | Ga0500568_0000345 | Ga0500568_0000345_14784_15530 | 248 |
| 193 | 3300053153 | Ga0500616_0000119 | Ga0500616_0000119_31309_32055 | 248 |
| 194 | 3300053157 | Ga0500624_000107 | Ga0500624_000107_29692_30441 | 248 |
| 195 | iso_pu_bacteria | 2582581293 | 2585199299 | 248 |
| 196 | iso_pu_bacteria | 2582581293 | 2585199560 | 248 |
| 197 | 2162886007 | SwRhRL2b_contig_290893 | SwRhRL2b_0021.00003640 | 249 |
| 198 | 3300001904 | JGI24736J21556_1000900 | JGI24736J21556_10009006 | 249 |
| 199 | 3300001915 | JGI24741J21665_1000596 | JGI24741J21665_10005968 | 249 |
| 200 | 3300001979 | JGI24740J21852_10000580 | JGI24740J21852_100005802 | 249 |
| 201 | 3300001989 | JGI24739J22299_10028024 | JGI24739J22299_100280242 | 249 |
| 202 | 3300001990 | JGI24737J22298_10000054 | JGI24737J22298_1000005427 | 249 |
| 203 | 3300001990 | JGI24737J22298_10000952 | JGI24737J22298_100009523 | 249 |
| 204 | 3300002067 | JGI24735J21928_10002076 | JGI24735J21928_100020766 | 249 |
| 205 | 3300002075 | JGI24738J21930_10012066 | JGI24738J21930_100120661 | 249 |
| 206 | 3300002244 | JGI24742J22300_10010079 | JGI24742J22300_100100792 | 249 |
| 207 | 3300002774 | JGI25150J39212_1000472 | JGI25150J39212_10004722 | 249 |
| 208 | 3300003187 | JGI25151J46595_10028399 | JGI25151J46595_100283993 | 249 |
| 209 | 3300003215 | JGI25153J46596_10000038 | JGI25153J46596_10000038130 | 249 |
| 210 | 3300003323 | rootH1_10001301 | rootH1_100013013 | 249 |
| 211 | 3300003323 | rootH1_10064589 | rootH1_100645892 | 249 |
| 212 | 3300003763 | Ga0055529_1000014 | Ga0055529_1000014172 | 249 |
| 213 | 3300003775 | Ga0055524_1000598 | Ga0055524_10005989 | 249 |
| 214 | 3300003781 | Ga0055536_1003677 | Ga0055536_10036773 | 249 |
| 215 | 3300003791 | Ga0055530_10000131 | Ga0055530_1000013114 | 249 |
| 216 | 3300003791 | Ga0055530_10002644 | Ga0055530_100026448 | 249 |
| 217 | 3300003791 | Ga0055530_10011719 | Ga0055530_100117193 | 249 |
| 218 | 3300003794 | Ga0055531_10000617 | Ga0055531_1000061714 | 249 |
| 219 | 3300003794 | Ga0055531_10016551 | Ga0055531_100165513 | 249 |
| 220 | 3300005262 | Ga0065165_1000906 | Ga0065165_100090610 | 249 |
| 221 | 3300005262 | Ga0065165_1006868 | Ga0065165_10068683 | 249 |
| 222 | 3300005289 | Ga0065704_10001326 | Ga0065704_1000132613 | 249 |
| 223 | 3300005327 | Ga0070658_10001045 | Ga0070658_1000104514 | 249 |
| 224 | 3300005327 | Ga0070658_10066526 | Ga0070658_100665261 | 249 |
| 225 | 3300005327 | Ga0070658_10220152 | Ga0070658_102201522 | 249 |
| 226 | 3300005328 | Ga0070676_10091733 | Ga0070676_100917332 | 249 |
| 227 | 3300005328 | Ga0070676_10616292 | Ga0070676_106162921 | 249 |
| 228 | 3300005329 | Ga0070683_100123397 | Ga0070683_1001233972 | 249 |
| 229 | 3300005329 | Ga0070683_100321491 | Ga0070683_1003214912 | 249 |
| 230 | 3300005330 | Ga0070690_100090469 | Ga0070690_1000904692 | 249 |
| 231 | 3300005331 | Ga0070670_100022090 | Ga0070670_1000220903 | 249 |
| 232 | 3300005333 | Ga0070677_10024855 | Ga0070677_100248552 | 249 |
| 233 | 3300005336 | Ga0070680_100000337 | Ga0070680_10000033724 | 249 |
| 234 | 3300005336 | Ga0070680_100279561 | Ga0070680_1002795612 | 249 |
| 235 | 3300005338 | Ga0068868_100018762 | Ga0068868_1000187624 | 249 |
| 236 | 3300005338 | Ga0068868_100021029 | Ga0068868_1000210292 | 249 |
| 237 | 3300005338 | Ga0068868_100491033 | Ga0068868_1004910331 | 249 |
| 238 | 3300005339 | Ga0070660_100015201 | Ga0070660_1000152014 | 249 |
| 239 | 3300005339 | Ga0070660_100128642 | Ga0070660_1001286422 | 249 |
| 240 | 3300005340 | Ga0070689_100146496 | Ga0070689_1001464962 | 249 |
| 241 | 3300005344 | Ga0070661_100000754 | Ga0070661_10000075415 | 249 |
| 242 | 3300005344 | Ga0070661_100034420 | Ga0070661_1000344203 | 249 |
| 243 | 3300005347 | Ga0070668_100062113 | Ga0070668_1000621132 | 249 |
| 244 | 3300005347 | Ga0070668_100887166 | Ga0070668_1008871661 | 249 |
| 245 | 3300005353 | Ga0070669_100171483 | Ga0070669_1001714831 | 249 |
| 246 | 3300005354 | Ga0070675_100087864 | Ga0070675_1000878642 | 249 |
| 247 | 3300005356 | Ga0070674_100000446 | Ga0070674_10000044621 | 249 |
| 248 | 3300005356 | Ga0070674_100000533 | Ga0070674_10000053314 | 249 |
| 249 | 3300005364 | Ga0070673_100155276 | Ga0070673_1001552762 | 249 |
| 250 | 3300005365 | Ga0070688_100182617 | Ga0070688_1001826172 | 249 |
| 251 | 3300005366 | Ga0070659_100691089 | Ga0070659_1006910891 | 249 |
| 252 | 3300005367 | Ga0070667_100051825 | Ga0070667_1000518252 | 249 |
| 253 | 3300005367 | Ga0070667_100384848 | Ga0070667_1003848482 | 249 |
| 254 | 3300005455 | Ga0070663_100002383 | Ga0070663_1000023837 | 249 |
| 255 | 3300005456 | Ga0070678_100002168 | Ga0070678_1000021688 | 249 |
| 256 | 3300005456 | Ga0070678_100034974 | Ga0070678_1000349743 | 249 |
| 257 | 3300005457 | Ga0070662_100001493 | Ga0070662_1000014933 | 249 |
| 258 | 3300005457 | Ga0070662_100411331 | Ga0070662_1004113312 | 249 |
| 259 | 3300005458 | Ga0070681_10180235 | Ga0070681_101802352 | 249 |
| 260 | 3300005458 | Ga0070681_10453471 | Ga0070681_104534712 | 249 |
| 261 | 3300005466 | Ga0070685_10055233 | Ga0070685_100552332 | 249 |
| 262 | 3300005530 | Ga0070679_100065430 | Ga0070679_1000654302 | 249 |
| 263 | 3300005530 | Ga0070679_100113545 | Ga0070679_1001135452 | 249 |
| 264 | 3300005535 | Ga0070684_100061718 | Ga0070684_1000617183 | 249 |
| 265 | 3300005539 | Ga0068853_100056738 | Ga0068853_1000567382 | 249 |
| 266 | 3300005543 | Ga0070672_100038223 | Ga0070672_1000382233 | 249 |
| 267 | 3300005548 | Ga0070665_100023704 | Ga0070665_1000237043 | 249 |
| 268 | 3300005548 | Ga0070665_100024558 | Ga0070665_1000245586 | 249 |
| 269 | 3300005548 | Ga0070665_100074160 | Ga0070665_1000741602 | 249 |
| 270 | 3300005548 | Ga0070665_100202758 | Ga0070665_1002027582 | 249 |
| 271 | 3300005548 | Ga0070665_100363231 | Ga0070665_1003632312 | 249 |
| 272 | 3300005563 | Ga0068855_100019306 | Ga0068855_1000193062 | 249 |
| 273 | 3300005563 | Ga0068855_100065616 | Ga0068855_1000656162 | 249 |
| 274 | 3300005563 | Ga0068855_100083990 | Ga0068855_1000839901 | 249 |
| 275 | 3300005563 | Ga0068855_100133324 | Ga0068855_1001333241 | 249 |
| 276 | 3300005563 | Ga0068855_100329526 | Ga0068855_1003295262 | 249 |
| 277 | 3300005564 | Ga0070664_100007015 | Ga0070664_1000070155 | 249 |
| 278 | 3300005577 | Ga0068857_100067958 | Ga0068857_1000679582 | 249 |
| 279 | 3300005578 | Ga0068854_100007205 | Ga0068854_1000072053 | 249 |
| 280 | 3300005578 | Ga0068854_100024487 | Ga0068854_1000244874 | 249 |
| 281 | 3300005578 | Ga0068854_100173152 | Ga0068854_1001731522 | 249 |
| 282 | 3300005614 | Ga0068856_100089983 | Ga0068856_1000899832 | 249 |
| 283 | 3300005616 | Ga0068852_100117209 | Ga0068852_1001172092 | 249 |
| 284 | 3300005616 | Ga0068852_100279853 | Ga0068852_1002798532 | 249 |
| 285 | 3300005618 | Ga0068864_100370777 | Ga0068864_1003707772 | 249 |
| 286 | 3300005834 | Ga0068851_10014560 | Ga0068851_100145604 | 249 |
| 287 | 3300005840 | Ga0068870_10324476 | Ga0068870_103244761 | 249 |
| 288 | 3300005843 | Ga0068860_100025256 | Ga0068860_1000252563 | 249 |
| 289 | 3300006175 | Ga0070712_100546858 | Ga0070712_1005468581 | 249 |
| 290 | 3300006178 | Ga0075367_10000744 | Ga0075367_100007446 | 249 |
| 291 | 3300006353 | Ga0075370_10020630 | Ga0075370_100206302 | 249 |
| 292 | 3300006358 | Ga0068871_100046319 | Ga0068871_1000463192 | 249 |
| 293 | 3300006358 | Ga0068871_100191209 | Ga0068871_1001912092 | 249 |
| 294 | 3300006881 | Ga0068865_100310106 | Ga0068865_1003101062 | 249 |
| 295 | 3300006946 | Ga0079104_1036655 | Ga0079104_10366551 | 249 |
| 296 | 3300009011 | Ga0105251_10000041 | Ga0105251_1000004194 | 249 |
| 297 | 3300009011 | Ga0105251_10026323 | Ga0105251_100263232 | 249 |
| 298 | 3300009093 | Ga0105240_10003013 | Ga0105240_1000301320 | 249 |
| 299 | 3300009093 | Ga0105240_10003693 | Ga0105240_1000369321 | 249 |
| 300 | 3300009093 | Ga0105240_10005249 | Ga0105240_1000524911 | 249 |
| 301 | 3300009093 | Ga0105240_10102371 | Ga0105240_101023712 | 249 |
| 302 | 3300009093 | Ga0105240_10416779 | Ga0105240_104167792 | 249 |
| 303 | 3300009093 | Ga0105240_10418413 | Ga0105240_104184132 | 249 |
| 304 | 3300009098 | Ga0105245_10001089 | Ga0105245_100010897 | 249 |
| 305 | 3300009148 | Ga0105243_10000850 | Ga0105243_100008503 | 249 |
| 306 | 3300009148 | Ga0105243_10048017 | Ga0105243_100480173 | 249 |
| 307 | 3300009148 | Ga0105243_10198778 | Ga0105243_101987782 | 249 |
| 308 | 3300009174 | Ga0105241_10003989 | Ga0105241_100039898 | 249 |
| 309 | 3300009174 | Ga0105241_10007570 | Ga0105241_100075706 | 249 |
| 310 | 3300009174 | Ga0105241_10108146 | Ga0105241_101081462 | 249 |
| 311 | 3300009545 | Ga0105237_10076519 | Ga0105237_100765194 | 249 |
| 312 | 3300009545 | Ga0105237_10088523 | Ga0105237_100885232 | 249 |
| 313 | 3300009545 | Ga0105237_10105976 | Ga0105237_101059761 | 249 |
| 314 | 3300009545 | Ga0105237_10611870 | Ga0105237_106118701 | 249 |
| 315 | 3300009551 | Ga0105238_10046240 | Ga0105238_100462402 | 249 |
| 316 | 3300009551 | Ga0105238_10064733 | Ga0105238_100647332 | 249 |
| 317 | 3300009551 | Ga0105238_10090258 | Ga0105238_100902582 | 249 |
| 318 | 3300009551 | Ga0105238_10124587 | Ga0105238_101245873 | 249 |
| 319 | 3300009551 | Ga0105238_10213095 | Ga0105238_102130952 | 249 |
| 320 | 3300009551 | Ga0105238_10583715 | Ga0105238_105837152 | 249 |
| 321 | 3300009553 | Ga0105249_10005913 | Ga0105249_100059137 | 249 |
| 322 | 3300010375 | Ga0105239_10040388 | Ga0105239_100403884 | 249 |
| 323 | 3300010375 | Ga0105239_10112652 | Ga0105239_101126522 | 249 |
| 324 | 3300010375 | Ga0105239_10142058 | Ga0105239_101420582 | 249 |
| 325 | 3300010375 | Ga0105239_10250566 | Ga0105239_102505662 | 249 |
| 326 | 3300010375 | Ga0105239_10353957 | Ga0105239_103539572 | 249 |
| 327 | 3300010375 | Ga0105239_10407565 | Ga0105239_104075652 | 249 |
| 328 | 3300011119 | Ga0105246_10096750 | Ga0105246_100967501 | 249 |
| 329 | 3300013100 | Ga0157373_10033509 | Ga0157373_100335092 | 249 |
| 330 | 3300013100 | Ga0157373_10304930 | Ga0157373_103049301 | 249 |
| 331 | 3300013102 | Ga0157371_10000757 | Ga0157371_1000075710 | 249 |
| 332 | 3300013102 | Ga0157371_10014187 | Ga0157371_100141872 | 249 |
| 333 | 3300013104 | Ga0157370_10002465 | Ga0157370_1000246517 | 249 |
| 334 | 3300013104 | Ga0157370_10194756 | Ga0157370_101947562 | 249 |
| 335 | 3300013105 | Ga0157369_10062533 | Ga0157369_100625334 | 249 |
| 336 | 3300013105 | Ga0157369_10329648 | Ga0157369_103296482 | 249 |
| 337 | 3300013296 | Ga0157374_10147671 | Ga0157374_101476711 | 249 |
| 338 | 3300013296 | Ga0157374_10261406 | Ga0157374_102614062 | 249 |
| 339 | 3300013297 | Ga0157378_10139889 | Ga0157378_101398893 | 249 |
| 340 | 3300013297 | Ga0157378_10679719 | Ga0157378_106797191 | 249 |
| 341 | 3300013306 | Ga0163162_10946254 | Ga0163162_109462541 | 249 |
| 342 | 3300013307 | Ga0157372_10001644 | Ga0157372_1000164419 | 249 |
| 343 | 3300014325 | Ga0163163_10000033 | Ga0163163_1000003372 | 249 |
| 344 | 3300014325 | Ga0163163_10015128 | Ga0163163_100151282 | 249 |
| 345 | 3300014325 | Ga0163163_10692710 | Ga0163163_106927102 | 249 |
| 346 | 3300014326 | Ga0157380_10021232 | Ga0157380_100212323 | 249 |
| 347 | 3300014326 | Ga0157380_10278955 | Ga0157380_102789552 | 249 |
| 348 | 3300017792 | Ga0163161_10009039 | Ga0163161_100090397 | 249 |
| 349 | 3300017792 | Ga0163161_10020467 | Ga0163161_100204672 | 249 |
| 350 | 3300017792 | Ga0163161_10056323 | Ga0163161_100563232 | 249 |
| 351 | 3300025229 | Ga0209147_100748 | Ga0209147_10074813 | 249 |
| 352 | 3300025245 | Ga0207425_1000016 | Ga0207425_1000016127 | 249 |
| 353 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011175 | 249 |
| 354 | 3300025258 | Ga0209129_1002879 | Ga0209129_10028796 | 249 |
| 355 | 3300025272 | Ga0209455_1000006 | Ga0209455_10000061019 | 249 |
| 356 | 3300025273 | Ga0209673_1001790 | Ga0209673_10017908 | 249 |
| 357 | 3300025292 | Ga0209676_1000046 | Ga0209676_1000046360 | 249 |
| 358 | 3300025292 | Ga0209676_1000413 | Ga0209676_100041332 | 249 |
| 359 | 3300025294 | Ga0209025_1000396 | Ga0209025_100039621 | 249 |
| 360 | 3300025295 | Ga0209564_1002536 | Ga0209564_100253610 | 249 |
| 361 | 3300025297 | Ga0209758_1000009 | Ga0209758_1000009368 | 249 |
| 362 | 3300025298 | Ga0209050_1000057 | Ga0209050_1000057279 | 249 |
| 363 | 3300025298 | Ga0209050_1000347 | Ga0209050_100034732 | 249 |
| 364 | 3300025298 | Ga0209050_1003694 | Ga0209050_10036947 | 249 |
| 365 | 3300025298 | Ga0209050_1005329 | Ga0209050_10053296 | 249 |
| 366 | 3300025298 | Ga0209050_1063271 | Ga0209050_10632711 | 249 |
| 367 | 3300025299 | Ga0209256_1000851 | Ga0209256_100085112 | 249 |
| 368 | 3300025303 | Ga0209051_1007363 | Ga0209051_10073632 | 249 |
| 369 | 3300025303 | Ga0209051_1088170 | Ga0209051_10881701 | 249 |
| 370 | 3300025304 | Ga0209257_1000191 | Ga0209257_100019178 | 249 |
| 371 | 3300025304 | Ga0209257_1000371 | Ga0209257_100037132 | 249 |
| 372 | 3300025304 | Ga0209257_1001875 | Ga0209257_10018752 | 249 |
| 373 | 3300025304 | Ga0209257_1005118 | Ga0209257_10051185 | 249 |
| 374 | 3300025304 | Ga0209257_1012086 | Ga0209257_10120864 | 249 |
| 375 | 3300025321 | Ga0207656_10070900 | Ga0207656_100709002 | 249 |
| 376 | 3300025735 | Ga0207713_1000798 | Ga0207713_100079811 | 249 |
| 377 | 3300025735 | Ga0207713_1025055 | Ga0207713_10250552 | 249 |
| 378 | 3300025893 | Ga0207682_10013464 | Ga0207682_100134643 | 249 |
| 379 | 3300025901 | Ga0207688_10310724 | Ga0207688_103107242 | 249 |
| 380 | 3300025903 | Ga0207680_10020755 | Ga0207680_100207552 | 249 |
| 381 | 3300025903 | Ga0207680_10079100 | Ga0207680_100791002 | 249 |
| 382 | 3300025904 | Ga0207647_10001047 | Ga0207647_100010474 | 249 |
| 383 | 3300025904 | Ga0207647_10030584 | Ga0207647_100305843 | 249 |
| 384 | 3300025904 | Ga0207647_10088389 | Ga0207647_100883892 | 249 |
| 385 | 3300025907 | Ga0207645_10209951 | Ga0207645_102099512 | 249 |
| 386 | 3300025908 | Ga0207643_10185251 | Ga0207643_101852512 | 249 |
| 387 | 3300025909 | Ga0207705_10000718 | Ga0207705_1000071812 | 249 |
| 388 | 3300025909 | Ga0207705_10610569 | Ga0207705_106105691 | 249 |
| 389 | 3300025911 | Ga0207654_10000732 | Ga0207654_1000073210 | 249 |
| 390 | 3300025911 | Ga0207654_10010982 | Ga0207654_100109822 | 249 |
| 391 | 3300025911 | Ga0207654_10053448 | Ga0207654_100534482 | 249 |
| 392 | 3300025912 | Ga0207707_10099537 | Ga0207707_100995372 | 249 |
| 393 | 3300025912 | Ga0207707_10110313 | Ga0207707_101103132 | 249 |
| 394 | 3300025913 | Ga0207695_10002546 | Ga0207695_1000254616 | 249 |
| 395 | 3300025913 | Ga0207695_10005914 | Ga0207695_1000591412 | 249 |
| 396 | 3300025913 | Ga0207695_10006892 | Ga0207695_100068923 | 249 |
| 397 | 3300025913 | Ga0207695_10057230 | Ga0207695_100572302 | 249 |
| 398 | 3300025913 | Ga0207695_10082352 | Ga0207695_100823522 | 249 |
| 399 | 3300025913 | Ga0207695_10135058 | Ga0207695_101350582 | 249 |
| 400 | 3300025913 | Ga0207695_10140950 | Ga0207695_101409503 | 249 |
| 401 | 3300025913 | Ga0207695_10305928 | Ga0207695_103059282 | 249 |
| 402 | 3300025913 | Ga0207695_10498228 | Ga0207695_104982281 | 249 |
| 403 | 3300025914 | Ga0207671_10059804 | Ga0207671_100598041 | 249 |
| 404 | 3300025914 | Ga0207671_10246317 | Ga0207671_102463172 | 249 |
| 405 | 3300025916 | Ga0207663_10533993 | Ga0207663_105339932 | 249 |
| 406 | 3300025917 | Ga0207660_10004779 | Ga0207660_100047795 | 249 |
| 407 | 3300025917 | Ga0207660_10105032 | Ga0207660_101050322 | 249 |
| 408 | 3300025919 | Ga0207657_10011730 | Ga0207657_100117303 | 249 |
| 409 | 3300025920 | Ga0207649_10000371 | Ga0207649_1000037114 | 249 |
| 410 | 3300025921 | Ga0207652_10052761 | Ga0207652_100527613 | 249 |
| 411 | 3300025921 | Ga0207652_10324655 | Ga0207652_103246552 | 249 |
| 412 | 3300025923 | Ga0207681_10015211 | Ga0207681_100152113 | 249 |
| 413 | 3300025923 | Ga0207681_10209152 | Ga0207681_102091521 | 249 |
| 414 | 3300025924 | Ga0207694_10018283 | Ga0207694_100182832 | 249 |
| 415 | 3300025924 | Ga0207694_10135382 | Ga0207694_101353822 | 249 |
| 416 | 3300025925 | Ga0207650_10019160 | Ga0207650_100191603 | 249 |
| 417 | 3300025926 | Ga0207659_10164160 | Ga0207659_101641602 | 249 |
| 418 | 3300025927 | Ga0207687_10000547 | Ga0207687_1000054714 | 249 |
| 419 | 3300025927 | Ga0207687_10036971 | Ga0207687_100369711 | 249 |
| 420 | 3300025932 | Ga0207690_10001913 | Ga0207690_100019139 | 249 |
| 421 | 3300025933 | Ga0207706_10002790 | Ga0207706_1000279010 | 249 |
| 422 | 3300025934 | Ga0207686_10517784 | Ga0207686_105177842 | 249 |
| 423 | 3300025935 | Ga0207709_10000059 | Ga0207709_1000005932 | 249 |
| 424 | 3300025935 | Ga0207709_10131149 | Ga0207709_101311492 | 249 |
| 425 | 3300025937 | Ga0207669_10000749 | Ga0207669_1000074912 | 249 |
| 426 | 3300025938 | Ga0207704_10271374 | Ga0207704_102713741 | 249 |
| 427 | 3300025940 | Ga0207691_10123002 | Ga0207691_101230023 | 249 |
| 428 | 3300025941 | Ga0207711_10008674 | Ga0207711_100086741 | 249 |
| 429 | 3300025944 | Ga0207661_10139228 | Ga0207661_101392281 | 249 |
| 430 | 3300025944 | Ga0207661_10386573 | Ga0207661_103865731 | 249 |
| 431 | 3300025949 | Ga0207667_10000006 | Ga0207667_10000006267 | 249 |
| 432 | 3300025949 | Ga0207667_10070960 | Ga0207667_100709602 | 249 |
| 433 | 3300025949 | Ga0207667_10286854 | Ga0207667_102868542 | 249 |
| 434 | 3300025960 | Ga0207651_10303634 | Ga0207651_103036342 | 249 |
| 435 | 3300025961 | Ga0207712_10010198 | Ga0207712_100101986 | 249 |
| 436 | 3300025972 | Ga0207668_10040020 | Ga0207668_100400203 | 249 |
| 437 | 3300025972 | Ga0207668_10435408 | Ga0207668_104354081 | 249 |
| 438 | 3300025981 | Ga0207640_10001209 | Ga0207640_100012098 | 249 |
| 439 | 3300025981 | Ga0207640_10002063 | Ga0207640_100020636 | 249 |
| 440 | 3300026023 | Ga0207677_10063621 | Ga0207677_100636212 | 249 |
| 441 | 3300026041 | Ga0207639_10014822 | Ga0207639_100148222 | 249 |
| 442 | 3300026041 | Ga0207639_10030031 | Ga0207639_100300313 | 249 |
| 443 | 3300026041 | Ga0207639_10031910 | Ga0207639_100319104 | 249 |
| 444 | 3300026067 | Ga0207678_10000545 | Ga0207678_1000054525 | 249 |
| 445 | 3300026078 | Ga0207702_10002024 | Ga0207702_100020247 | 249 |
| 446 | 3300026078 | Ga0207702_10014590 | Ga0207702_100145903 | 249 |
| 447 | 3300026089 | Ga0207648_10337674 | Ga0207648_103376741 | 249 |
| 448 | 3300026116 | Ga0207674_10001654 | Ga0207674_100016547 | 249 |
| 449 | 3300026116 | Ga0207674_10027324 | Ga0207674_100273249 | 249 |
| 450 | 3300026121 | Ga0207683_10006818 | Ga0207683_100068188 | 249 |
| 451 | 3300026121 | Ga0207683_10081300 | Ga0207683_100813002 | 249 |
| 452 | 3300026121 | Ga0207683_10087307 | Ga0207683_100873072 | 249 |
| 453 | 3300026142 | Ga0207698_10017674 | Ga0207698_100176746 | 249 |
| 454 | 3300026142 | Ga0207698_10234617 | Ga0207698_102346172 | 249 |
| 455 | 3300027866 | Ga0209813_10000077 | Ga0209813_1000007711 | 249 |
| 456 | 3300028379 | Ga0268266_10027727 | Ga0268266_100277271 | 249 |
| 457 | 3300028379 | Ga0268266_10028256 | Ga0268266_100282562 | 249 |
| 458 | 3300028379 | Ga0268266_10179985 | Ga0268266_101799852 | 249 |
| 459 | 3300028379 | Ga0268266_10187424 | Ga0268266_101874242 | 249 |
| 460 | 3300028379 | Ga0268266_10303796 | Ga0268266_103037962 | 249 |
| 461 | 3300028380 | Ga0268265_10603668 | Ga0268265_106036681 | 249 |
| 462 | 3300028381 | Ga0268264_10097231 | Ga0268264_100972312 | 249 |
| 463 | 3300028577 | Ga0265318_10009288 | Ga0265318_100092882 | 249 |
| 464 | 3300031241 | Ga0265325_10002784 | Ga0265325_1000278410 | 249 |
| 465 | 3300031249 | Ga0265339_10055217 | Ga0265339_100552172 | 249 |
| 466 | 3300031344 | Ga0265316_10122323 | Ga0265316_101223231 | 249 |
| 467 | 3300031456 | Ga0307513_10059066 | Ga0307513_100590663 | 249 |
| 468 | 3300031548 | Ga0307408_100008127 | Ga0307408_10000812710 | 249 |
| 469 | 3300031595 | Ga0265313_10003810 | Ga0265313_100038104 | 249 |
| 470 | 3300031595 | Ga0265313_10008369 | Ga0265313_100083697 | 249 |
| 471 | 3300031711 | Ga0265314_10087716 | Ga0265314_100877162 | 249 |
| 472 | 3300031711 | Ga0265314_10249442 | Ga0265314_102494422 | 249 |
| 473 | 3300031731 | Ga0307405_10039971 | Ga0307405_100399713 | 249 |
| 474 | 3300031852 | Ga0307410_10002590 | Ga0307410_100025902 | 249 |
| 475 | 3300031901 | Ga0307406_10002019 | Ga0307406_100020197 | 249 |
| 476 | 3300031911 | Ga0307412_10035072 | Ga0307412_100350722 | 249 |
| 477 | 3300031911 | Ga0307412_10149881 | Ga0307412_101498812 | 249 |
| 478 | 3300031995 | Ga0307409_100038474 | Ga0307409_1000384744 | 249 |
| 479 | 3300032004 | Ga0307414_10040948 | Ga0307414_100409483 | 249 |
| 480 | 3300032004 | Ga0307414_10112600 | Ga0307414_101126002 | 249 |
| 481 | 3300032004 | Ga0307414_10114496 | Ga0307414_101144962 | 249 |
| 482 | 3300032004 | Ga0307414_10363185 | Ga0307414_103631852 | 249 |
| 483 | 3300035113 | Ga0373936_0247516 | Ga0373936_0247516_36_785 | 249 |
| 484 | 3300035172 | Ga0373955_0058693 | Ga0373955_0058693_1167_1916 | 249 |
| 485 | 3300035692 | Ga0373935_0273237 | Ga0373935_0273237_359_1108 | 249 |
| 486 | 3300037312 | Ga0395899_0000674 | Ga0395899_0000674_18970_19719 | 249 |
| 487 | 3300037418 | Ga0395900_0000075 | Ga0395900_0000075_20919_21668 | 249 |
| 488 | 3300037418 | Ga0395900_0121430 | Ga0395900_0121430_1355_2104 | 249 |
| 489 | 3300037466 | Ga0395898_0000055 | Ga0395898_0000055_165170_165919 | 249 |
| 490 | 3300037466 | Ga0395898_0235657 | Ga0395898_0235657_272_1021 | 249 |
| 491 | 3300037471 | Ga0395905_0000067 | Ga0395905_0000067_112639_113388 | 249 |
| 492 | 3300038443 | Ga0395901_0000648 | Ga0395901_0000648_34568_35317 | 249 |
| 493 | 3300038443 | Ga0395901_0064369 | Ga0395901_0064369_2239_2988 | 249 |
| 494 | 3300041406 | Ga0439439_0044389 | Ga0439439_0044389_373_1122 | 249 |
| 495 | 3300041410 | Ga0439461_0008099 | Ga0439461_0008099_1007_1756 | 249 |
| 496 | 3300041459 | Ga0451800_1383254 | Ga0451800_1383254_299_1048 | 249 |
| 497 | 3300041498 | Ga0451841_1047927 | Ga0451841_1047927_324_1085 | 249 |
| 498 | 3300041997 | Ga0439431_0007189 | Ga0439431_0007189_1445_2194 | 249 |
| 499 | 3300042004 | Ga0439445_0019503 | Ga0439445_0019503_765_1532 | 249 |
| 500 | 3300042010 | Ga0439452_020802 | Ga0439452_020802_870_1619 | 249 |
| 501 | 3300042015 | Ga0439462_0067201 | Ga0439462_0067201_153_902 | 249 |
| 502 | 3300044684 | Ga0466966_0310567 | Ga0466966_0310567_47_826 | 249 |
| 503 | 3300044694 | Ga0466963_0300141 | Ga0466963_0300141_363_1112 | 249 |
| 504 | 3300044735 | Ga0466968_0021934 | Ga0466968_0021934_1779_2528 | 249 |
| 505 | 3300044842 | Ga0466957_0086150 | Ga0466957_0086150_535_1284 | 249 |
| 506 | 3300045049 | Ga0466959_0245630 | Ga0466959_0245630_456_1205 | 249 |
| 507 | 3300045976 | Ga0466967_0111054 | Ga0466967_0111054_1294_2097 | 249 |
| 508 | 3300045976 | Ga0466967_0388609 | Ga0466967_0388609_507_1256 | 249 |
| 509 | 3300046453 | Ga0495627_000295 | Ga0495627_000295_22433_23182 | 249 |
| 510 | 3300046460 | Ga0495638_0012858 | Ga0495638_0012858_1436_2200 | 249 |
| 511 | 3300046491 | Ga0495584_0048051 | Ga0495584_0048051_324_1073 | 249 |
| 512 | 3300046492 | Ga0495585_0193727 | Ga0495585_0193727_256_1005 | 249 |
| 513 | 3300046506 | Ga0495583_0000023 | Ga0495583_0000023_190938_191687 | 249 |
| 514 | 3300046506 | Ga0495583_0014188 | Ga0495583_0014188_1964_2713 | 249 |
| 515 | 3300046506 | Ga0495583_0025567 | Ga0495583_0025567_944_1693 | 249 |
| 516 | 3300046506 | Ga0495583_0096401 | Ga0495583_0096401_461_1210 | 249 |
| 517 | 3300046512 | Ga0495610_0000034 | Ga0495610_0000034_182402_183151 | 249 |
| 518 | 3300046512 | Ga0495610_0000102 | Ga0495610_0000102_87943_88692 | 249 |
| 519 | 3300046512 | Ga0495610_0101354 | Ga0495610_0101354_153_902 | 249 |
| 520 | 3300046515 | Ga0495620_0052963 | Ga0495620_0052963_905_1654 | 249 |
| 521 | 3300046518 | Ga0495631_0130961 | Ga0495631_0130961_151_900 | 249 |
| 522 | 3300046519 | Ga0495632_0000013 | Ga0495632_0000013_28400_29149 | 249 |
| 523 | 3300046519 | Ga0495632_0083888 | Ga0495632_0083888_373_1122 | 249 |
| 524 | 3300046520 | Ga0495637_0000229 | Ga0495637_0000229_32994_33743 | 249 |
| 525 | 3300046520 | Ga0495637_0010298 | Ga0495637_0010298_1363_2112 | 249 |
| 526 | 3300046520 | Ga0495637_0150077 | Ga0495637_0150077_117_866 | 249 |
| 527 | 3300046522 | Ga0495643_0000010 | Ga0495643_0000010_166977_167726 | 249 |
| 528 | 3300046522 | Ga0495643_0000434 | Ga0495643_0000434_15411_16160 | 249 |
| 529 | 3300046524 | Ga0495648_0001360 | Ga0495648_0001360_10036_10785 | 249 |
| 530 | 3300046524 | Ga0495648_0005640 | Ga0495648_0005640_1156_1905 | 249 |
| 531 | 3300046524 | Ga0495648_0006463 | Ga0495648_0006463_4901_5650 | 249 |
| 532 | 3300046524 | Ga0495648_0158220 | Ga0495648_0158220_136_885 | 249 |
| 533 | 3300046525 | Ga0495663_0000004 | Ga0495663_0000004_135664_136413 | 249 |
| 534 | 3300046525 | Ga0495663_0003013 | Ga0495663_0003013_182_931 | 249 |
| 535 | 3300046530 | Ga0495654_0064020 | Ga0495654_0064020_165_914 | 249 |
| 536 | 3300046536 | Ga0495587_0037590 | Ga0495587_0037590_1561_2310 | 249 |
| 537 | 3300046536 | Ga0495587_0081093 | Ga0495587_0081093_331_1080 | 249 |
| 538 | 3300046538 | Ga0495609_0006670 | Ga0495609_0006670_3145_4005 | 249 |
| 539 | 3300046557 | Ga0495622_0012205 | Ga0495622_0012205_2172_2921 | 249 |
| 540 | 3300046558 | Ga0495633_0000092 | Ga0495633_0000092_9244_9993 | 249 |
| 541 | 3300046558 | Ga0495633_0000427 | Ga0495633_0000427_21605_22354 | 249 |
| 542 | 3300046558 | Ga0495633_0000765 | Ga0495633_0000765_10426_11175 | 249 |
| 543 | 3300046558 | Ga0495633_0002661 | Ga0495633_0002661_3266_4015 | 249 |
| 544 | 3300046558 | Ga0495633_0150453 | Ga0495633_0150453_275_1024 | 249 |
| 545 | 3300046558 | Ga0495633_0167776 | Ga0495633_0167776_252_1001 | 249 |
| 546 | 3300046616 | Ga0495668_0000016 | Ga0495668_0000016_67880_68629 | 249 |
| 547 | 3300046648 | Ga0495611_0035397 | Ga0495611_0035397_613_1362 | 249 |
| 548 | 3300046648 | Ga0495611_0135451 | Ga0495611_0135451_301_1050 | 249 |
| 549 | 3300046648 | Ga0495611_0234590 | Ga0495611_0234590_77_826 | 249 |
| 550 | 3300046660 | Ga0495625_0000106 | Ga0495625_0000106_28213_28962 | 249 |
| 551 | 3300046660 | Ga0495625_0048616 | Ga0495625_0048616_1187_1951 | 249 |
| 552 | 3300046684 | Ga0495669_0000052 | Ga0495669_0000052_20669_21418 | 249 |
| 553 | 3300046691 | Ga0495670_0004750 | Ga0495670_0004750_4323_5072 | 249 |
| 554 | 3300046691 | Ga0495670_0030902 | Ga0495670_0030902_1035_1784 | 249 |
| 555 | 3300046691 | Ga0495670_0066077 | Ga0495670_0066077_791_1657 | 249 |
| 556 | 3300046692 | Ga0495671_0000014 | Ga0495671_0000014_166977_167726 | 249 |
| 557 | 3300046692 | Ga0495671_0024350 | Ga0495671_0024350_2062_2811 | 249 |
| 558 | 3300046692 | Ga0495671_0258742 | Ga0495671_0258742_55_804 | 249 |
| 559 | 3300046694 | Ga0495649_0005210 | Ga0495649_0005210_2889_3638 | 249 |
| 560 | 3300046810 | Ga0495660_0001451 | Ga0495660_0001451_4383_5150 | 249 |
| 561 | 3300047318 | Ga0495636_0016743 | Ga0495636_0016743_670_1452 | 249 |
| 562 | 3300047320 | Ga0495672_0063688 | Ga0495672_0063688_120_869 | 249 |
| 563 | 3300047323 | Ga0495683_0007315 | Ga0495683_0007315_4575_5324 | 249 |
| 564 | 3300047323 | Ga0495683_0016176 | Ga0495683_0016176_238_987 | 249 |
| 565 | 3300047443 | Ga0495687_000068 | Ga0495687_000068_102372_103121 | 249 |
| 566 | 3300047443 | Ga0495687_000335 | Ga0495687_000335_8265_9014 | 249 |
| 567 | 3300047444 | Ga0495675_0187475 | Ga0495675_0187475_370_1119 | 249 |
| 568 | 3300047445 | Ga0495677_0133457 | Ga0495677_0133457_134_883 | 249 |
| 569 | 3300047469 | Ga0495673_0080399 | Ga0495673_0080399_119_868 | 249 |
| 570 | 3300047470 | Ga0495681_0000104 | Ga0495681_0000104_45298_46047 | 249 |
| 571 | 3300047470 | Ga0495681_0001853 | Ga0495681_0001853_5257_6006 | 249 |
| 572 | 3300047472 | Ga0495686_0001248 | Ga0495686_0001248_7854_8603 | 249 |
| 573 | 3300047472 | Ga0495686_0024028 | Ga0495686_0024028_2562_3311 | 249 |
| 574 | 3300047472 | Ga0495686_0062797 | Ga0495686_0062797_1420_2169 | 249 |
| 575 | 3300048088 | Ga0495602_0051585 | Ga0495602_0051585_1844_2593 | 249 |
| 576 | 3300048907 | Ga0496104_0008454 | Ga0496104_0008454_774_1523 | 249 |
| 577 | 3300048907 | Ga0496104_0046791 | Ga0496104_0046791_2944_3693 | 249 |
| 578 | 3300048908 | Ga0496105_0003263 | Ga0496105_0003263_5956_6705 | 249 |
| 579 | 3300048908 | Ga0496105_0010189 | Ga0496105_0010189_255_1004 | 249 |
| 580 | 3300048913 | Ga0496110_0084811 | Ga0496110_0084811_1750_2499 | 249 |
| 581 | 3300048913 | Ga0496110_0108041 | Ga0496110_0108041_841_1590 | 249 |
| 582 | 3300048918 | Ga0496115_0001186 | Ga0496115_0001186_12188_12937 | 249 |
| 583 | 3300048918 | Ga0496115_0082816 | Ga0496115_0082816_60_809 | 249 |
| 584 | 3300048919 | Ga0496116_0011033 | Ga0496116_0011033_1087_1839 | 249 |
| 585 | 3300048919 | Ga0496116_0029623 | Ga0496116_0029623_2508_3257 | 249 |
| 586 | 3300048919 | Ga0496116_0200504 | Ga0496116_0200504_230_979 | 249 |
| 587 | 3300048920 | Ga0496117_0001833 | Ga0496117_0001833_14343_15092 | 249 |
| 588 | 3300048920 | Ga0496117_0009240 | Ga0496117_0009240_7246_7995 | 249 |
| 589 | 3300048920 | Ga0496117_0070508 | Ga0496117_0070508_1585_2334 | 249 |
| 590 | 3300048921 | Ga0496118_0004463 | Ga0496118_0004463_7410_8159 | 249 |
| 591 | 3300048921 | Ga0496118_0006864 | Ga0496118_0006864_1049_1798 | 249 |
| 592 | 3300048921 | Ga0496118_0011452 | Ga0496118_0011452_5751_6500 | 249 |
| 593 | 3300048922 | Ga0496119_0000140 | Ga0496119_0000140_81269_82018 | 249 |
| 594 | 3300048922 | Ga0496119_0045445 | Ga0496119_0045445_1208_1957 | 249 |
| 595 | 3300048923 | Ga0496120_0000011 | Ga0496120_0000011_198399_199148 | 249 |
| 596 | 3300048923 | Ga0496120_0110363 | Ga0496120_0110363_51_800 | 249 |
| 597 | 3300048924 | Ga0496121_0000112 | Ga0496121_0000112_151335_152084 | 249 |
| 598 | 3300048924 | Ga0496121_0000734 | Ga0496121_0000734_6291_7058 | 249 |
| 599 | 3300048924 | Ga0496121_0000997 | Ga0496121_0000997_1326_2075 | 249 |
| 600 | 3300048924 | Ga0496121_0044825 | Ga0496121_0044825_2254_3006 | 249 |
| 601 | 3300048924 | Ga0496121_0210174 | Ga0496121_0210174_386_1135 | 249 |
| 602 | 3300048925 | Ga0496122_0000253 | Ga0496122_0000253_99574_100323 | 249 |
| 603 | 3300048925 | Ga0496122_0074202 | Ga0496122_0074202_923_1672 | 249 |
| 604 | 3300048926 | Ga0496123_0000206 | Ga0496123_0000206_20212_20961 | 249 |
| 605 | 3300048926 | Ga0496123_0167173 | Ga0496123_0167173_265_1014 | 249 |
| 606 | 3300048927 | Ga0496124_0000148 | Ga0496124_0000148_68135_68884 | 249 |
| 607 | 3300048927 | Ga0496124_0009107 | Ga0496124_0009107_6725_7474 | 249 |
| 608 | 3300048927 | Ga0496124_0151453 | Ga0496124_0151453_902_1651 | 249 |
| 609 | 3300048927 | Ga0496124_0174671 | Ga0496124_0174671_661_1410 | 249 |
| 610 | 3300048928 | Ga0496125_0000387 | Ga0496125_0000387_72974_73726 | 249 |
| 611 | 3300048928 | Ga0496125_0025013 | Ga0496125_0025013_2406_3155 | 249 |
| 612 | 3300048929 | Ga0496126_0047094 | Ga0496126_0047094_2702_3454 | 249 |
| 613 | 3300048929 | Ga0496126_0051469 | Ga0496126_0051469_1474_2223 | 249 |
| 614 | 3300048929 | Ga0496126_0097037 | Ga0496126_0097037_709_1458 | 249 |
| 615 | 3300048929 | Ga0496126_0150433 | Ga0496126_0150433_576_1325 | 249 |
| 616 | 3300049459 | Ga0495678_106501 | Ga0495678_106501_54_818 | 249 |
| 617 | 3300049460 | Ga0495682_0008927 | Ga0495682_0008927_1009_1758 | 249 |
| 618 | 3300049568 | Ga0501031_0027991 | Ga0501031_0027991_856_1614 | 249 |
| 619 | 3300049569 | Ga0501032_0005428 | Ga0501032_0005428_5115_5873 | 249 |
| 620 | 3300049570 | Ga0501033_0004813 | Ga0501033_0004813_9983_10732 | 249 |
| 621 | 3300049570 | Ga0501033_0008295 | Ga0501033_0008295_5099_5848 | 249 |
| 622 | 3300049570 | Ga0501033_0020152 | Ga0501033_0020152_4164_4994 | 249 |
| 623 | 3300049570 | Ga0501033_0062110 | Ga0501033_0062110_389_1147 | 249 |
| 624 | 3300049571 | Ga0501034_0004672 | Ga0501034_0004672_14303_15061 | 249 |
| 625 | 3300049571 | Ga0501034_0236105 | Ga0501034_0236105_159_917 | 249 |
| 626 | 3300049572 | Ga0501036_0000882 | Ga0501036_0000882_10377_11135 | 249 |
| 627 | 3300049574 | Ga0501038_0186271 | Ga0501038_0186271_876_1634 | 249 |
| 628 | 3300049575 | Ga0501039_0002562 | Ga0501039_0002562_11280_12038 | 249 |
| 629 | 3300049578 | Ga0501042_0013815 | Ga0501042_0013815_539_1297 | 249 |
| 630 | 3300049579 | Ga0501043_0059164 | Ga0501043_0059164_74_832 | 249 |
| 631 | 3300049579 | Ga0501043_0101116 | Ga0501043_0101116_731_1480 | 249 |
| 632 | 3300049580 | Ga0501046_0004326 | Ga0501046_0004326_276_1034 | 249 |
| 633 | 3300049581 | Ga0501047_0001026 | Ga0501047_0001026_1651_2400 | 249 |
| 634 | 3300049581 | Ga0501047_0006093 | Ga0501047_0006093_505_1266 | 249 |
| 635 | 3300049581 | Ga0501047_0010083 | Ga0501047_0010083_120_878 | 249 |
| 636 | 3300049581 | Ga0501047_0040118 | Ga0501047_0040118_2828_3586 | 249 |
| 637 | 3300049581 | Ga0501047_0185553 | Ga0501047_0185553_822_1652 | 249 |
| 638 | 3300049581 | Ga0501047_0324529 | Ga0501047_0324529_126_875 | 249 |
| 639 | 3300049583 | Ga0501067_0021187 | Ga0501067_0021187_1804_2562 | 249 |
| 640 | 3300049584 | Ga0501068_0037223 | Ga0501068_0037223_214_972 | 249 |
| 641 | 3300049585 | Ga0501069_0138890 | Ga0501069_0138890_617_1375 | 249 |
| 642 | 3300049586 | Ga0501070_0027633 | Ga0501070_0027633_2780_3538 | 249 |
| 643 | 3300049589 | Ga0501073_0002008 | Ga0501073_0002008_13189_13947 | 249 |
| 644 | 3300049589 | Ga0501073_0187084 | Ga0501073_0187084_391_1140 | 249 |
| 645 | 3300049589 | Ga0501073_0293637 | Ga0501073_0293637_352_1110 | 249 |
| 646 | 3300049741 | Ga0501079_0009177 | Ga0501079_0009177_2251_3009 | 249 |
| 647 | 3300049742 | Ga0501080_0067296 | Ga0501080_0067296_2274_3032 | 249 |
| 648 | 3300049742 | Ga0501080_0304856 | Ga0501080_0304856_337_1095 | 249 |
| 649 | 3300049742 | Ga0501080_0506773 | Ga0501080_0506773_317_1066 | 249 |
| 650 | 3300049744 | Ga0501083_0013559 | Ga0501083_0013559_2271_3029 | 249 |
| 651 | 3300049823 | Ga0501044_0000796 | Ga0501044_0000796_28877_29626 | 249 |
| 652 | 3300049823 | Ga0501044_0000921 | Ga0501044_0000921_25710_26459 | 249 |
| 653 | 3300049823 | Ga0501044_0025454 | Ga0501044_0025454_4596_5384 | 249 |
| 654 | 3300049823 | Ga0501044_0081857 | Ga0501044_0081857_1604_2362 | 249 |
| 655 | 3300049823 | Ga0501044_0088160 | Ga0501044_0088160_1900_2649 | 249 |
| 656 | 3300049823 | Ga0501044_0124384 | Ga0501044_0124384_1791_2540 | 249 |
| 657 | 3300049823 | Ga0501044_0136781 | Ga0501044_0136781_395_1225 | 249 |
| 658 | 3300050494 | nmdc:mga06z11_90_c1 | nmdc:mga06z11_90_c1_8695_9444 | 249 |
| 659 | 3300050495 | nmdc:mga04h51_299_c1 | nmdc:mga04h51_299_c1_3212_3961 | 249 |
| 660 | 3300053079 | Ga0500610_0000131 | Ga0500610_0000131_2242_2991 | 249 |
| 661 | 3300053080 | Ga0500635_0021268 | Ga0500635_0021268_1100_1849 | 249 |
| 662 | 3300053093 | Ga0500651_0009693 | Ga0500651_0009693_311_1060 | 249 |
| 663 | 3300053094 | Ga0500566_0000347 | Ga0500566_0000347_4177_4926 | 249 |
| 664 | 3300053096 | Ga0500641_0013243 | Ga0500641_0013243_1112_1861 | 249 |
| 665 | 3300053103 | Ga0500555_000042 | Ga0500555_000042_30144_30893 | 249 |
| 666 | 3300053104 | Ga0500556_0000128 | Ga0500556_0000128_9554_10303 | 249 |
| 667 | 3300053118 | Ga0500594_0001896 | Ga0500594_0001896_3243_3992 | 249 |
| 668 | 3300053128 | Ga0500626_027420 | Ga0500626_027420_1275_2024 | 249 |
| 669 | 3300053130 | Ga0500642_0000599 | Ga0500642_0000599_7673_8422 | 249 |
| 670 | 3300053134 | Ga0500658_0000477 | Ga0500658_0000477_15284_16051 | 249 |
| 671 | 3300053136 | Ga0500559_0008943 | Ga0500559_0008943_1273_2022 | 249 |
| 672 | 3300053136 | Ga0500559_0039329 | Ga0500559_0039329_1271_2020 | 249 |
| 673 | 3300053140 | Ga0500573_0000004 | Ga0500573_0000004_270792_271697 | 249 |
| 674 | 3300053727 | Ga0500611_003038 | Ga0500611_003038_833_1597 | 249 |
| 675 | 3300053730 | Ga0500645_000002 | Ga0500645_000002_285325_286074 | 249 |
| 676 | 3300054114 | Ga0501084_0006391 | Ga0501084_0006391_8762_9520 | 249 |
| 677 | 3300060353 | Ga0501082_0251933 | Ga0501082_0251933_479_1237 | 249 |
| 678 | 3300061719 | Ga0466962_0104017 | Ga0466962_0104017_503_1252 | 249 |
| 679 | iso_pu_bacteria | 2643221622 | 2644128239 | 249 |
| 680 | iso_pu_bacteria | 2818991435 | 2819536927 | 249 |
| 681 | iso_pu_bacteria | 2818991454 | 2819645178 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5end-assembly1.cif.gz_B-2 | crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(q152a) from vibrio cholerae | 0.9556 | 8 | 246 |
| 4wk6-assembly1.cif.gz_D | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph | 0.9547 | 8 | 246 |
| 1uls-assembly1.cif.gz_A | crystal structure of tt0140 from thermus thermophilus hb8 | 0.9505 | 7 | 247 |
| 3f9i-assembly1.cif.gz_A-2 | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9499 | 8 | 249 |
| 4ure-assembly1.cif.gz_A | molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 | 0.948 | 9 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4urfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9489 | 8 | 246 | 3.40.50.720 |
| 5h5xG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9487 | 3 | 249 | 3.40.50.720 |
| 4ni5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9426 | 7 | 247 | 3.40.50.720 |
| 4wecC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9403 | 7 | 249 | 3.40.50.720 |
| af_Q54PL1_17_278_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9382 | 6 | 246 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520I1R1-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9679 | 1 | 171 |
GO:0016616
GO:0030497 |
| AF-G6YHQ1-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9667 | 4 | 249 |
GO:0016616
GO:0030497 |
| AF-A0A1I3T2W7-F1-model_v4 | 3-oxoacyl-[acyl-carrier protein] reductase | 0.9611 | 9 | 249 |
GO:0016491
|
| AF-A0A1Q3QWK2-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9597 | 9 | 249 |
GO:0016616
GO:0030497 |
| AF-A0A1X7M7R7-F1-model_v4 | 3-oxoacyl-[acyl-carrier protein] reductase | 0.9594 | 9 | 249 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar