F474872

General Info

Members Datasets Scaffolds Average Seq Length
681 350 654 253

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0000004|Ga0500573_0000004_270792_271697
Length 301
Sequence LIWFFQHEFEGRLSDHIEASRHSSSGVDTDTRNAGAQPVRRAQTPASQNQDGVGFFAGRFSGRAAVVTGGASGLGFLTAERIVKEGGTVSLWDINEASLNVAAQKLGGVHTHKVHVGRHPDVADAARKSLEALGKIDVLVNCAGITGATVPVQDFPVDNWLQVMDVNLNGIFYCCREVVPAMLAQGYGRIVNIASVAGKEGNPKASAYSASKAGVIGFTKSLGKELATSGILVNCITPATFESPILDQLPQSQIDYMRSRIPMGRLGHAEECAALVCWLASQECSFSTAATFDISGGRTTY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
7 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
8 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
9 2818991435 Caulobacter henricii 536 Isolate Unclassified
10 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
11 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
12 2849560528 Caulobacter zeae 410 Isolate Unclassified
13 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
14 2851153111 Caulobacter radicis 736 Isolate Unclassified
15 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
16 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
17 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
18 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
19 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
20 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
21 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
22 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
23 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
29 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
30 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
31 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
32 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
33 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
34 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
226 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
227 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
228 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
229 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
232 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
233 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
234 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
301 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
330 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
331 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
332 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
333 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
334 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
335 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
336 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
337 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
338 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
343 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
344 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
345 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
346 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
347 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 0
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 10.28
Nodule 0.15
Rhizoplane 2.06
Rhizosphere 78.85
Stem 0
Stem Tuber 0
Unclassified 8.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_290893 2162886007 Bacteria 3591
2 JGI24736J21556_1000900 3300001904 Bacteria 5490
3 JGI24741J21665_1000596 3300001915 Bacteria 10951
4 JGI24740J21852_10000043 3300001979 Bacteria 41252
5 JGI24740J21852_10000580 3300001979 Bacteria 15718
6 JGI24739J22299_10028024 3300001989 Bacteria 1966
7 JGI24737J22298_10000054 3300001990 Bacteria 33923
8 JGI24737J22298_10000952 3300001990 Bacteria 10265
9 JGI24737J22298_10031451 3300001990 Bacteria 1657
10 JGI24735J21928_10002076 3300002067 Bacteria 7062
11 JGI24735J21928_10008827 3300002067 Bacteria 3251
12 JGI24735J21928_10012443 3300002067 Bacteria 2689
13 JGI24750J21931_1000088 3300002070 Bacteria 13881
14 JGI24748J21848_1000065 3300002074 Bacteria 40176
15 JGI24738J21930_10012066 3300002075 Bacteria 1890
16 JGI24749J21850_1003606 3300002076 Bacteria 2163
17 JGI24034J26672_10000008 3300002239 Bacteria 200986
18 JGI24742J22300_10010079 3300002244 Bacteria 1561
19 JGI24751J29686_10001254 3300002459 Bacteria 5362
20 JGI25150J39212_1000472 3300002774 Bacteria 17386
21 JGI25151J46595_10028399 3300003187 Bacteria 2229
22 JGI25153J46596_10000038 3300003215 Bacteria 178190
23 JGI25153J46596_10020495 3300003215 Bacteria 2498
24 rootH1_10001301 3300003323 Bacteria 5199
25 rootH1_10064589 3300003323 Bacteria 2704
26 Ga0055529_1000014 3300003763 Bacteria 367283
27 Ga0055524_1000598 3300003775 Bacteria 26071
28 Ga0055536_1003677 3300003781 Bacteria 8154
29 Ga0055530_10000131 3300003791 Bacteria 65535
30 Ga0055530_10002644 3300003791 Bacteria 11209
31 Ga0055530_10011719 3300003791 Bacteria 3124
32 Ga0055531_10000617 3300003794 Bacteria 30689
33 Ga0055531_10016551 3300003794 Bacteria 3173
34 Ga0065165_1000906 3300005262 Bacteria 38225
35 Ga0065165_1006868 3300005262 Bacteria 5788
36 Ga0065704_10001326 3300005289 Bacteria 14211
37 Ga0070658_10001045 3300005327 Bacteria 23669
38 Ga0070658_10066526 3300005327 Bacteria 2944
39 Ga0070658_10220152 3300005327 Bacteria 1605
40 Ga0070676_10000469 3300005328 Bacteria 19353
41 Ga0070676_10091733 3300005328 Bacteria 1862
42 Ga0070676_10616292 3300005328 Bacteria 784
43 Ga0070683_100021868 3300005329 Bacteria 5710
44 Ga0070683_100123397 3300005329 Bacteria 2448
45 Ga0070683_100321491 3300005329 Bacteria 1473
46 Ga0070690_100000006 3300005330 Bacteria 132992
47 Ga0070690_100090469 3300005330 Bacteria 2015
48 Ga0070670_100022090 3300005331 Bacteria 5477
49 Ga0070670_100085356 3300005331 Bacteria 2712
50 Ga0070677_10024855 3300005333 Bacteria 2231
51 Ga0068869_100003327 3300005334 Bacteria 9820
52 Ga0070666_10000004 3300005335 Bacteria 372098
53 Ga0070680_100000337 3300005336 Bacteria 31413
54 Ga0070680_100213456 3300005336 Bacteria 1628
55 Ga0070680_100279561 3300005336 Bacteria 1414
56 Ga0068868_100000228 3300005338 Bacteria 38192
57 Ga0068868_100018762 3300005338 Bacteria 5174
58 Ga0068868_100021029 3300005338 Bacteria 4912
59 Ga0068868_100491033 3300005338 Bacteria 1074
60 Ga0070660_100015201 3300005339 Bacteria 5552
61 Ga0070660_100128642 3300005339 Bacteria 2025
62 Ga0070689_100003505 3300005340 Bacteria 10439
63 Ga0070689_100146496 3300005340 Bacteria 1902
64 Ga0070661_100000754 3300005344 Bacteria 23327
65 Ga0070661_100034420 3300005344 Bacteria 3673
66 Ga0070661_100090366 3300005344 Bacteria 2268
67 Ga0070668_100062113 3300005347 Bacteria 2894
68 Ga0070668_100721845 3300005347 Bacteria 880
69 Ga0070668_100887166 3300005347 Bacteria 796
70 Ga0070669_100000183 3300005353 Bacteria 54573
71 Ga0070669_100171483 3300005353 Bacteria 1692
72 Ga0070675_100087864 3300005354 Bacteria 2600
73 Ga0070675_100215307 3300005354 Bacteria 1671
74 Ga0070674_100000446 3300005356 Bacteria 20838
75 Ga0070674_100000533 3300005356 Bacteria 19178
76 Ga0070673_100000011 3300005364 Bacteria 145332
77 Ga0070673_100155276 3300005364 Bacteria 1942
78 Ga0070688_100000425 3300005365 Bacteria 21388
79 Ga0070688_100182617 3300005365 Bacteria 1456
80 Ga0070659_100038286 3300005366 Bacteria 3739
81 Ga0070659_100691089 3300005366 Bacteria 882
82 Ga0070667_100051825 3300005367 Bacteria 3461
83 Ga0070667_100384848 3300005367 Bacteria 1274
84 Ga0070663_100000513 3300005455 Bacteria 20457
85 Ga0070663_100002383 3300005455 Bacteria 10566
86 Ga0070678_100002168 3300005456 Bacteria 10661
87 Ga0070678_100034974 3300005456 Bacteria 3503
88 Ga0070678_100154879 3300005456 Bacteria 1850
89 Ga0070662_100001493 3300005457 Bacteria 14389
90 Ga0070662_100411331 3300005457 Bacteria 1118
91 Ga0070681_10180235 3300005458 Bacteria 2034
92 Ga0070681_10453471 3300005458 Bacteria 1195
93 Ga0068867_100002153 3300005459 Bacteria 13818
94 Ga0070685_10000268 3300005466 Bacteria 33580
95 Ga0070685_10055233 3300005466 Bacteria 2307
96 Ga0070679_100065430 3300005530 Bacteria 3624
97 Ga0070679_100113545 3300005530 Bacteria 2694
98 Ga0070684_100061718 3300005535 Bacteria 3281
99 Ga0068853_100046728 3300005539 Bacteria 3713
100 Ga0068853_100056738 3300005539 Unclassified 3378
101 Ga0070672_100038223 3300005543 Bacteria 3666
102 Ga0070686_100000036 3300005544 Bacteria 108117
103 Ga0070665_100000004 3300005548 Bacteria 785500
104 Ga0070665_100000226 3300005548 Bacteria 94176
105 Ga0070665_100000912 3300005548 Bacteria 37939
106 Ga0070665_100023704 3300005548 Bacteria 6181
107 Ga0070665_100024558 3300005548 Bacteria 6072
108 Ga0070665_100074160 3300005548 Bacteria 3408
109 Ga0070665_100074684 3300005548 Bacteria 3396
110 Ga0070665_100202758 3300005548 Bacteria 1984
111 Ga0070665_100363231 3300005548 Bacteria 1454
112 Ga0070665_100520817 3300005548 Bacteria 1201
113 Ga0068855_100019306 3300005563 Bacteria 8190
114 Ga0068855_100065616 3300005563 Bacteria 4232
115 Ga0068855_100083990 3300005563 Bacteria 3688
116 Ga0068855_100133324 3300005563 Bacteria 2835
117 Ga0068855_100329526 3300005563 Unclassified 1686
118 Ga0070664_100007015 3300005564 Bacteria 9091
119 Ga0068857_100067958 3300005577 Bacteria 3172
120 Ga0068854_100007205 3300005578 Bacteria 7100
121 Ga0068854_100024487 3300005578 Bacteria 4133
122 Ga0068854_100173152 3300005578 Bacteria 1681
123 Ga0068856_100089983 3300005614 Bacteria 3053
124 Ga0068852_100117209 3300005616 Bacteria 2431
125 Ga0068852_100279853 3300005616 Bacteria 1608
126 Ga0068859_100006326 3300005617 Bacteria 12011
127 Ga0068864_100000243 3300005618 Bacteria 48752
128 Ga0068864_100370777 3300005618 Bacteria 1355
129 Ga0068861_100001448 3300005719 Bacteria 15011
130 Ga0068851_10014560 3300005834 Bacteria 3736
131 Ga0068870_10223815 3300005840 Bacteria 1153
132 Ga0068870_10324476 3300005840 Bacteria 979
133 Ga0068863_100000013 3300005841 Bacteria 220357
134 Ga0068858_100002184 3300005842 Bacteria 19828
135 Ga0068858_100007209 3300005842 Bacteria 10778
136 Ga0068860_100000009 3300005843 Bacteria 372089
137 Ga0068860_100025256 3300005843 Bacteria 5734
138 Ga0068862_100000029 3300005844 Bacteria 182708
139 Ga0070712_100546858 3300006175 Bacteria 975
140 Ga0075367_10000744 3300006178 Bacteria 12671
141 Ga0097621_100460226 3300006237 Bacteria 1147
142 Ga0075370_10006824 3300006353 Bacteria 5772
143 Ga0075370_10020630 3300006353 Bacteria 3605
144 Ga0075370_10136210 3300006353 Bacteria 1435
145 Ga0068871_100046319 3300006358 Bacteria 3503
146 Ga0068871_100191209 3300006358 Bacteria 1763
147 Ga0068865_100000012 3300006881 Bacteria 145314
148 Ga0068865_100096656 3300006881 Bacteria 2154
149 Ga0068865_100310106 3300006881 Bacteria 1266
150 Ga0097620_100006326 3300006931 Bacteria 12011
151 Ga0079104_1036655 3300006946 Bacteria 1175
152 Ga0105251_10000041 3300009011 Bacteria 115207
153 Ga0105251_10026323 3300009011 Bacteria 2962
154 Ga0105240_10003013 3300009093 Bacteria 26500
155 Ga0105240_10003693 3300009093 Bacteria 23672
156 Ga0105240_10005249 3300009093 Bacteria 19347
157 Ga0105240_10102371 3300009093 Bacteria 3480
158 Ga0105240_10416779 3300009093 Bacteria 1510
159 Ga0105240_10418413 3300009093 Bacteria 1506
160 Ga0105245_10000097 3300009098 Bacteria 84528
161 Ga0105245_10001089 3300009098 Bacteria 24632
162 Ga0105245_10041161 3300009098 Bacteria 4119
163 Ga0105243_10000850 3300009148 Bacteria 28978
164 Ga0105243_10000958 3300009148 Bacteria 26973
165 Ga0105243_10048017 3300009148 Bacteria 3364
166 Ga0105243_10198778 3300009148 Bacteria 1757
167 Ga0105241_10003989 3300009174 Bacteria 10909
168 Ga0105241_10007570 3300009174 Bacteria 7985
169 Ga0105241_10108146 3300009174 Bacteria 2222
170 Ga0105242_10000486 3300009176 Bacteria 31546
171 Ga0105248_10013870 3300009177 Bacteria 8867
172 Ga0105248_10076503 3300009177 Bacteria 3762
173 Ga0105237_10076519 3300009545 Bacteria 3337
174 Ga0105237_10088523 3300009545 Bacteria 3086
175 Ga0105237_10105976 3300009545 Bacteria 2803
176 Ga0105237_10611870 3300009545 Bacteria 1096
177 Ga0105238_10046240 3300009551 Bacteria 4393
178 Ga0105238_10064733 3300009551 Bacteria 3656
179 Ga0105238_10090258 3300009551 Bacteria 3052
180 Ga0105238_10124587 3300009551 Unclassified 2556
181 Ga0105238_10213095 3300009551 Bacteria 1908
182 Ga0105238_10583715 3300009551 Bacteria 1124
183 Ga0105249_10000006 3300009553 Bacteria 354449
184 Ga0105249_10005913 3300009553 Bacteria 10596
185 Ga0105239_10015105 3300010375 Bacteria 8561
186 Ga0105239_10040388 3300010375 Bacteria 5112
187 Ga0105239_10112652 3300010375 Bacteria 3016
188 Ga0105239_10142058 3300010375 Bacteria 2676
189 Ga0105239_10250566 3300010375 Bacteria 1989
190 Ga0105239_10353957 3300010375 Bacteria 1658
191 Ga0105239_10407565 3300010375 Bacteria 1539
192 Ga0105246_10000113 3300011119 Bacteria 36243
193 Ga0105246_10096750 3300011119 Bacteria 2140
194 Ga0157373_10033509 3300013100 Bacteria 3695
195 Ga0157373_10304930 3300013100 Bacteria 1131
196 Ga0157371_10000757 3300013102 Bacteria 37321
197 Ga0157371_10014187 3300013102 Bacteria 6024
198 Ga0157370_10002465 3300013104 Bacteria 22320
199 Ga0157370_10194756 3300013104 Bacteria 1881
200 Ga0157370_10382631 3300013104 Bacteria 1296
201 Ga0157369_10062533 3300013105 Bacteria 4011
202 Ga0157369_10329648 3300013105 Bacteria 1586
203 Ga0157374_10000132 3300013296 Bacteria 68144
204 Ga0157374_10147671 3300013296 Bacteria 2285
205 Ga0157374_10261406 3300013296 Bacteria 1705
206 Ga0157374_10487193 3300013296 Bacteria 1237
207 Ga0157378_10000341 3300013297 Bacteria 45974
208 Ga0157378_10139889 3300013297 Bacteria 2247
209 Ga0157378_10679719 3300013297 Bacteria 1047
210 Ga0163162_10005444 3300013306 Bacteria 12300
211 Ga0163162_10229260 3300013306 Bacteria 1988
212 Ga0163162_10946254 3300013306 Bacteria 973
213 Ga0157372_10001644 3300013307 Bacteria 24283
214 Ga0157372_10019482 3300013307 Bacteria 7315
215 Ga0157375_10000872 3300013308 Bacteria 26252
216 Ga0163163_10000033 3300014325 Bacteria 166801
217 Ga0163163_10003094 3300014325 Bacteria 14108
218 Ga0163163_10015128 3300014325 Bacteria 7121
219 Ga0163163_10119893 3300014325 Bacteria 2664
220 Ga0163163_10692710 3300014325 Bacteria 1082
221 Ga0157380_10000786 3300014326 Bacteria 19924
222 Ga0157380_10021232 3300014326 Bacteria 4867
223 Ga0157380_10278955 3300014326 Bacteria 1528
224 Ga0163161_10000029 3300017792 Bacteria 193416
225 Ga0163161_10009039 3300017792 Bacteria 6891
226 Ga0163161_10020467 3300017792 Bacteria 4642
227 Ga0163161_10056323 3300017792 Bacteria 2855
228 Ga0207672_1001409 3300025223 Bacteria 1884
229 Ga0209147_100748 3300025229 Bacteria 16056
230 Ga0207425_1000016 3300025245 Bacteria 428169
231 Ga0207425_1004891 3300025245 Bacteria 3921
232 Ga0209148_1000011 3300025254 Bacteria 1196503
233 Ga0209129_1002879 3300025258 Bacteria 7931
234 Ga0209455_1000006 3300025272 Bacteria 1196503
235 Ga0209673_1001790 3300025273 Bacteria 17757
236 Ga0209676_1000046 3300025292 Bacteria 409173
237 Ga0209676_1000413 3300025292 Bacteria 76892
238 Ga0209025_1000396 3300025294 Bacteria 89775
239 Ga0209564_1002536 3300025295 Bacteria 14094
240 Ga0209758_1000009 3300025297 Bacteria 1123483
241 Ga0209758_1000995 3300025297 Bacteria 37746
242 Ga0209050_1000057 3300025298 Bacteria 326289
243 Ga0209050_1000347 3300025298 Bacteria 90767
244 Ga0209050_1003694 3300025298 Bacteria 11026
245 Ga0209050_1005329 3300025298 Bacteria 8149
246 Ga0209050_1063271 3300025298 Bacteria 863
247 Ga0209256_1000851 3300025299 Bacteria 38114
248 Ga0209051_1007363 3300025303 Bacteria 6031
249 Ga0209051_1088170 3300025303 Bacteria 872
250 Ga0209257_1000191 3300025304 Bacteria 152659
251 Ga0209257_1000371 3300025304 Bacteria 90767
252 Ga0209257_1000506 3300025304 Bacteria 68402
253 Ga0209257_1001875 3300025304 Bacteria 22766
254 Ga0209257_1005118 3300025304 Bacteria 9497
255 Ga0209257_1012086 3300025304 Bacteria 4049
256 Ga0207697_10023401 3300025315 Bacteria 2529
257 Ga0207656_10070900 3300025321 Bacteria 1548
258 Ga0207713_1000798 3300025735 Bacteria 29158
259 Ga0207713_1025055 3300025735 Bacteria 2763
260 Ga0207682_10013464 3300025893 Bacteria 3187
261 Ga0207688_10310724 3300025901 Bacteria 965
262 Ga0207680_10000010 3300025903 Bacteria 414170
263 Ga0207680_10020755 3300025903 Bacteria 3544
264 Ga0207680_10079100 3300025903 Bacteria 2061
265 Ga0207647_10001047 3300025904 Bacteria 21386
266 Ga0207647_10012153 3300025904 Bacteria 6007
267 Ga0207647_10030584 3300025904 Bacteria 3471
268 Ga0207647_10088389 3300025904 Bacteria 1851
269 Ga0207645_10001643 3300025907 Bacteria 18212
270 Ga0207645_10209951 3300025907 Bacteria 1282
271 Ga0207643_10185251 3300025908 Bacteria 1261
272 Ga0207705_10000718 3300025909 Bacteria 27269
273 Ga0207705_10130675 3300025909 Bacteria 1869
274 Ga0207705_10610569 3300025909 Bacteria 848
275 Ga0207654_10000732 3300025911 Bacteria 18264
276 Ga0207654_10010982 3300025911 Bacteria 4610
277 Ga0207654_10053448 3300025911 Bacteria 2331
278 Ga0207707_10099537 3300025912 Bacteria 2541
279 Ga0207707_10110313 3300025912 Unclassified 2404
280 Ga0207695_10002546 3300025913 Bacteria 26780
281 Ga0207695_10005914 3300025913 Bacteria 16042
282 Ga0207695_10006892 3300025913 Bacteria 14616
283 Ga0207695_10057230 3300025913 Bacteria 4051
284 Ga0207695_10082352 3300025913 Bacteria 3254
285 Ga0207695_10135058 3300025913 Unclassified 2421
286 Ga0207695_10140950 3300025913 Bacteria 2359
287 Ga0207695_10305928 3300025913 Bacteria 1480
288 Ga0207695_10498228 3300025913 Bacteria 1100
289 Ga0207671_10059804 3300025914 Bacteria 2826
290 Ga0207671_10246317 3300025914 Bacteria 1405
291 Ga0207671_10319384 3300025914 Bacteria 1229
292 Ga0207663_10533993 3300025916 Bacteria 915
293 Ga0207660_10004779 3300025917 Bacteria 8810
294 Ga0207660_10006982 3300025917 Bacteria 7313
295 Ga0207660_10105032 3300025917 Unclassified 2116
296 Ga0207657_10011730 3300025919 Bacteria 8682
297 Ga0207657_10362268 3300025919 Bacteria 1143
298 Ga0207649_10000371 3300025920 Bacteria 33543
299 Ga0207649_10378924 3300025920 Bacteria 1054
300 Ga0207652_10052761 3300025921 Bacteria 3491
301 Ga0207652_10324655 3300025921 Bacteria 1390
302 Ga0207681_10000047 3300025923 Bacteria 127446
303 Ga0207681_10015211 3300025923 Bacteria 4798
304 Ga0207681_10209152 3300025923 Bacteria 1503
305 Ga0207694_10018283 3300025924 Bacteria 5297
306 Ga0207694_10135382 3300025924 Bacteria 1978
307 Ga0207650_10019160 3300025925 Bacteria 4808
308 Ga0207650_10318522 3300025925 Bacteria 1273
309 Ga0207659_10164160 3300025926 Bacteria 1746
310 Ga0207659_10177509 3300025926 Bacteria 1685
311 Ga0207687_10000547 3300025927 Bacteria 25260
312 Ga0207687_10013082 3300025927 Bacteria 5423
313 Ga0207687_10017874 3300025927 Bacteria 4678
314 Ga0207687_10036971 3300025927 Bacteria 3329
315 Ga0207644_10018443 3300025931 Bacteria 4720
316 Ga0207690_10001913 3300025932 Bacteria 12788
317 Ga0207690_10042395 3300025932 Bacteria 2988
318 Ga0207706_10002790 3300025933 Bacteria 16968
319 Ga0207686_10000148 3300025934 Bacteria 53751
320 Ga0207686_10517784 3300025934 Bacteria 928
321 Ga0207709_10000059 3300025935 Bacteria 211914
322 Ga0207709_10131149 3300025935 Bacteria 1708
323 Ga0207670_10179692 3300025936 Bacteria 1593
324 Ga0207669_10000749 3300025937 Bacteria 14044
325 Ga0207704_10000021 3300025938 Bacteria 148508
326 Ga0207704_10195215 3300025938 Bacteria 1476
327 Ga0207704_10271374 3300025938 Bacteria 1285
328 Ga0207691_10123002 3300025940 Bacteria 2297
329 Ga0207691_10148038 3300025940 Bacteria 2066
330 Ga0207691_10268732 3300025940 Bacteria 1469
331 Ga0207711_10008674 3300025941 Bacteria 8505
332 Ga0207711_10026097 3300025941 Bacteria 4901
333 Ga0207711_10042948 3300025941 Bacteria 3854
334 Ga0207689_10000686 3300025942 Bacteria 32336
335 Ga0207661_10032090 3300025944 Bacteria 4066
336 Ga0207661_10139228 3300025944 Bacteria 2087
337 Ga0207661_10386573 3300025944 Unclassified 1267
338 Ga0207667_10000006 3300025949 Bacteria 679876
339 Ga0207667_10070960 3300025949 Bacteria 3624
340 Ga0207667_10286854 3300025949 Bacteria 1682
341 Ga0207651_10000012 3300025960 Bacteria 189928
342 Ga0207651_10102163 3300025960 Bacteria 2130
343 Ga0207651_10303634 3300025960 Bacteria 1328
344 Ga0207712_10000014 3300025961 Bacteria 375393
345 Ga0207712_10010198 3300025961 Bacteria 5959
346 Ga0207668_10040020 3300025972 Bacteria 3159
347 Ga0207668_10435408 3300025972 Bacteria 1116
348 Ga0207640_10001209 3300025981 Bacteria 14089
349 Ga0207640_10002063 3300025981 Bacteria 10833
350 Ga0207658_10001340 3300025986 Bacteria 19288
351 Ga0207677_10000058 3300026023 Bacteria 95751
352 Ga0207677_10063621 3300026023 Bacteria 2565
353 Ga0207703_10000613 3300026035 Bacteria 36130
354 Ga0207703_10177650 3300026035 Bacteria 1877
355 Ga0207639_10014822 3300026041 Bacteria 5490
356 Ga0207639_10026520 3300026041 Bacteria 4211
357 Ga0207639_10030031 3300026041 Bacteria 3984
358 Ga0207639_10031910 3300026041 Bacteria 3874
359 Ga0207678_10000545 3300026067 Bacteria 34437
360 Ga0207678_10001731 3300026067 Bacteria 19965
361 Ga0207702_10002024 3300026078 Bacteria 19642
362 Ga0207702_10014590 3300026078 Bacteria 6521
363 Ga0207641_10000116 3300026088 Bacteria 117850
364 Ga0207648_10000051 3300026089 Bacteria 108363
365 Ga0207648_10337674 3300026089 Bacteria 1356
366 Ga0207676_10000331 3300026095 Bacteria 40710
367 Ga0207676_10003373 3300026095 Bacteria 11292
368 Ga0207674_10001654 3300026116 Bacteria 28679
369 Ga0207674_10027324 3300026116 Bacteria 6039
370 Ga0207675_100000262 3300026118 Bacteria 50134
371 Ga0207683_10006818 3300026121 Bacteria 9779
372 Ga0207683_10081300 3300026121 Bacteria 2876
373 Ga0207683_10087307 3300026121 Bacteria 2774
374 Ga0207683_10166382 3300026121 Bacteria 1995
375 Ga0207698_10017674 3300026142 Bacteria 4845
376 Ga0207698_10234617 3300026142 Bacteria 1668
377 Ga0209813_10000077 3300027866 Bacteria 36660
378 Ga0268266_10000002 3300028379 Bacteria 3059047
379 Ga0268266_10000009 3300028379 Bacteria 1097737
380 Ga0268266_10000768 3300028379 Bacteria 42899
381 Ga0268266_10027727 3300028379 Bacteria 4815
382 Ga0268266_10028256 3300028379 Bacteria 4768
383 Ga0268266_10052347 3300028379 Bacteria 3506
384 Ga0268266_10179985 3300028379 Bacteria 1924
385 Ga0268266_10187424 3300028379 Bacteria 1887
386 Ga0268266_10303796 3300028379 Bacteria 1489
387 Ga0268265_10000283 3300028380 Bacteria 57566
388 Ga0268265_10603668 3300028380 Bacteria 1049
389 Ga0268264_10000023 3300028381 Bacteria 471408
390 Ga0268264_10097231 3300028381 Bacteria 2552
391 Ga0265318_10009288 3300028577 Bacteria 4331
392 Ga0265325_10002784 3300031241 Bacteria 11672
393 Ga0265339_10055217 3300031249 Bacteria 2155
394 Ga0265331_10005913 3300031250 Bacteria 7315
395 Ga0265331_10032729 3300031250 Bacteria 2575
396 Ga0265316_10122323 3300031344 Bacteria 1965
397 Ga0307513_10059066 3300031456 Bacteria 4072
398 Ga0307408_100008127 3300031548 Bacteria 6933
399 Ga0265313_10003810 3300031595 Bacteria 11920
400 Ga0265313_10008369 3300031595 Bacteria 6882
401 Ga0265314_10087716 3300031711 Bacteria 2034
402 Ga0265314_10249442 3300031711 Bacteria 1020
403 Ga0307405_10039971 3300031731 Bacteria 2838
404 Ga0307410_10002590 3300031852 Bacteria 8781
405 Ga0307406_10002019 3300031901 Bacteria 11074
406 Ga0307412_10035072 3300031911 Bacteria 3202
407 Ga0307412_10149881 3300031911 Bacteria 1719
408 Ga0307409_100038474 3300031995 Bacteria 3539
409 Ga0307414_10040948 3300032004 Bacteria 3133
410 Ga0307414_10112600 3300032004 Bacteria 2075
411 Ga0307414_10114496 3300032004 Bacteria 2060
412 Ga0307414_10363185 3300032004 Bacteria 1246
413 Ga0307415_100265599 3300032126 Bacteria 1403
414 Ga0373936_0247516 3300035113 Bacteria 795
415 Ga0373943_0147357 3300035170 Bacteria 1273
416 Ga0373955_0058693 3300035172 Bacteria 2118
417 Ga0373935_0273237 3300035692 Bacteria 1188
418 Ga0395899_0000674 3300037312 Bacteria 34563
419 Ga0395900_0000075 3300037418 Bacteria 183525
420 Ga0395900_0121430 3300037418 Bacteria 2680
421 Ga0395898_0000055 3300037466 Bacteria 278557
422 Ga0395898_0235657 3300037466 Bacteria 1745
423 Ga0395905_0000067 3300037471 Bacteria 181887
424 Ga0395901_0000648 3300038443 Bacteria 40227
425 Ga0395901_0064369 3300038443 Bacteria 3817
426 Ga0439439_0044389 3300041406 Bacteria 1157
427 Ga0439461_0008099 3300041410 Bacteria 1877
428 Ga0451800_1383254 3300041459 Bacteria 1354
429 Ga0451841_1047927 3300041498 Bacteria 1115
430 Ga0439431_0007189 3300041997 Bacteria 2480
431 Ga0439443_009276 3300042003 Bacteria 1408
432 Ga0439445_0019503 3300042004 Bacteria 1691
433 Ga0439448_0029180 3300042005 Bacteria 1745
434 Ga0439452_020802 3300042010 Bacteria 1717
435 Ga0439455_0000718 3300042012 Bacteria 4916
436 Ga0439462_0067201 3300042015 Bacteria 972
437 Ga0439458_0000567 3300042157 Bacteria 9515
438 Ga0439435_0004964 3300042436 Bacteria 2897
439 Ga0466966_0310567 3300044684 Bacteria 948
440 Ga0466963_0300141 3300044694 Bacteria 1130
441 Ga0466968_0021934 3300044735 Bacteria 2590
442 Ga0466957_0086150 3300044842 Bacteria 1963
443 Ga0466959_0245630 3300045049 Bacteria 1235
444 Ga0451576_0877091 3300045051 Bacteria 942
445 Ga0466967_0111054 3300045976 Bacteria 2519
446 Ga0466967_0388609 3300045976 Bacteria 1356
447 Ga0495627_000260 3300046453 Bacteria 54170
448 Ga0495627_000295 3300046453 Bacteria 49392
449 Ga0495638_0012858 3300046460 Bacteria 5719
450 Ga0495653_0407100 3300046463 Bacteria 863
451 Ga0495650_0001200 3300046471 Bacteria 27305
452 Ga0495584_0048051 3300046491 Bacteria 2152
453 Ga0495585_0193727 3300046492 Bacteria 1038
454 Ga0495607_0038043 3300046501 Bacteria 2885
455 Ga0495583_0000023 3300046506 Bacteria 280019
456 Ga0495583_0000087 3300046506 Bacteria 164974
457 Ga0495583_0014188 3300046506 Bacteria 4407
458 Ga0495583_0025567 3300046506 Bacteria 2947
459 Ga0495583_0096401 3300046506 Bacteria 1267
460 Ga0495610_0000034 3300046512 Bacteria 201408
461 Ga0495610_0000102 3300046512 Bacteria 98985
462 Ga0495610_0101354 3300046512 Bacteria 1289
463 Ga0495620_0052963 3300046515 Bacteria 1720
464 Ga0495631_0130961 3300046518 Bacteria 1078
465 Ga0495632_0000013 3300046519 Bacteria 247879
466 Ga0495632_0000918 3300046519 Bacteria 25891
467 Ga0495632_0083888 3300046519 Bacteria 1517
468 Ga0495637_0000229 3300046520 Bacteria 43471
469 Ga0495637_0010298 3300046520 Bacteria 4529
470 Ga0495637_0150077 3300046520 Bacteria 880
471 Ga0495643_0000010 3300046522 Bacteria 341431
472 Ga0495643_0000434 3300046522 Bacteria 54356
473 Ga0495648_0001360 3300046524 Bacteria 24162
474 Ga0495648_0005640 3300046524 Bacteria 10360
475 Ga0495648_0006463 3300046524 Bacteria 9563
476 Ga0495648_0158220 3300046524 Bacteria 1174
477 Ga0495663_0000004 3300046525 Bacteria 355166
478 Ga0495663_0003013 3300046525 Bacteria 4946
479 Ga0495654_0064020 3300046530 Bacteria 1759
480 Ga0495587_0037590 3300046536 Bacteria 2906
481 Ga0495587_0081093 3300046536 Bacteria 1880
482 Ga0495609_0006670 3300046538 Bacteria 5859
483 Ga0495622_0012205 3300046557 Bacteria 3973
484 Ga0495633_0000092 3300046558 Bacteria 121446
485 Ga0495633_0000427 3300046558 Bacteria 43836
486 Ga0495633_0000765 3300046558 Bacteria 28937
487 Ga0495633_0002661 3300046558 Bacteria 12438
488 Ga0495633_0008652 3300046558 Bacteria 5715
489 Ga0495633_0051812 3300046558 Bacteria 1933
490 Ga0495633_0150453 3300046558 Bacteria 1075
491 Ga0495633_0167776 3300046558 Bacteria 1012
492 Ga0495667_0270410 3300046559 Bacteria 1080
493 Ga0495668_0000016 3300046616 Bacteria 438197
494 Ga0495611_0035397 3300046648 Bacteria 2212
495 Ga0495611_0135451 3300046648 Bacteria 1150
496 Ga0495611_0234590 3300046648 Bacteria 852
497 Ga0495625_0000106 3300046660 Bacteria 125985
498 Ga0495625_0048616 3300046660 Bacteria 3053
499 Ga0495669_0000052 3300046684 Bacteria 79328
500 Ga0495670_0004750 3300046691 Bacteria 6673
501 Ga0495670_0030902 3300046691 Bacteria 2661
502 Ga0495670_0066077 3300046691 Bacteria 1824
503 Ga0495671_0000014 3300046692 Bacteria 341431
504 Ga0495671_0000042 3300046692 Bacteria 165201
505 Ga0495671_0024350 3300046692 Bacteria 3153
506 Ga0495671_0258742 3300046692 Bacteria 840
507 Ga0495649_0005210 3300046694 Bacteria 8320
508 Ga0495660_0001451 3300046810 Bacteria 16207
509 Ga0495636_0016743 3300047318 Bacteria 2931
510 Ga0495672_0063688 3300047320 Bacteria 2115
511 Ga0495683_0007315 3300047323 Bacteria 5984
512 Ga0495683_0016176 3300047323 Bacteria 3874
513 Ga0495687_000068 3300047443 Bacteria 161081
514 Ga0495687_000335 3300047443 Bacteria 60311
515 Ga0495675_0187475 3300047444 Bacteria 1264
516 Ga0495677_0133457 3300047445 Bacteria 951
517 Ga0495673_0000111 3300047469 Bacteria 164974
518 Ga0495673_0080399 3300047469 Bacteria 1351
519 Ga0495681_0000049 3300047470 Bacteria 109650
520 Ga0495681_0000104 3300047470 Bacteria 74261
521 Ga0495681_0001853 3300047470 Bacteria 15548
522 Ga0495686_0001248 3300047472 Bacteria 28936
523 Ga0495686_0024028 3300047472 Bacteria 4009
524 Ga0495686_0062797 3300047472 Bacteria 2303
525 Ga0495602_0051585 3300048088 Bacteria 3662
526 Ga0496104_0008454 3300048907 Bacteria 9151
527 Ga0496104_0046791 3300048907 Bacteria 4075
528 Ga0496104_0051009 3300048907 Bacteria 3904
529 Ga0496105_0003263 3300048908 Bacteria 11954
530 Ga0496105_0010189 3300048908 Bacteria 7386
531 Ga0496105_0078474 3300048908 Bacteria 2726
532 Ga0496110_0084811 3300048913 Bacteria 2828
533 Ga0496110_0108041 3300048913 Bacteria 2498
534 Ga0496111_0015746 3300048914 Bacteria 5200
535 Ga0496111_0073449 3300048914 Bacteria 2491
536 Ga0496115_0001186 3300048918 Bacteria 18684
537 Ga0496115_0082816 3300048918 Bacteria 2614
538 Ga0496116_0011033 3300048919 Bacteria 7515
539 Ga0496116_0029623 3300048919 Bacteria 3943
540 Ga0496116_0071550 3300048919 Bacteria 2195
541 Ga0496116_0200504 3300048919 Bacteria 1045
542 Ga0496117_0001833 3300048920 Bacteria 28776
543 Ga0496117_0008474 3300048920 Bacteria 9761
544 Ga0496117_0009240 3300048920 Bacteria 9217
545 Ga0496117_0070508 3300048920 Bacteria 2347
546 Ga0496118_0004463 3300048921 Bacteria 16596
547 Ga0496118_0006864 3300048921 Bacteria 12334
548 Ga0496118_0009510 3300048921 Bacteria 9797
549 Ga0496118_0011452 3300048921 Bacteria 8655
550 Ga0496119_0000140 3300048922 Bacteria 101373
551 Ga0496119_0045445 3300048922 Bacteria 2753
552 Ga0496120_0000011 3300048923 Bacteria 365549
553 Ga0496120_0110363 3300048923 Bacteria 1438
554 Ga0496121_0000112 3300048924 Bacteria 183480
555 Ga0496121_0000170 3300048924 Bacteria 144547
556 Ga0496121_0000734 3300048924 Bacteria 60436
557 Ga0496121_0000997 3300048924 Bacteria 50601
558 Ga0496121_0044825 3300048924 Bacteria 3809
559 Ga0496121_0210174 3300048924 Bacteria 1379
560 Ga0496122_0000253 3300048925 Bacteria 120534
561 Ga0496122_0001355 3300048925 Bacteria 39961
562 Ga0496122_0074202 3300048925 Bacteria 2408
563 Ga0496123_0000206 3300048926 Bacteria 120598
564 Ga0496123_0002426 3300048926 Bacteria 23191
565 Ga0496123_0167173 3300048926 Bacteria 1165
566 Ga0496124_0000148 3300048927 Bacteria 144782
567 Ga0496124_0009107 3300048927 Bacteria 10264
568 Ga0496124_0057234 3300048927 Bacteria 3286
569 Ga0496124_0151453 3300048927 Bacteria 1818
570 Ga0496124_0174671 3300048927 Bacteria 1660
571 Ga0496125_0000387 3300048928 Bacteria 82001
572 Ga0496125_0025013 3300048928 Bacteria 5478
573 Ga0496126_0003603 3300048929 Bacteria 19386
574 Ga0496126_0047094 3300048929 Bacteria 3949
575 Ga0496126_0051469 3300048929 Bacteria 3749
576 Ga0496126_0097037 3300048929 Bacteria 2583
577 Ga0496126_0150433 3300048929 Unclassified 1996
578 Ga0496126_0164775 3300048929 Bacteria 1892
579 Ga0495678_106501 3300049459 Bacteria 963
580 Ga0495682_0008927 3300049460 Bacteria 3932
581 Ga0501031_0027991 3300049568 Bacteria 3673
582 Ga0501032_0005428 3300049569 Bacteria 9471
583 Ga0501033_0004813 3300049570 Bacteria 10785
584 Ga0501033_0008295 3300049570 Bacteria 8047
585 Ga0501033_0020152 3300049570 Bacteria 5042
586 Ga0501033_0062110 3300049570 Bacteria 2751
587 Ga0501034_0003706 3300049571 Bacteria 17261
588 Ga0501034_0004672 3300049571 Bacteria 15163
589 Ga0501034_0236105 3300049571 Bacteria 1776
590 Ga0501036_0000882 3300049572 Bacteria 22405
591 Ga0501038_0186271 3300049574 Bacteria 1672
592 Ga0501039_0002562 3300049575 Bacteria 13562
593 Ga0501040_0002512 3300049576 Bacteria 11813
594 Ga0501042_0013815 3300049578 Bacteria 5500
595 Ga0501042_0059481 3300049578 Bacteria 2728
596 Ga0501043_0059164 3300049579 Bacteria 3007
597 Ga0501043_0101116 3300049579 Bacteria 2266
598 Ga0501046_0004326 3300049580 Bacteria 12928
599 Ga0501047_0001026 3300049581 Bacteria 28057
600 Ga0501047_0006093 3300049581 Bacteria 11334
601 Ga0501047_0010083 3300049581 Bacteria 8932
602 Ga0501047_0040118 3300049581 Bacteria 4528
603 Ga0501047_0185553 3300049581 Bacteria 1945
604 Ga0501047_0254683 3300049581 Bacteria 1604
605 Ga0501047_0324529 3300049581 Bacteria 1379
606 Ga0501067_0021187 3300049583 Bacteria 3596
607 Ga0501068_0037223 3300049584 Bacteria 2913
608 Ga0501069_0138890 3300049585 Bacteria 1393
609 Ga0501070_0027633 3300049586 Bacteria 4759
610 Ga0501073_0002008 3300049589 Bacteria 15184
611 Ga0501073_0187084 3300049589 Bacteria 1433
612 Ga0501073_0293637 3300049589 Bacteria 1121
613 Ga0501076_0626278 3300049592 Bacteria 888
614 Ga0501238_000094 3300049671 Bacteria 14176
615 Ga0501079_0009177 3300049741 Bacteria 7490
616 Ga0501080_0067296 3300049742 Bacteria 3331
617 Ga0501080_0304856 3300049742 Bacteria 1444
618 Ga0501080_0506773 3300049742 Bacteria 1078
619 Ga0501083_0013559 3300049744 Bacteria 5699
620 Ga0501035_0277499 3300049822 Bacteria 1417
621 Ga0501044_0000796 3300049823 Bacteria 38157
622 Ga0501044_0000921 3300049823 Bacteria 35420
623 Ga0501044_0025454 3300049823 Bacteria 6272
624 Ga0501044_0081857 3300049823 Bacteria 3267
625 Ga0501044_0088160 3300049823 Bacteria 3133
626 Ga0501044_0124384 3300049823 Bacteria 2577
627 Ga0501044_0136781 3300049823 Bacteria 2441
628 nmdc:mga06z11_90_c1 3300050494 Bacteria 38500
629 nmdc:mga04h51_299_c1 3300050495 Bacteria 12655
630 nmdc:mga07m45_35718_c1 3300050496 Bacteria 2765
631 Ga0500610_0000131 3300053079 Bacteria 22564
632 Ga0500635_0021268 3300053080 Bacteria 1997
633 Ga0500651_0009693 3300053093 Bacteria 5740
634 Ga0500566_0000347 3300053094 Bacteria 25160
635 Ga0500641_0013243 3300053096 Bacteria 3028
636 Ga0500555_000042 3300053103 Bacteria 65300
637 Ga0500556_0000128 3300053104 Bacteria 65099
638 Ga0500594_0001896 3300053118 Bacteria 4524
639 Ga0500626_027420 3300053128 Bacteria 2567
640 Ga0500642_0000599 3300053130 Bacteria 10789
641 Ga0500658_0000477 3300053134 Bacteria 17107
642 Ga0500559_0002516 3300053136 Bacteria 9415
643 Ga0500559_0008943 3300053136 Bacteria 4359
644 Ga0500559_0039329 3300053136 Bacteria 2057
645 Ga0500568_0000345 3300053139 Bacteria 36283
646 Ga0500573_0000004 3300053140 Bacteria 341236
647 Ga0500616_0000119 3300053153 Bacteria 143264
648 Ga0500624_000107 3300053157 Bacteria 39921
649 Ga0500637_0111301 3300053178 Bacteria 1588
650 Ga0500611_003038 3300053727 Bacteria 2098
651 Ga0500645_000002 3300053730 Bacteria 388892
652 Ga0501084_0006391 3300054114 Bacteria 9684
653 Ga0501082_0251933 3300060353 Bacteria 1536
654 Ga0466962_0104017 3300061719 Bacteria 1364

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100215307 Ga0070675_1002153072 233
2 3300005456 Ga0070678_100154879 Ga0070678_1001548791 233
3 3300006237 Ga0097621_100460226 Ga0097621_1004602261 233
4 3300006881 Ga0068865_100096656 Ga0068865_1000966562 233
5 3300009098 Ga0105245_10041161 Ga0105245_100411612 233
6 3300013296 Ga0157374_10487193 Ga0157374_104871932 233
7 3300025926 Ga0207659_10177509 Ga0207659_101775092 233
8 3300025927 Ga0207687_10017874 Ga0207687_100178742 233
9 3300025938 Ga0207704_10195215 Ga0207704_101952151 233
10 3300025940 Ga0207691_10148038 Ga0207691_101480382 233
11 3300025960 Ga0207651_10102163 Ga0207651_101021632 233
12 3300026121 Ga0207683_10166382 Ga0207683_101663822 233
13 3300042003 Ga0439443_009276 Ga0439443_009276_573_1328 236
14 3300048929 Ga0496126_0164775 Ga0496126_0164775_1082_1837 237
15 3300049576 Ga0501040_0002512 Ga0501040_0002512_6193_6963 237
16 3300049578 Ga0501042_0059481 Ga0501042_0059481_1708_2478 237
17 3300006353 Ga0075370_10136210 Ga0075370_101362101 240
18 3300025304 Ga0209257_1000506 Ga0209257_10005065 241
19 3300035170 Ga0373943_0147357 Ga0373943_0147357_58_792 241
20 3300046501 Ga0495607_0038043 Ga0495607_0038043_2085_2834 241
21 3300046506 Ga0495583_0000087 Ga0495583_0000087_8760_9509 241
22 3300046519 Ga0495632_0000918 Ga0495632_0000918_491_1240 241
23 3300046558 Ga0495633_0008652 Ga0495633_0008652_4481_5230 241
24 3300046692 Ga0495671_0000042 Ga0495671_0000042_8987_9736 241
25 3300047469 Ga0495673_0000111 Ga0495673_0000111_155466_156215 241
26 3300003215 JGI25153J46596_10020495 JGI25153J46596_100204952 242
27 3300005548 Ga0070665_100000226 Ga0070665_10000022692 242
28 3300005840 Ga0068870_10223815 Ga0068870_102238152 242
29 3300025245 Ga0207425_1004891 Ga0207425_10048914 242
30 3300025297 Ga0209758_1000995 Ga0209758_100099519 242
31 3300028379 Ga0268266_10000002 Ga0268266_100000022885 242
32 3300049671 Ga0501238_000094 Ga0501238_000094_6684_7436 242
33 3300053136 Ga0500559_0002516 Ga0500559_0002516_7568_8332 242
34 iso_pu_bacteria 2582581280 2585155377 242
35 iso_pu_bacteria 2582581280 2585155612 242
36 iso_pu_bacteria 2582581293 2585198941 242
37 iso_pu_bacteria 2582581293 2585199378 242
38 3300005539 Ga0068853_100046728 Ga0068853_1000467284 243
39 3300005548 Ga0070665_100520817 Ga0070665_1005208171 243
40 3300026041 Ga0207639_10026520 Ga0207639_100265202 243
41 3300001979 JGI24740J21852_10000043 JGI24740J21852_1000004335 244
42 3300005344 Ga0070661_100090366 Ga0070661_1000903662 244
43 3300005455 Ga0070663_100000513 Ga0070663_1000005134 244
44 3300025920 Ga0207649_10378924 Ga0207649_103789242 244
45 3300026067 Ga0207678_10001731 Ga0207678_1000173116 244
46 3300031250 Ga0265331_10032729 Ga0265331_100327293 244
47 3300042436 Ga0439435_0004964 Ga0439435_0004964_1055_1810 244
48 iso_pu_bacteria 2830075706 2830077990 244
49 3300005328 Ga0070676_10000469 Ga0070676_1000046912 245
50 3300005334 Ga0068869_100003327 Ga0068869_1000033274 245
51 3300005338 Ga0068868_100000228 Ga0068868_1000002285 245
52 3300005364 Ga0070673_100000011 Ga0070673_10000001173 245
53 3300005459 Ga0068867_100002153 Ga0068867_1000021535 245
54 3300006881 Ga0068865_100000012 Ga0068865_10000001251 245
55 3300009098 Ga0105245_10000097 Ga0105245_1000009751 245
56 3300009148 Ga0105243_10000958 Ga0105243_1000095814 245
57 3300009176 Ga0105242_10000486 Ga0105242_100004868 245
58 3300011119 Ga0105246_10000113 Ga0105246_1000011313 245
59 3300013296 Ga0157374_10000132 Ga0157374_1000013234 245
60 3300013297 Ga0157378_10000341 Ga0157378_1000034113 245
61 3300013308 Ga0157375_10000872 Ga0157375_1000087211 245
62 3300025907 Ga0207645_10001643 Ga0207645_100016433 245
63 3300025927 Ga0207687_10013082 Ga0207687_100130823 245
64 3300025934 Ga0207686_10000148 Ga0207686_1000014828 245
65 3300025938 Ga0207704_10000021 Ga0207704_1000002173 245
66 3300025942 Ga0207689_10000686 Ga0207689_1000068613 245
67 3300025960 Ga0207651_10000012 Ga0207651_1000001249 245
68 3300026023 Ga0207677_10000058 Ga0207677_1000005849 245
69 3300026089 Ga0207648_10000051 Ga0207648_1000005120 245
70 iso_pu_bacteria 2512564014 2512643255 245
71 iso_pu_bacteria 2524023250 2524613865 245
72 iso_pu_bacteria 2599185354 2600203255 245
73 iso_pu_bacteria 2751185897 2753766781 245
74 iso_pu_bacteria 2849560528 2849560733 245
75 iso_pu_bacteria 2849573788 2849574254 245
76 iso_pu_bacteria 2851153111 2851158120 245
77 iso_pu_bacteria 2928027323 2928028101 245
78 iso_pu_bacteria 2928972540 2928973689 245
79 iso_pu_bacteria 2941485952 2941489154 245
80 iso_pu_bacteria 2977240413 2977241356 245
81 iso_pu_bacteria 2984555340 2984558430 245
82 iso_pu_bacteria 2984564862 2984567163 245
83 iso_pu_bacteria 2993356040 2993358254 245
84 3300013104 Ga0157370_10382631 Ga0157370_103826311 246
85 iso_pu_bacteria 2818991435 2819539566 246
86 iso_pu_bacteria 2818991454 2819648774 246
87 iso_pu_bacteria 2851153111 2851156501 246
88 3300002067 JGI24735J21928_10008827 JGI24735J21928_100088273 247
89 3300005329 Ga0070683_100021868 Ga0070683_1000218682 247
90 3300005336 Ga0070680_100213456 Ga0070680_1002134562 247
91 3300005347 Ga0070668_100721845 Ga0070668_1007218451 247
92 3300005548 Ga0070665_100000912 Ga0070665_10000091222 247
93 3300005548 Ga0070665_100074684 Ga0070665_1000746842 247
94 3300005618 Ga0068864_100000243 Ga0068864_10000024325 247
95 3300005842 Ga0068858_100002184 Ga0068858_10000218422 247
96 3300009177 Ga0105248_10076503 Ga0105248_100765033 247
97 3300013306 Ga0163162_10005444 Ga0163162_100054444 247
98 3300014325 Ga0163163_10119893 Ga0163163_101198932 247
99 3300025315 Ga0207697_10023401 Ga0207697_100234013 247
100 3300025914 Ga0207671_10319384 Ga0207671_103193842 247
101 3300025917 Ga0207660_10006982 Ga0207660_100069826 247
102 3300025941 Ga0207711_10026097 Ga0207711_100260973 247
103 3300025944 Ga0207661_10032090 Ga0207661_100320903 247
104 3300026035 Ga0207703_10177650 Ga0207703_101776501 247
105 3300026095 Ga0207676_10000331 Ga0207676_1000033129 247
106 3300028379 Ga0268266_10000768 Ga0268266_100007686 247
107 3300028379 Ga0268266_10052347 Ga0268266_100523472 247
108 3300031250 Ga0265331_10005913 Ga0265331_100059136 247
109 3300032126 Ga0307415_100265599 Ga0307415_1002655992 247
110 3300045051 Ga0451576_0877091 Ga0451576_0877091_83_826 247
111 3300046453 Ga0495627_000260 Ga0495627_000260_15545_16288 247
112 3300046471 Ga0495650_0001200 Ga0495650_0001200_11016_11759 247
113 3300046559 Ga0495667_0270410 Ga0495667_0270410_282_1025 247
114 3300047470 Ga0495681_0000049 Ga0495681_0000049_93363_94106 247
115 3300048924 Ga0496121_0000170 Ga0496121_0000170_56150_56893 247
116 3300048929 Ga0496126_0003603 Ga0496126_0003603_1168_1911 247
117 3300049592 Ga0501076_0626278 Ga0501076_0626278_124_867 247
118 3300053178 Ga0500637_0111301 Ga0500637_0111301_341_1087 247
119 3300001990 JGI24737J22298_10031451 JGI24737J22298_100314512 248
120 3300002067 JGI24735J21928_10012443 JGI24735J21928_100124433 248
121 3300002070 JGI24750J21931_1000088 JGI24750J21931_100008811 248
122 3300002074 JGI24748J21848_1000065 JGI24748J21848_100006540 248
123 3300002076 JGI24749J21850_1003606 JGI24749J21850_10036062 248
124 3300002239 JGI24034J26672_10000008 JGI24034J26672_10000008201 248
125 3300002459 JGI24751J29686_10001254 JGI24751J29686_100012544 248
126 3300005330 Ga0070690_100000006 Ga0070690_10000000690 248
127 3300005331 Ga0070670_100085356 Ga0070670_1000853562 248
128 3300005335 Ga0070666_10000004 Ga0070666_1000000491 248
129 3300005340 Ga0070689_100003505 Ga0070689_1000035056 248
130 3300005353 Ga0070669_100000183 Ga0070669_1000001832 248
131 3300005365 Ga0070688_100000425 Ga0070688_1000004255 248
132 3300005366 Ga0070659_100038286 Ga0070659_1000382863 248
133 3300005466 Ga0070685_10000268 Ga0070685_1000026819 248
134 3300005544 Ga0070686_100000036 Ga0070686_10000003691 248
135 3300005548 Ga0070665_100000004 Ga0070665_100000004467 248
136 3300005617 Ga0068859_100006326 Ga0068859_1000063267 248
137 3300005719 Ga0068861_100001448 Ga0068861_1000014486 248
138 3300005841 Ga0068863_100000013 Ga0068863_10000001314 248
139 3300005842 Ga0068858_100007209 Ga0068858_1000072097 248
140 3300005843 Ga0068860_100000009 Ga0068860_10000000991 248
141 3300005844 Ga0068862_100000029 Ga0068862_100000029102 248
142 3300006353 Ga0075370_10006824 Ga0075370_100068242 248
143 3300006931 Ga0097620_100006326 Ga0097620_1000063267 248
144 3300009177 Ga0105248_10013870 Ga0105248_100138704 248
145 3300009553 Ga0105249_10000006 Ga0105249_10000006273 248
146 3300010375 Ga0105239_10015105 Ga0105239_100151054 248
147 3300013306 Ga0163162_10229260 Ga0163162_102292602 248
148 3300013307 Ga0157372_10019482 Ga0157372_100194826 248
149 3300014325 Ga0163163_10003094 Ga0163163_1000309411 248
150 3300014326 Ga0157380_10000786 Ga0157380_100007866 248
151 3300017792 Ga0163161_10000029 Ga0163161_1000002996 248
152 3300025223 Ga0207672_1001409 Ga0207672_10014092 248
153 3300025903 Ga0207680_10000010 Ga0207680_10000010316 248
154 3300025904 Ga0207647_10012153 Ga0207647_100121533 248
155 3300025909 Ga0207705_10130675 Ga0207705_101306753 248
156 3300025919 Ga0207657_10362268 Ga0207657_103622682 248
157 3300025923 Ga0207681_10000047 Ga0207681_1000004722 248
158 3300025925 Ga0207650_10318522 Ga0207650_103185222 248
159 3300025931 Ga0207644_10018443 Ga0207644_100184433 248
160 3300025932 Ga0207690_10042395 Ga0207690_100423952 248
161 3300025936 Ga0207670_10179692 Ga0207670_101796922 248
162 3300025940 Ga0207691_10268732 Ga0207691_102687322 248
163 3300025941 Ga0207711_10042948 Ga0207711_100429484 248
164 3300025961 Ga0207712_10000014 Ga0207712_1000001491 248
165 3300025986 Ga0207658_10001340 Ga0207658_100013405 248
166 3300026035 Ga0207703_10000613 Ga0207703_1000061311 248
167 3300026088 Ga0207641_10000116 Ga0207641_1000011615 248
168 3300026095 Ga0207676_10003373 Ga0207676_1000337310 248
169 3300026118 Ga0207675_100000262 Ga0207675_10000026223 248
170 3300028379 Ga0268266_10000009 Ga0268266_10000009333 248
171 3300028380 Ga0268265_10000283 Ga0268265_1000028356 248
172 3300028381 Ga0268264_10000023 Ga0268264_10000023274 248
173 3300042005 Ga0439448_0029180 Ga0439448_0029180_914_1660 248
174 3300042012 Ga0439455_0000718 Ga0439455_0000718_109_855 248
175 3300042157 Ga0439458_0000567 Ga0439458_0000567_141_887 248
176 3300046463 Ga0495653_0407100 Ga0495653_0407100_56_802 248
177 3300046558 Ga0495633_0051812 Ga0495633_0051812_205_954 248
178 3300048907 Ga0496104_0051009 Ga0496104_0051009_1799_2554 248
179 3300048908 Ga0496105_0078474 Ga0496105_0078474_1631_2386 248
180 3300048914 Ga0496111_0015746 Ga0496111_0015746_1008_1754 248
181 3300048914 Ga0496111_0073449 Ga0496111_0073449_1521_2276 248
182 3300048919 Ga0496116_0071550 Ga0496116_0071550_433_1188 248
183 3300048920 Ga0496117_0008474 Ga0496117_0008474_873_1628 248
184 3300048921 Ga0496118_0009510 Ga0496118_0009510_1257_2012 248
185 3300048925 Ga0496122_0001355 Ga0496122_0001355_7250_7996 248
186 3300048926 Ga0496123_0002426 Ga0496123_0002426_10621_11367 248
187 3300048927 Ga0496124_0057234 Ga0496124_0057234_1803_2549 248
188 3300049571 Ga0501034_0003706 Ga0501034_0003706_8095_8841 248
189 3300049581 Ga0501047_0254683 Ga0501047_0254683_706_1452 248
190 3300049822 Ga0501035_0277499 Ga0501035_0277499_275_1021 248
191 3300050496 nmdc:mga07m45_35718_c1 nmdc:mga07m45_35718_c1_1488_2234 248
192 3300053139 Ga0500568_0000345 Ga0500568_0000345_14784_15530 248
193 3300053153 Ga0500616_0000119 Ga0500616_0000119_31309_32055 248
194 3300053157 Ga0500624_000107 Ga0500624_000107_29692_30441 248
195 iso_pu_bacteria 2582581293 2585199299 248
196 iso_pu_bacteria 2582581293 2585199560 248
197 2162886007 SwRhRL2b_contig_290893 SwRhRL2b_0021.00003640 249
198 3300001904 JGI24736J21556_1000900 JGI24736J21556_10009006 249
199 3300001915 JGI24741J21665_1000596 JGI24741J21665_10005968 249
200 3300001979 JGI24740J21852_10000580 JGI24740J21852_100005802 249
201 3300001989 JGI24739J22299_10028024 JGI24739J22299_100280242 249
202 3300001990 JGI24737J22298_10000054 JGI24737J22298_1000005427 249
203 3300001990 JGI24737J22298_10000952 JGI24737J22298_100009523 249
204 3300002067 JGI24735J21928_10002076 JGI24735J21928_100020766 249
205 3300002075 JGI24738J21930_10012066 JGI24738J21930_100120661 249
206 3300002244 JGI24742J22300_10010079 JGI24742J22300_100100792 249
207 3300002774 JGI25150J39212_1000472 JGI25150J39212_10004722 249
208 3300003187 JGI25151J46595_10028399 JGI25151J46595_100283993 249
209 3300003215 JGI25153J46596_10000038 JGI25153J46596_10000038130 249
210 3300003323 rootH1_10001301 rootH1_100013013 249
211 3300003323 rootH1_10064589 rootH1_100645892 249
212 3300003763 Ga0055529_1000014 Ga0055529_1000014172 249
213 3300003775 Ga0055524_1000598 Ga0055524_10005989 249
214 3300003781 Ga0055536_1003677 Ga0055536_10036773 249
215 3300003791 Ga0055530_10000131 Ga0055530_1000013114 249
216 3300003791 Ga0055530_10002644 Ga0055530_100026448 249
217 3300003791 Ga0055530_10011719 Ga0055530_100117193 249
218 3300003794 Ga0055531_10000617 Ga0055531_1000061714 249
219 3300003794 Ga0055531_10016551 Ga0055531_100165513 249
220 3300005262 Ga0065165_1000906 Ga0065165_100090610 249
221 3300005262 Ga0065165_1006868 Ga0065165_10068683 249
222 3300005289 Ga0065704_10001326 Ga0065704_1000132613 249
223 3300005327 Ga0070658_10001045 Ga0070658_1000104514 249
224 3300005327 Ga0070658_10066526 Ga0070658_100665261 249
225 3300005327 Ga0070658_10220152 Ga0070658_102201522 249
226 3300005328 Ga0070676_10091733 Ga0070676_100917332 249
227 3300005328 Ga0070676_10616292 Ga0070676_106162921 249
228 3300005329 Ga0070683_100123397 Ga0070683_1001233972 249
229 3300005329 Ga0070683_100321491 Ga0070683_1003214912 249
230 3300005330 Ga0070690_100090469 Ga0070690_1000904692 249
231 3300005331 Ga0070670_100022090 Ga0070670_1000220903 249
232 3300005333 Ga0070677_10024855 Ga0070677_100248552 249
233 3300005336 Ga0070680_100000337 Ga0070680_10000033724 249
234 3300005336 Ga0070680_100279561 Ga0070680_1002795612 249
235 3300005338 Ga0068868_100018762 Ga0068868_1000187624 249
236 3300005338 Ga0068868_100021029 Ga0068868_1000210292 249
237 3300005338 Ga0068868_100491033 Ga0068868_1004910331 249
238 3300005339 Ga0070660_100015201 Ga0070660_1000152014 249
239 3300005339 Ga0070660_100128642 Ga0070660_1001286422 249
240 3300005340 Ga0070689_100146496 Ga0070689_1001464962 249
241 3300005344 Ga0070661_100000754 Ga0070661_10000075415 249
242 3300005344 Ga0070661_100034420 Ga0070661_1000344203 249
243 3300005347 Ga0070668_100062113 Ga0070668_1000621132 249
244 3300005347 Ga0070668_100887166 Ga0070668_1008871661 249
245 3300005353 Ga0070669_100171483 Ga0070669_1001714831 249
246 3300005354 Ga0070675_100087864 Ga0070675_1000878642 249
247 3300005356 Ga0070674_100000446 Ga0070674_10000044621 249
248 3300005356 Ga0070674_100000533 Ga0070674_10000053314 249
249 3300005364 Ga0070673_100155276 Ga0070673_1001552762 249
250 3300005365 Ga0070688_100182617 Ga0070688_1001826172 249
251 3300005366 Ga0070659_100691089 Ga0070659_1006910891 249
252 3300005367 Ga0070667_100051825 Ga0070667_1000518252 249
253 3300005367 Ga0070667_100384848 Ga0070667_1003848482 249
254 3300005455 Ga0070663_100002383 Ga0070663_1000023837 249
255 3300005456 Ga0070678_100002168 Ga0070678_1000021688 249
256 3300005456 Ga0070678_100034974 Ga0070678_1000349743 249
257 3300005457 Ga0070662_100001493 Ga0070662_1000014933 249
258 3300005457 Ga0070662_100411331 Ga0070662_1004113312 249
259 3300005458 Ga0070681_10180235 Ga0070681_101802352 249
260 3300005458 Ga0070681_10453471 Ga0070681_104534712 249
261 3300005466 Ga0070685_10055233 Ga0070685_100552332 249
262 3300005530 Ga0070679_100065430 Ga0070679_1000654302 249
263 3300005530 Ga0070679_100113545 Ga0070679_1001135452 249
264 3300005535 Ga0070684_100061718 Ga0070684_1000617183 249
265 3300005539 Ga0068853_100056738 Ga0068853_1000567382 249
266 3300005543 Ga0070672_100038223 Ga0070672_1000382233 249
267 3300005548 Ga0070665_100023704 Ga0070665_1000237043 249
268 3300005548 Ga0070665_100024558 Ga0070665_1000245586 249
269 3300005548 Ga0070665_100074160 Ga0070665_1000741602 249
270 3300005548 Ga0070665_100202758 Ga0070665_1002027582 249
271 3300005548 Ga0070665_100363231 Ga0070665_1003632312 249
272 3300005563 Ga0068855_100019306 Ga0068855_1000193062 249
273 3300005563 Ga0068855_100065616 Ga0068855_1000656162 249
274 3300005563 Ga0068855_100083990 Ga0068855_1000839901 249
275 3300005563 Ga0068855_100133324 Ga0068855_1001333241 249
276 3300005563 Ga0068855_100329526 Ga0068855_1003295262 249
277 3300005564 Ga0070664_100007015 Ga0070664_1000070155 249
278 3300005577 Ga0068857_100067958 Ga0068857_1000679582 249
279 3300005578 Ga0068854_100007205 Ga0068854_1000072053 249
280 3300005578 Ga0068854_100024487 Ga0068854_1000244874 249
281 3300005578 Ga0068854_100173152 Ga0068854_1001731522 249
282 3300005614 Ga0068856_100089983 Ga0068856_1000899832 249
283 3300005616 Ga0068852_100117209 Ga0068852_1001172092 249
284 3300005616 Ga0068852_100279853 Ga0068852_1002798532 249
285 3300005618 Ga0068864_100370777 Ga0068864_1003707772 249
286 3300005834 Ga0068851_10014560 Ga0068851_100145604 249
287 3300005840 Ga0068870_10324476 Ga0068870_103244761 249
288 3300005843 Ga0068860_100025256 Ga0068860_1000252563 249
289 3300006175 Ga0070712_100546858 Ga0070712_1005468581 249
290 3300006178 Ga0075367_10000744 Ga0075367_100007446 249
291 3300006353 Ga0075370_10020630 Ga0075370_100206302 249
292 3300006358 Ga0068871_100046319 Ga0068871_1000463192 249
293 3300006358 Ga0068871_100191209 Ga0068871_1001912092 249
294 3300006881 Ga0068865_100310106 Ga0068865_1003101062 249
295 3300006946 Ga0079104_1036655 Ga0079104_10366551 249
296 3300009011 Ga0105251_10000041 Ga0105251_1000004194 249
297 3300009011 Ga0105251_10026323 Ga0105251_100263232 249
298 3300009093 Ga0105240_10003013 Ga0105240_1000301320 249
299 3300009093 Ga0105240_10003693 Ga0105240_1000369321 249
300 3300009093 Ga0105240_10005249 Ga0105240_1000524911 249
301 3300009093 Ga0105240_10102371 Ga0105240_101023712 249
302 3300009093 Ga0105240_10416779 Ga0105240_104167792 249
303 3300009093 Ga0105240_10418413 Ga0105240_104184132 249
304 3300009098 Ga0105245_10001089 Ga0105245_100010897 249
305 3300009148 Ga0105243_10000850 Ga0105243_100008503 249
306 3300009148 Ga0105243_10048017 Ga0105243_100480173 249
307 3300009148 Ga0105243_10198778 Ga0105243_101987782 249
308 3300009174 Ga0105241_10003989 Ga0105241_100039898 249
309 3300009174 Ga0105241_10007570 Ga0105241_100075706 249
310 3300009174 Ga0105241_10108146 Ga0105241_101081462 249
311 3300009545 Ga0105237_10076519 Ga0105237_100765194 249
312 3300009545 Ga0105237_10088523 Ga0105237_100885232 249
313 3300009545 Ga0105237_10105976 Ga0105237_101059761 249
314 3300009545 Ga0105237_10611870 Ga0105237_106118701 249
315 3300009551 Ga0105238_10046240 Ga0105238_100462402 249
316 3300009551 Ga0105238_10064733 Ga0105238_100647332 249
317 3300009551 Ga0105238_10090258 Ga0105238_100902582 249
318 3300009551 Ga0105238_10124587 Ga0105238_101245873 249
319 3300009551 Ga0105238_10213095 Ga0105238_102130952 249
320 3300009551 Ga0105238_10583715 Ga0105238_105837152 249
321 3300009553 Ga0105249_10005913 Ga0105249_100059137 249
322 3300010375 Ga0105239_10040388 Ga0105239_100403884 249
323 3300010375 Ga0105239_10112652 Ga0105239_101126522 249
324 3300010375 Ga0105239_10142058 Ga0105239_101420582 249
325 3300010375 Ga0105239_10250566 Ga0105239_102505662 249
326 3300010375 Ga0105239_10353957 Ga0105239_103539572 249
327 3300010375 Ga0105239_10407565 Ga0105239_104075652 249
328 3300011119 Ga0105246_10096750 Ga0105246_100967501 249
329 3300013100 Ga0157373_10033509 Ga0157373_100335092 249
330 3300013100 Ga0157373_10304930 Ga0157373_103049301 249
331 3300013102 Ga0157371_10000757 Ga0157371_1000075710 249
332 3300013102 Ga0157371_10014187 Ga0157371_100141872 249
333 3300013104 Ga0157370_10002465 Ga0157370_1000246517 249
334 3300013104 Ga0157370_10194756 Ga0157370_101947562 249
335 3300013105 Ga0157369_10062533 Ga0157369_100625334 249
336 3300013105 Ga0157369_10329648 Ga0157369_103296482 249
337 3300013296 Ga0157374_10147671 Ga0157374_101476711 249
338 3300013296 Ga0157374_10261406 Ga0157374_102614062 249
339 3300013297 Ga0157378_10139889 Ga0157378_101398893 249
340 3300013297 Ga0157378_10679719 Ga0157378_106797191 249
341 3300013306 Ga0163162_10946254 Ga0163162_109462541 249
342 3300013307 Ga0157372_10001644 Ga0157372_1000164419 249
343 3300014325 Ga0163163_10000033 Ga0163163_1000003372 249
344 3300014325 Ga0163163_10015128 Ga0163163_100151282 249
345 3300014325 Ga0163163_10692710 Ga0163163_106927102 249
346 3300014326 Ga0157380_10021232 Ga0157380_100212323 249
347 3300014326 Ga0157380_10278955 Ga0157380_102789552 249
348 3300017792 Ga0163161_10009039 Ga0163161_100090397 249
349 3300017792 Ga0163161_10020467 Ga0163161_100204672 249
350 3300017792 Ga0163161_10056323 Ga0163161_100563232 249
351 3300025229 Ga0209147_100748 Ga0209147_10074813 249
352 3300025245 Ga0207425_1000016 Ga0207425_1000016127 249
353 3300025254 Ga0209148_1000011 Ga0209148_1000011175 249
354 3300025258 Ga0209129_1002879 Ga0209129_10028796 249
355 3300025272 Ga0209455_1000006 Ga0209455_10000061019 249
356 3300025273 Ga0209673_1001790 Ga0209673_10017908 249
357 3300025292 Ga0209676_1000046 Ga0209676_1000046360 249
358 3300025292 Ga0209676_1000413 Ga0209676_100041332 249
359 3300025294 Ga0209025_1000396 Ga0209025_100039621 249
360 3300025295 Ga0209564_1002536 Ga0209564_100253610 249
361 3300025297 Ga0209758_1000009 Ga0209758_1000009368 249
362 3300025298 Ga0209050_1000057 Ga0209050_1000057279 249
363 3300025298 Ga0209050_1000347 Ga0209050_100034732 249
364 3300025298 Ga0209050_1003694 Ga0209050_10036947 249
365 3300025298 Ga0209050_1005329 Ga0209050_10053296 249
366 3300025298 Ga0209050_1063271 Ga0209050_10632711 249
367 3300025299 Ga0209256_1000851 Ga0209256_100085112 249
368 3300025303 Ga0209051_1007363 Ga0209051_10073632 249
369 3300025303 Ga0209051_1088170 Ga0209051_10881701 249
370 3300025304 Ga0209257_1000191 Ga0209257_100019178 249
371 3300025304 Ga0209257_1000371 Ga0209257_100037132 249
372 3300025304 Ga0209257_1001875 Ga0209257_10018752 249
373 3300025304 Ga0209257_1005118 Ga0209257_10051185 249
374 3300025304 Ga0209257_1012086 Ga0209257_10120864 249
375 3300025321 Ga0207656_10070900 Ga0207656_100709002 249
376 3300025735 Ga0207713_1000798 Ga0207713_100079811 249
377 3300025735 Ga0207713_1025055 Ga0207713_10250552 249
378 3300025893 Ga0207682_10013464 Ga0207682_100134643 249
379 3300025901 Ga0207688_10310724 Ga0207688_103107242 249
380 3300025903 Ga0207680_10020755 Ga0207680_100207552 249
381 3300025903 Ga0207680_10079100 Ga0207680_100791002 249
382 3300025904 Ga0207647_10001047 Ga0207647_100010474 249
383 3300025904 Ga0207647_10030584 Ga0207647_100305843 249
384 3300025904 Ga0207647_10088389 Ga0207647_100883892 249
385 3300025907 Ga0207645_10209951 Ga0207645_102099512 249
386 3300025908 Ga0207643_10185251 Ga0207643_101852512 249
387 3300025909 Ga0207705_10000718 Ga0207705_1000071812 249
388 3300025909 Ga0207705_10610569 Ga0207705_106105691 249
389 3300025911 Ga0207654_10000732 Ga0207654_1000073210 249
390 3300025911 Ga0207654_10010982 Ga0207654_100109822 249
391 3300025911 Ga0207654_10053448 Ga0207654_100534482 249
392 3300025912 Ga0207707_10099537 Ga0207707_100995372 249
393 3300025912 Ga0207707_10110313 Ga0207707_101103132 249
394 3300025913 Ga0207695_10002546 Ga0207695_1000254616 249
395 3300025913 Ga0207695_10005914 Ga0207695_1000591412 249
396 3300025913 Ga0207695_10006892 Ga0207695_100068923 249
397 3300025913 Ga0207695_10057230 Ga0207695_100572302 249
398 3300025913 Ga0207695_10082352 Ga0207695_100823522 249
399 3300025913 Ga0207695_10135058 Ga0207695_101350582 249
400 3300025913 Ga0207695_10140950 Ga0207695_101409503 249
401 3300025913 Ga0207695_10305928 Ga0207695_103059282 249
402 3300025913 Ga0207695_10498228 Ga0207695_104982281 249
403 3300025914 Ga0207671_10059804 Ga0207671_100598041 249
404 3300025914 Ga0207671_10246317 Ga0207671_102463172 249
405 3300025916 Ga0207663_10533993 Ga0207663_105339932 249
406 3300025917 Ga0207660_10004779 Ga0207660_100047795 249
407 3300025917 Ga0207660_10105032 Ga0207660_101050322 249
408 3300025919 Ga0207657_10011730 Ga0207657_100117303 249
409 3300025920 Ga0207649_10000371 Ga0207649_1000037114 249
410 3300025921 Ga0207652_10052761 Ga0207652_100527613 249
411 3300025921 Ga0207652_10324655 Ga0207652_103246552 249
412 3300025923 Ga0207681_10015211 Ga0207681_100152113 249
413 3300025923 Ga0207681_10209152 Ga0207681_102091521 249
414 3300025924 Ga0207694_10018283 Ga0207694_100182832 249
415 3300025924 Ga0207694_10135382 Ga0207694_101353822 249
416 3300025925 Ga0207650_10019160 Ga0207650_100191603 249
417 3300025926 Ga0207659_10164160 Ga0207659_101641602 249
418 3300025927 Ga0207687_10000547 Ga0207687_1000054714 249
419 3300025927 Ga0207687_10036971 Ga0207687_100369711 249
420 3300025932 Ga0207690_10001913 Ga0207690_100019139 249
421 3300025933 Ga0207706_10002790 Ga0207706_1000279010 249
422 3300025934 Ga0207686_10517784 Ga0207686_105177842 249
423 3300025935 Ga0207709_10000059 Ga0207709_1000005932 249
424 3300025935 Ga0207709_10131149 Ga0207709_101311492 249
425 3300025937 Ga0207669_10000749 Ga0207669_1000074912 249
426 3300025938 Ga0207704_10271374 Ga0207704_102713741 249
427 3300025940 Ga0207691_10123002 Ga0207691_101230023 249
428 3300025941 Ga0207711_10008674 Ga0207711_100086741 249
429 3300025944 Ga0207661_10139228 Ga0207661_101392281 249
430 3300025944 Ga0207661_10386573 Ga0207661_103865731 249
431 3300025949 Ga0207667_10000006 Ga0207667_10000006267 249
432 3300025949 Ga0207667_10070960 Ga0207667_100709602 249
433 3300025949 Ga0207667_10286854 Ga0207667_102868542 249
434 3300025960 Ga0207651_10303634 Ga0207651_103036342 249
435 3300025961 Ga0207712_10010198 Ga0207712_100101986 249
436 3300025972 Ga0207668_10040020 Ga0207668_100400203 249
437 3300025972 Ga0207668_10435408 Ga0207668_104354081 249
438 3300025981 Ga0207640_10001209 Ga0207640_100012098 249
439 3300025981 Ga0207640_10002063 Ga0207640_100020636 249
440 3300026023 Ga0207677_10063621 Ga0207677_100636212 249
441 3300026041 Ga0207639_10014822 Ga0207639_100148222 249
442 3300026041 Ga0207639_10030031 Ga0207639_100300313 249
443 3300026041 Ga0207639_10031910 Ga0207639_100319104 249
444 3300026067 Ga0207678_10000545 Ga0207678_1000054525 249
445 3300026078 Ga0207702_10002024 Ga0207702_100020247 249
446 3300026078 Ga0207702_10014590 Ga0207702_100145903 249
447 3300026089 Ga0207648_10337674 Ga0207648_103376741 249
448 3300026116 Ga0207674_10001654 Ga0207674_100016547 249
449 3300026116 Ga0207674_10027324 Ga0207674_100273249 249
450 3300026121 Ga0207683_10006818 Ga0207683_100068188 249
451 3300026121 Ga0207683_10081300 Ga0207683_100813002 249
452 3300026121 Ga0207683_10087307 Ga0207683_100873072 249
453 3300026142 Ga0207698_10017674 Ga0207698_100176746 249
454 3300026142 Ga0207698_10234617 Ga0207698_102346172 249
455 3300027866 Ga0209813_10000077 Ga0209813_1000007711 249
456 3300028379 Ga0268266_10027727 Ga0268266_100277271 249
457 3300028379 Ga0268266_10028256 Ga0268266_100282562 249
458 3300028379 Ga0268266_10179985 Ga0268266_101799852 249
459 3300028379 Ga0268266_10187424 Ga0268266_101874242 249
460 3300028379 Ga0268266_10303796 Ga0268266_103037962 249
461 3300028380 Ga0268265_10603668 Ga0268265_106036681 249
462 3300028381 Ga0268264_10097231 Ga0268264_100972312 249
463 3300028577 Ga0265318_10009288 Ga0265318_100092882 249
464 3300031241 Ga0265325_10002784 Ga0265325_1000278410 249
465 3300031249 Ga0265339_10055217 Ga0265339_100552172 249
466 3300031344 Ga0265316_10122323 Ga0265316_101223231 249
467 3300031456 Ga0307513_10059066 Ga0307513_100590663 249
468 3300031548 Ga0307408_100008127 Ga0307408_10000812710 249
469 3300031595 Ga0265313_10003810 Ga0265313_100038104 249
470 3300031595 Ga0265313_10008369 Ga0265313_100083697 249
471 3300031711 Ga0265314_10087716 Ga0265314_100877162 249
472 3300031711 Ga0265314_10249442 Ga0265314_102494422 249
473 3300031731 Ga0307405_10039971 Ga0307405_100399713 249
474 3300031852 Ga0307410_10002590 Ga0307410_100025902 249
475 3300031901 Ga0307406_10002019 Ga0307406_100020197 249
476 3300031911 Ga0307412_10035072 Ga0307412_100350722 249
477 3300031911 Ga0307412_10149881 Ga0307412_101498812 249
478 3300031995 Ga0307409_100038474 Ga0307409_1000384744 249
479 3300032004 Ga0307414_10040948 Ga0307414_100409483 249
480 3300032004 Ga0307414_10112600 Ga0307414_101126002 249
481 3300032004 Ga0307414_10114496 Ga0307414_101144962 249
482 3300032004 Ga0307414_10363185 Ga0307414_103631852 249
483 3300035113 Ga0373936_0247516 Ga0373936_0247516_36_785 249
484 3300035172 Ga0373955_0058693 Ga0373955_0058693_1167_1916 249
485 3300035692 Ga0373935_0273237 Ga0373935_0273237_359_1108 249
486 3300037312 Ga0395899_0000674 Ga0395899_0000674_18970_19719 249
487 3300037418 Ga0395900_0000075 Ga0395900_0000075_20919_21668 249
488 3300037418 Ga0395900_0121430 Ga0395900_0121430_1355_2104 249
489 3300037466 Ga0395898_0000055 Ga0395898_0000055_165170_165919 249
490 3300037466 Ga0395898_0235657 Ga0395898_0235657_272_1021 249
491 3300037471 Ga0395905_0000067 Ga0395905_0000067_112639_113388 249
492 3300038443 Ga0395901_0000648 Ga0395901_0000648_34568_35317 249
493 3300038443 Ga0395901_0064369 Ga0395901_0064369_2239_2988 249
494 3300041406 Ga0439439_0044389 Ga0439439_0044389_373_1122 249
495 3300041410 Ga0439461_0008099 Ga0439461_0008099_1007_1756 249
496 3300041459 Ga0451800_1383254 Ga0451800_1383254_299_1048 249
497 3300041498 Ga0451841_1047927 Ga0451841_1047927_324_1085 249
498 3300041997 Ga0439431_0007189 Ga0439431_0007189_1445_2194 249
499 3300042004 Ga0439445_0019503 Ga0439445_0019503_765_1532 249
500 3300042010 Ga0439452_020802 Ga0439452_020802_870_1619 249
501 3300042015 Ga0439462_0067201 Ga0439462_0067201_153_902 249
502 3300044684 Ga0466966_0310567 Ga0466966_0310567_47_826 249
503 3300044694 Ga0466963_0300141 Ga0466963_0300141_363_1112 249
504 3300044735 Ga0466968_0021934 Ga0466968_0021934_1779_2528 249
505 3300044842 Ga0466957_0086150 Ga0466957_0086150_535_1284 249
506 3300045049 Ga0466959_0245630 Ga0466959_0245630_456_1205 249
507 3300045976 Ga0466967_0111054 Ga0466967_0111054_1294_2097 249
508 3300045976 Ga0466967_0388609 Ga0466967_0388609_507_1256 249
509 3300046453 Ga0495627_000295 Ga0495627_000295_22433_23182 249
510 3300046460 Ga0495638_0012858 Ga0495638_0012858_1436_2200 249
511 3300046491 Ga0495584_0048051 Ga0495584_0048051_324_1073 249
512 3300046492 Ga0495585_0193727 Ga0495585_0193727_256_1005 249
513 3300046506 Ga0495583_0000023 Ga0495583_0000023_190938_191687 249
514 3300046506 Ga0495583_0014188 Ga0495583_0014188_1964_2713 249
515 3300046506 Ga0495583_0025567 Ga0495583_0025567_944_1693 249
516 3300046506 Ga0495583_0096401 Ga0495583_0096401_461_1210 249
517 3300046512 Ga0495610_0000034 Ga0495610_0000034_182402_183151 249
518 3300046512 Ga0495610_0000102 Ga0495610_0000102_87943_88692 249
519 3300046512 Ga0495610_0101354 Ga0495610_0101354_153_902 249
520 3300046515 Ga0495620_0052963 Ga0495620_0052963_905_1654 249
521 3300046518 Ga0495631_0130961 Ga0495631_0130961_151_900 249
522 3300046519 Ga0495632_0000013 Ga0495632_0000013_28400_29149 249
523 3300046519 Ga0495632_0083888 Ga0495632_0083888_373_1122 249
524 3300046520 Ga0495637_0000229 Ga0495637_0000229_32994_33743 249
525 3300046520 Ga0495637_0010298 Ga0495637_0010298_1363_2112 249
526 3300046520 Ga0495637_0150077 Ga0495637_0150077_117_866 249
527 3300046522 Ga0495643_0000010 Ga0495643_0000010_166977_167726 249
528 3300046522 Ga0495643_0000434 Ga0495643_0000434_15411_16160 249
529 3300046524 Ga0495648_0001360 Ga0495648_0001360_10036_10785 249
530 3300046524 Ga0495648_0005640 Ga0495648_0005640_1156_1905 249
531 3300046524 Ga0495648_0006463 Ga0495648_0006463_4901_5650 249
532 3300046524 Ga0495648_0158220 Ga0495648_0158220_136_885 249
533 3300046525 Ga0495663_0000004 Ga0495663_0000004_135664_136413 249
534 3300046525 Ga0495663_0003013 Ga0495663_0003013_182_931 249
535 3300046530 Ga0495654_0064020 Ga0495654_0064020_165_914 249
536 3300046536 Ga0495587_0037590 Ga0495587_0037590_1561_2310 249
537 3300046536 Ga0495587_0081093 Ga0495587_0081093_331_1080 249
538 3300046538 Ga0495609_0006670 Ga0495609_0006670_3145_4005 249
539 3300046557 Ga0495622_0012205 Ga0495622_0012205_2172_2921 249
540 3300046558 Ga0495633_0000092 Ga0495633_0000092_9244_9993 249
541 3300046558 Ga0495633_0000427 Ga0495633_0000427_21605_22354 249
542 3300046558 Ga0495633_0000765 Ga0495633_0000765_10426_11175 249
543 3300046558 Ga0495633_0002661 Ga0495633_0002661_3266_4015 249
544 3300046558 Ga0495633_0150453 Ga0495633_0150453_275_1024 249
545 3300046558 Ga0495633_0167776 Ga0495633_0167776_252_1001 249
546 3300046616 Ga0495668_0000016 Ga0495668_0000016_67880_68629 249
547 3300046648 Ga0495611_0035397 Ga0495611_0035397_613_1362 249
548 3300046648 Ga0495611_0135451 Ga0495611_0135451_301_1050 249
549 3300046648 Ga0495611_0234590 Ga0495611_0234590_77_826 249
550 3300046660 Ga0495625_0000106 Ga0495625_0000106_28213_28962 249
551 3300046660 Ga0495625_0048616 Ga0495625_0048616_1187_1951 249
552 3300046684 Ga0495669_0000052 Ga0495669_0000052_20669_21418 249
553 3300046691 Ga0495670_0004750 Ga0495670_0004750_4323_5072 249
554 3300046691 Ga0495670_0030902 Ga0495670_0030902_1035_1784 249
555 3300046691 Ga0495670_0066077 Ga0495670_0066077_791_1657 249
556 3300046692 Ga0495671_0000014 Ga0495671_0000014_166977_167726 249
557 3300046692 Ga0495671_0024350 Ga0495671_0024350_2062_2811 249
558 3300046692 Ga0495671_0258742 Ga0495671_0258742_55_804 249
559 3300046694 Ga0495649_0005210 Ga0495649_0005210_2889_3638 249
560 3300046810 Ga0495660_0001451 Ga0495660_0001451_4383_5150 249
561 3300047318 Ga0495636_0016743 Ga0495636_0016743_670_1452 249
562 3300047320 Ga0495672_0063688 Ga0495672_0063688_120_869 249
563 3300047323 Ga0495683_0007315 Ga0495683_0007315_4575_5324 249
564 3300047323 Ga0495683_0016176 Ga0495683_0016176_238_987 249
565 3300047443 Ga0495687_000068 Ga0495687_000068_102372_103121 249
566 3300047443 Ga0495687_000335 Ga0495687_000335_8265_9014 249
567 3300047444 Ga0495675_0187475 Ga0495675_0187475_370_1119 249
568 3300047445 Ga0495677_0133457 Ga0495677_0133457_134_883 249
569 3300047469 Ga0495673_0080399 Ga0495673_0080399_119_868 249
570 3300047470 Ga0495681_0000104 Ga0495681_0000104_45298_46047 249
571 3300047470 Ga0495681_0001853 Ga0495681_0001853_5257_6006 249
572 3300047472 Ga0495686_0001248 Ga0495686_0001248_7854_8603 249
573 3300047472 Ga0495686_0024028 Ga0495686_0024028_2562_3311 249
574 3300047472 Ga0495686_0062797 Ga0495686_0062797_1420_2169 249
575 3300048088 Ga0495602_0051585 Ga0495602_0051585_1844_2593 249
576 3300048907 Ga0496104_0008454 Ga0496104_0008454_774_1523 249
577 3300048907 Ga0496104_0046791 Ga0496104_0046791_2944_3693 249
578 3300048908 Ga0496105_0003263 Ga0496105_0003263_5956_6705 249
579 3300048908 Ga0496105_0010189 Ga0496105_0010189_255_1004 249
580 3300048913 Ga0496110_0084811 Ga0496110_0084811_1750_2499 249
581 3300048913 Ga0496110_0108041 Ga0496110_0108041_841_1590 249
582 3300048918 Ga0496115_0001186 Ga0496115_0001186_12188_12937 249
583 3300048918 Ga0496115_0082816 Ga0496115_0082816_60_809 249
584 3300048919 Ga0496116_0011033 Ga0496116_0011033_1087_1839 249
585 3300048919 Ga0496116_0029623 Ga0496116_0029623_2508_3257 249
586 3300048919 Ga0496116_0200504 Ga0496116_0200504_230_979 249
587 3300048920 Ga0496117_0001833 Ga0496117_0001833_14343_15092 249
588 3300048920 Ga0496117_0009240 Ga0496117_0009240_7246_7995 249
589 3300048920 Ga0496117_0070508 Ga0496117_0070508_1585_2334 249
590 3300048921 Ga0496118_0004463 Ga0496118_0004463_7410_8159 249
591 3300048921 Ga0496118_0006864 Ga0496118_0006864_1049_1798 249
592 3300048921 Ga0496118_0011452 Ga0496118_0011452_5751_6500 249
593 3300048922 Ga0496119_0000140 Ga0496119_0000140_81269_82018 249
594 3300048922 Ga0496119_0045445 Ga0496119_0045445_1208_1957 249
595 3300048923 Ga0496120_0000011 Ga0496120_0000011_198399_199148 249
596 3300048923 Ga0496120_0110363 Ga0496120_0110363_51_800 249
597 3300048924 Ga0496121_0000112 Ga0496121_0000112_151335_152084 249
598 3300048924 Ga0496121_0000734 Ga0496121_0000734_6291_7058 249
599 3300048924 Ga0496121_0000997 Ga0496121_0000997_1326_2075 249
600 3300048924 Ga0496121_0044825 Ga0496121_0044825_2254_3006 249
601 3300048924 Ga0496121_0210174 Ga0496121_0210174_386_1135 249
602 3300048925 Ga0496122_0000253 Ga0496122_0000253_99574_100323 249
603 3300048925 Ga0496122_0074202 Ga0496122_0074202_923_1672 249
604 3300048926 Ga0496123_0000206 Ga0496123_0000206_20212_20961 249
605 3300048926 Ga0496123_0167173 Ga0496123_0167173_265_1014 249
606 3300048927 Ga0496124_0000148 Ga0496124_0000148_68135_68884 249
607 3300048927 Ga0496124_0009107 Ga0496124_0009107_6725_7474 249
608 3300048927 Ga0496124_0151453 Ga0496124_0151453_902_1651 249
609 3300048927 Ga0496124_0174671 Ga0496124_0174671_661_1410 249
610 3300048928 Ga0496125_0000387 Ga0496125_0000387_72974_73726 249
611 3300048928 Ga0496125_0025013 Ga0496125_0025013_2406_3155 249
612 3300048929 Ga0496126_0047094 Ga0496126_0047094_2702_3454 249
613 3300048929 Ga0496126_0051469 Ga0496126_0051469_1474_2223 249
614 3300048929 Ga0496126_0097037 Ga0496126_0097037_709_1458 249
615 3300048929 Ga0496126_0150433 Ga0496126_0150433_576_1325 249
616 3300049459 Ga0495678_106501 Ga0495678_106501_54_818 249
617 3300049460 Ga0495682_0008927 Ga0495682_0008927_1009_1758 249
618 3300049568 Ga0501031_0027991 Ga0501031_0027991_856_1614 249
619 3300049569 Ga0501032_0005428 Ga0501032_0005428_5115_5873 249
620 3300049570 Ga0501033_0004813 Ga0501033_0004813_9983_10732 249
621 3300049570 Ga0501033_0008295 Ga0501033_0008295_5099_5848 249
622 3300049570 Ga0501033_0020152 Ga0501033_0020152_4164_4994 249
623 3300049570 Ga0501033_0062110 Ga0501033_0062110_389_1147 249
624 3300049571 Ga0501034_0004672 Ga0501034_0004672_14303_15061 249
625 3300049571 Ga0501034_0236105 Ga0501034_0236105_159_917 249
626 3300049572 Ga0501036_0000882 Ga0501036_0000882_10377_11135 249
627 3300049574 Ga0501038_0186271 Ga0501038_0186271_876_1634 249
628 3300049575 Ga0501039_0002562 Ga0501039_0002562_11280_12038 249
629 3300049578 Ga0501042_0013815 Ga0501042_0013815_539_1297 249
630 3300049579 Ga0501043_0059164 Ga0501043_0059164_74_832 249
631 3300049579 Ga0501043_0101116 Ga0501043_0101116_731_1480 249
632 3300049580 Ga0501046_0004326 Ga0501046_0004326_276_1034 249
633 3300049581 Ga0501047_0001026 Ga0501047_0001026_1651_2400 249
634 3300049581 Ga0501047_0006093 Ga0501047_0006093_505_1266 249
635 3300049581 Ga0501047_0010083 Ga0501047_0010083_120_878 249
636 3300049581 Ga0501047_0040118 Ga0501047_0040118_2828_3586 249
637 3300049581 Ga0501047_0185553 Ga0501047_0185553_822_1652 249
638 3300049581 Ga0501047_0324529 Ga0501047_0324529_126_875 249
639 3300049583 Ga0501067_0021187 Ga0501067_0021187_1804_2562 249
640 3300049584 Ga0501068_0037223 Ga0501068_0037223_214_972 249
641 3300049585 Ga0501069_0138890 Ga0501069_0138890_617_1375 249
642 3300049586 Ga0501070_0027633 Ga0501070_0027633_2780_3538 249
643 3300049589 Ga0501073_0002008 Ga0501073_0002008_13189_13947 249
644 3300049589 Ga0501073_0187084 Ga0501073_0187084_391_1140 249
645 3300049589 Ga0501073_0293637 Ga0501073_0293637_352_1110 249
646 3300049741 Ga0501079_0009177 Ga0501079_0009177_2251_3009 249
647 3300049742 Ga0501080_0067296 Ga0501080_0067296_2274_3032 249
648 3300049742 Ga0501080_0304856 Ga0501080_0304856_337_1095 249
649 3300049742 Ga0501080_0506773 Ga0501080_0506773_317_1066 249
650 3300049744 Ga0501083_0013559 Ga0501083_0013559_2271_3029 249
651 3300049823 Ga0501044_0000796 Ga0501044_0000796_28877_29626 249
652 3300049823 Ga0501044_0000921 Ga0501044_0000921_25710_26459 249
653 3300049823 Ga0501044_0025454 Ga0501044_0025454_4596_5384 249
654 3300049823 Ga0501044_0081857 Ga0501044_0081857_1604_2362 249
655 3300049823 Ga0501044_0088160 Ga0501044_0088160_1900_2649 249
656 3300049823 Ga0501044_0124384 Ga0501044_0124384_1791_2540 249
657 3300049823 Ga0501044_0136781 Ga0501044_0136781_395_1225 249
658 3300050494 nmdc:mga06z11_90_c1 nmdc:mga06z11_90_c1_8695_9444 249
659 3300050495 nmdc:mga04h51_299_c1 nmdc:mga04h51_299_c1_3212_3961 249
660 3300053079 Ga0500610_0000131 Ga0500610_0000131_2242_2991 249
661 3300053080 Ga0500635_0021268 Ga0500635_0021268_1100_1849 249
662 3300053093 Ga0500651_0009693 Ga0500651_0009693_311_1060 249
663 3300053094 Ga0500566_0000347 Ga0500566_0000347_4177_4926 249
664 3300053096 Ga0500641_0013243 Ga0500641_0013243_1112_1861 249
665 3300053103 Ga0500555_000042 Ga0500555_000042_30144_30893 249
666 3300053104 Ga0500556_0000128 Ga0500556_0000128_9554_10303 249
667 3300053118 Ga0500594_0001896 Ga0500594_0001896_3243_3992 249
668 3300053128 Ga0500626_027420 Ga0500626_027420_1275_2024 249
669 3300053130 Ga0500642_0000599 Ga0500642_0000599_7673_8422 249
670 3300053134 Ga0500658_0000477 Ga0500658_0000477_15284_16051 249
671 3300053136 Ga0500559_0008943 Ga0500559_0008943_1273_2022 249
672 3300053136 Ga0500559_0039329 Ga0500559_0039329_1271_2020 249
673 3300053140 Ga0500573_0000004 Ga0500573_0000004_270792_271697 249
674 3300053727 Ga0500611_003038 Ga0500611_003038_833_1597 249
675 3300053730 Ga0500645_000002 Ga0500645_000002_285325_286074 249
676 3300054114 Ga0501084_0006391 Ga0501084_0006391_8762_9520 249
677 3300060353 Ga0501082_0251933 Ga0501082_0251933_479_1237 249
678 3300061719 Ga0466962_0104017 Ga0466962_0104017_503_1252 249
679 iso_pu_bacteria 2643221622 2644128239 249
680 iso_pu_bacteria 2818991435 2819536927 249
681 iso_pu_bacteria 2818991454 2819645178 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

63

254

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

69

299

0.95

PF08659

KR

KR domain

64

234

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5end-assembly1.cif.gz_B-2 crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(q152a) from vibrio cholerae 0.9556 8 246
4wk6-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9547 8 246
1uls-assembly1.cif.gz_A crystal structure of tt0140 from thermus thermophilus hb8 0.9505 7 247
3f9i-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9499 8 249
4ure-assembly1.cif.gz_A molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 0.948 9 246
ID Description Score Start End Superfamily
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9489 8 246 3.40.50.720
5h5xG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9487 3 249 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9426 7 247 3.40.50.720
4wecC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9403 7 249 3.40.50.720
af_Q54PL1_17_278_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9382 6 246 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A520I1R1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9679 1 171 GO:0016616
GO:0030497
AF-G6YHQ1-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9667 4 249 GO:0016616
GO:0030497
AF-A0A1I3T2W7-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9611 9 249 GO:0016491
AF-A0A1Q3QWK2-F1-model_v4 3-oxoacyl-ACP reductase 0.9597 9 249 GO:0016616
GO:0030497
AF-A0A1X7M7R7-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9594 9 249 GO:0016491

Feature Viewer

pLDDT pTM Quality
90.65 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map