F474875

General Info

Members Datasets Scaffolds Average Seq Length
681 536 1362 345

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221595|2643986455
Length 397
Sequence VANVRKEFDRFPALHDVSLDIKSGELIALLGPSGSGKTTLLRLIAGLERPTRGNIFFGDEDASHKSIQDRNVGFVFQHYALFRHMTVADNIGFGLKVRHGPSRPPAQEIRRRASELLDLVQLSGLEKRYPAQLSGGQRQRVALARAMAIEPKVLLLDEPFGALDAQVRRELRRWLREIHDATGHTTVFVTHDQEEALELADRVVVMSQGRIEQVGTADDIYDTPNSPFVYGFIGESSSLSVKVENGEIWLADRPIGLAAPNEPAGDATLYFRPHHVELLDGCSGCIAGTVAASRRVAGTRRVELEIGGERQRVEIELPVDHPAAQKSRVAFRPGRWKLFPAXAPAGRNRTAGRPPRGPEKPGGVPPRTLEAVSGVVDCNPESHVCACELQETGFGKA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
104 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
105 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
162 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
163 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
164 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
165 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
166 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
167 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
168 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
171 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
176 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
177 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
180 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
181 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
182 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
183 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
184 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
185 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
186 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
187 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
188 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
189 2512875024
190 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
191 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
192 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
193 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
194 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
195 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
196 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
197 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
198 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
199 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
200 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
201 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
202 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
203 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
204 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
205 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
206 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
207 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
208 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
209 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
210 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
211 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
212 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
213 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
214 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
215 2643221558 Rhizobium sp. Root149 Isolate Unclassified
216 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
217 2643221568 Rhizobium sp. Root564 Isolate Unclassified
218 2643221580 Devosia sp. Root635 Isolate Unclassified
219 2643221582 Rhizobium sp. Root651 Isolate Unclassified
220 2643221591 Devosia sp. Root685 Isolate Unclassified
221 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
222 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
223 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
224 2643221674 Devosia sp. Root436 Isolate Unclassified
225 2643221693 Rhizobium sp. Root491 Isolate Unclassified
226 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
227 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
228 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
229 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
230 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
231 2738541293 Rhizobium sp. GV031 Isolate Unclassified
232 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
233 2738543024 Aminobacter sp. AP02 Isolate Unclassified
234 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
235 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
236 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
237 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
238 2791355265 Rhizobium sp. H4 Isolate Nodule
239 2802429633 Rhizobium anhuiense J3 Isolate Nodule
240 2802429634 Rhizobium anhuiense S10 Isolate Nodule
241 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
242 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
243 2802429637 Rhizobium anhuiense C15 Isolate Nodule
244 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
245 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
246 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
247 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
248 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
249 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
250 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
251 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
252 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
253 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
254 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
255 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
256 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
257 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
258 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
259 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
260 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
261 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
262 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
263 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
264 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
265 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
266 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
267 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
268 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
269 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
270 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
271 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
272 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
273 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
274 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
275 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
276 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
277 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
278 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
279 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
280 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
281 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
282 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
283 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
284 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
285 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
286 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
287 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
288 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
289 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
290 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
291 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
292 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
293 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
294 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
295 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
296 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
297 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
298 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
299 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
300 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
301 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
302 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
303 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
304 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
305 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
306 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
307 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
308 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
309 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
310 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
311 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
312 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
313 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
314 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
315 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
316 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
317 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
318 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
319 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
320 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
321 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
322 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
323 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
324 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
325 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
326 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
327 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
328 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
329 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
330 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
331 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
332 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
333 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
334 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
335 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
336 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
337 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
338 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
339 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
340 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
341 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
342 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
343 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
344 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
345 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
346 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
347 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
348 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
349 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
350 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
351 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
352 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
353 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
354 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
355 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
356 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
357 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
358 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
359 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
360 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
361 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
362 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
363 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
364 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
365 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
366 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
367 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
368 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
369 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
370 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
371 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
372 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
373 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
374 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
375 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
376 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
377 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
378 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
379 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
380 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
381 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
382 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
383 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
384 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
385 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
386 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
387 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
388 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
389 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
390 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
391 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
392 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
393 2932401849 Devosia sp. 2618 Isolate Rhizosphere
394 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
395 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
396 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
397 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
398 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
399 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
400 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
401 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
402 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
403 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
404 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
405 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
406 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
407 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
408 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
409 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
410 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
411 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
412 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
413 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
414 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
415 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
416 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
417 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
418 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
419 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
420 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
421 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
422 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
423 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
424 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
425 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
426 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
427 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
428 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
429 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
430 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
431 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
432 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
433 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
434 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
435 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
436 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
437 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
438 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
439 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
440 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
441 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
442 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
443 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
444 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
445 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
446 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
447 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
448 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
449 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
450 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
451 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
452 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
453 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
454 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
455 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
456 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
457 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
458 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
459 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
460 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
461 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
462 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
463 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
464 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
465 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
466 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
467 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
468 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
469 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
470 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
471 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
472 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
473 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
474 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
475 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
476 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
477 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
478 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
479 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
480 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
481 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
482 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
483 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
484 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
485 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
486 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
487 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
488 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
489 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
490 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
491 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
492 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
493 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
494 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
495 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
496 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
497 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
498 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
499 3004167301 Mesorhizobium loti 582 Isolate Unclassified
500 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
501 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
502 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
503 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
504 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
505 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
506 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
507 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
508 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
509 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
510 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
511 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
512 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
513 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
514 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
515 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
516 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
517 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
518 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
519 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
520 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
521 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
522 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
523 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
524 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
525 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
526 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
527 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
528 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
529 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
530 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
531 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
532 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
533 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
534 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
535 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
536 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.84
Metatranscriptomes 0
Isolates 53.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 12.33
Nodule 38.47
Rhizoplane 1.62
Rhizosphere 27.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10015586 3300001989 Bacteria 2761
2 JGI25156J39149_1002906 3300002705 Bacteria 5853
3 JGI25157J39369_1001345 3300002741 Bacteria 9708
4 JGI25152J39213_1000107 3300002773 Bacteria 58133
5 JGI25151J46595_10000023 3300003187 Bacteria 221548
6 JGI25151J46595_10005137 3300003187 Bacteria 6790
7 JGI25165J46597_1000015 3300003214 Bacteria 380891
8 JGI25153J46596_10002930 3300003215 Bacteria 9661
9 JGI25153J46596_10003277 3300003215 Bacteria 9095
10 JGI25160J50197_1004162 3300003354 Bacteria 6296
11 Ga0055526_1005720 3300003771 Bacteria 7032
12 Ga0055526_1013475 3300003771 Bacteria 3454
13 Ga0055524_1020717 3300003775 Bacteria 2204
14 Ga0055536_1003545 3300003781 Bacteria 8352
15 Ga0055528_1000514 3300003790 Bacteria 30392
16 Ga0055540_1002759 3300003792 Bacteria 9013
17 Ga0055531_10006663 3300003794 Bacteria 6481
18 Ga0058692_1027145 3300003856 Bacteria 1118
19 Ga0055543_1001872 3300004625 Bacteria 7654
20 Ga0070682_100217697 3300005337 Bacteria 1357
21 Ga0070660_100225548 3300005339 Bacteria 1524
22 Ga0070661_100002605 3300005344 Bacteria 12373
23 Ga0070668_100258276 3300005347 Bacteria 1448
24 Ga0070672_100259190 3300005543 Bacteria 1466
25 Ga0070665_100012214 3300005548 Bacteria 8658
26 Ga0070665_100048847 3300005548 Bacteria 4247
27 Ga0068855_100028171 3300005563 Bacteria 6720
28 Ga0068857_100055754 3300005577 Bacteria 3507
29 Ga0068854_100007457 3300005578 Bacteria 6992
30 Ga0068856_100078650 3300005614 Bacteria 3270
31 Ga0068852_100002797 3300005616 Bacteria 12085
32 Ga0068852_100169080 3300005616 Bacteria 2047
33 Ga0068851_10002485 3300005834 Bacteria 8101
34 Ga0068860_100348622 3300005843 Bacteria 1457
35 Ga0081540_1088515 3300005983 Bacteria 1369
36 Ga0081539_10001815 3300005985 Bacteria 33742
37 Ga0075365_10009120 3300006038 Bacteria 5681
38 Ga0075365_10038867 3300006038 Bacteria 3095
39 Ga0075365_10132616 3300006038 Bacteria 1725
40 Ga0075363_100047888 3300006048 Bacteria 2271
41 Ga0075364_10000374 3300006051 Bacteria 22020
42 Ga0075364_10021680 3300006051 Bacteria 4050
43 Ga0075364_10079814 3300006051 Bacteria 2162
44 Ga0075367_10005310 3300006178 Bacteria 6378
45 Ga0075369_10003698 3300006186 Bacteria 5590
46 Ga0075366_10005534 3300006195 Bacteria 6843
47 Ga0075370_10003108 3300006353 Bacteria 7837
48 Ga0075370_10028633 3300006353 Bacteria 3097
49 Ga0079104_1000010 3300006946 Bacteria 366021
50 Ga0099826_10000070 3300006948 Bacteria 53527
51 Ga0099826_10004568 3300006948 Bacteria 9732
52 Ga0105240_10252007 3300009093 Bacteria 2041
53 Ga0105241_10051143 3300009174 Bacteria 3150
54 Ga0105237_10021807 3300009545 Bacteria 6579
55 Ga0105238_10008714 3300009551 Bacteria 10147
56 Ga0105239_10162575 3300010375 Bacteria 2495
57 Ga0105239_10235907 3300010375 Bacteria 2053
58 Ga0157373_10008462 3300013100 Bacteria 7639
59 Ga0157371_10000200 3300013102 Bacteria 87804
60 Ga0157371_10048186 3300013102 Bacteria 3029
61 Ga0157370_10000090 3300013104 Bacteria 103336
62 Ga0157369_10104463 3300013105 Bacteria 3016
63 Ga0157369_10136660 3300013105 Bacteria 2595
64 Ga0157369_10368524 3300013105 Bacteria 1491
65 Ga0207425_1000038 3300025245 Bacteria 221600
66 Ga0209026_1000025 3300025250 Bacteria 352548
67 Ga0209148_1000181 3300025254 Bacteria 124691
68 Ga0209129_1000036 3300025258 Bacteria 328331
69 Ga0209233_1000010 3300025261 Bacteria 1194329
70 Ga0209233_1020899 3300025261 Bacteria 1706
71 Ga0209455_1000127 3300025272 Bacteria 162518
72 Ga0209673_1000023 3300025273 Bacteria 411385
73 Ga0209673_1000132 3300025273 Bacteria 162349
74 Ga0209673_1003829 3300025273 Bacteria 8509
75 Ga0209676_1009947 3300025292 Bacteria 4029
76 Ga0209025_1000108 3300025294 Bacteria 221600
77 Ga0209025_1001057 3300025294 Bacteria 40170
78 Ga0209025_1001927 3300025294 Bacteria 24051
79 Ga0209564_1000100 3300025295 Bacteria 224016
80 Ga0209564_1024682 3300025295 Bacteria 2048
81 Ga0209758_1000104 3300025297 Bacteria 221600
82 Ga0209758_1000303 3300025297 Bacteria 96294
83 Ga0209758_1008060 3300025297 Bacteria 6950
84 Ga0209256_1000458 3300025299 Bacteria 61611
85 Ga0209256_1000818 3300025299 Bacteria 39749
86 Ga0209256_1002923 3300025299 Bacteria 12843
87 Ga0209051_1001670 3300025303 Bacteria 17921
88 Ga0207656_10018732 3300025321 Bacteria 2729
89 Ga0207647_10004726 3300025904 Bacteria 10086
90 Ga0207647_10039896 3300025904 Bacteria 2960
91 Ga0207705_10288636 3300025909 Bacteria 1257
92 Ga0207654_10039277 3300025911 Bacteria 2661
93 Ga0207657_10079377 3300025919 Bacteria 2761
94 Ga0207649_10001800 3300025920 Bacteria 12266
95 Ga0207694_10013751 3300025924 Bacteria 6101
96 Ga0207694_10239555 3300025924 Bacteria 1482
97 Ga0207667_10400376 3300025949 Bacteria 1398
98 Ga0207640_10279022 3300025981 Bacteria 1311
99 Ga0207639_10026652 3300026041 Bacteria 4200
100 Ga0207639_10302416 3300026041 Bacteria 1414
101 Ga0207702_10096643 3300026078 Bacteria 2598
102 Ga0207648_10391778 3300026089 Bacteria 1257
103 Ga0207674_10184193 3300026116 Bacteria 2039
104 Ga0207698_10005573 3300026142 Bacteria 7786
105 Ga0209281_1000078 3300027111 Bacteria 261622
106 Ga0209371_1000009 3300027312 Bacteria 963030
107 Ga0209371_1003091 3300027312 Bacteria 8491
108 Ga0209282_1000143 3300027666 Bacteria 42143
109 Ga0209282_1018668 3300027666 Bacteria 4398
110 Ga0268266_10035496 3300028379 Bacteria 4241
111 Ga0268266_10217857 3300028379 Bacteria 1753
112 Ga0307515_10000252 3300028794 Bacteria 132500
113 Ga0307515_10211427 3300028794 Bacteria 1783
114 Ga0265338_10122497 3300028800 Bacteria 2069
115 Ga0268256_1000010 3300030500 Bacteria 963034
116 Ga0265330_10028065 3300031235 Bacteria 2540
117 Ga0265332_10034389 3300031238 Bacteria 2203
118 Ga0265328_10052816 3300031239 Bacteria 1491
119 Ga0265325_10000866 3300031241 Bacteria 21795
120 Ga0265329_10005267 3300031242 Bacteria 5251
121 Ga0265339_10002644 3300031249 Bacteria 12774
122 Ga0265313_10000070 3300031595 Bacteria 99384
123 Ga0265314_10019269 3300031711 Bacteria 5289
124 Ga0265342_10016810 3300031712 Bacteria 4770
125 Ga0307516_10062921 3300031730 Bacteria 3594
126 Ga0307516_10099260 3300031730 Bacteria 2729
127 Ga0307406_10016696 3300031901 Bacteria 4273
128 Ga0307406_10066741 3300031901 Bacteria 2343
129 Ga0307414_10091785 3300032004 Bacteria 2258
130 Ga0307414_10133730 3300032004 Bacteria 1930
131 Ga0373927_0000253 3300035695 Bacteria 42014
132 Ga0373925_0090657 3300037068 Bacteria 2337
133 Ga0395899_0000442 3300037312 Bacteria 47552
134 Ga0395900_0000643 3300037418 Bacteria 46926
135 Ga0395900_0082159 3300037418 Bacteria 3310
136 Ga0395898_0000914 3300037466 Bacteria 47305
137 Ga0395905_0000621 3300037471 Bacteria 47593
138 Ga0395905_0001015 3300037471 Bacteria 35803
139 Ga0395905_0008999 3300037471 Bacteria 9798
140 Ga0395905_0011274 3300037471 Bacteria 8642
141 Ga0395905_0049494 3300037471 Bacteria 3938
142 Ga0395905_0300258 3300037471 Bacteria 1493
143 Ga0395901_0000466 3300038443 Bacteria 47044
144 Ga0395901_0002791 3300038443 Bacteria 17615
145 Ga0395901_0075618 3300038443 Bacteria 3513
146 Ga0395901_0515622 3300038443 Bacteria 1215
147 Ga0451847_0065524 3300041503 Bacteria 1700
148 Ga0451855_0473552 3300041511 Bacteria 1775
149 Ga0439435_0001050 3300042436 Bacteria 4873
150 Ga0466972_0013553 3300044658 Bacteria 4092
151 Ga0466970_0173388 3300044765 Bacteria 1196
152 Ga0495638_0049351 3300046460 Bacteria 2631
153 Ga0495638_0053162 3300046460 Bacteria 2521
154 Ga0495638_0104465 3300046460 Bacteria 1689
155 Ga0495585_0024722 3300046492 Bacteria 3443
156 Ga0495631_0004529 3300046518 Bacteria 7385
157 Ga0495632_0018382 3300046519 Bacteria 3837
158 Ga0495654_0000134 3300046530 Bacteria 77701
159 Ga0495668_0009854 3300046616 Bacteria 5830
160 Ga0495668_0203927 3300046616 Bacteria 1083
161 Ga0495611_0086645 3300046648 Bacteria 1445
162 Ga0495625_0013911 3300046660 Bacteria 6443
163 Ga0495588_0022539 3300046674 Bacteria 3113
164 Ga0495671_0073681 3300046692 Bacteria 1676
165 Ga0495686_0087271 3300047472 Bacteria 1898
166 Ga0496110_0144255 3300048913 Bacteria 2153
167 Ga0496111_0001801 3300048914 Bacteria 12580
168 Ga0496111_0218788 3300048914 Bacteria 1415
169 Ga0496112_0106756 3300048915 Bacteria 2770
170 Ga0496116_0000036 3300048919 Bacteria 388508
171 Ga0496116_0017655 3300048919 Bacteria 5529
172 Ga0496116_0027532 3300048919 Bacteria 4138
173 Ga0496116_0048447 3300048919 Bacteria 2852
174 Ga0496116_0108955 3300048919 Bacteria 1634
175 Ga0496117_0000002 3300048920 Bacteria 2483758
176 Ga0496117_0002129 3300048920 Bacteria 25902
177 Ga0496117_0031028 3300048920 Bacteria 4088
178 Ga0496117_0051715 3300048920 Bacteria 2901
179 Ga0496117_0147913 3300048920 Bacteria 1395
180 Ga0496118_0002809 3300048921 Bacteria 22813
181 Ga0496118_0012231 3300048921 Bacteria 8269
182 Ga0496118_0036698 3300048921 Bacteria 3957
183 Ga0496118_0038531 3300048921 Bacteria 3829
184 Ga0496118_0114607 3300048921 Bacteria 1777
185 Ga0496119_0008885 3300048922 Bacteria 8740
186 Ga0496119_0016100 3300048922 Bacteria 5711
187 Ga0496119_0030332 3300048922 Bacteria 3648
188 Ga0496119_0032048 3300048922 Bacteria 3510
189 Ga0496119_0065574 3300048922 Bacteria 2150
190 Ga0496120_0003418 3300048923 Bacteria 14503
191 Ga0496120_0004133 3300048923 Bacteria 12496
192 Ga0496121_0000001 3300048924 Bacteria 1830318
193 Ga0496121_0004009 3300048924 Bacteria 20283
194 Ga0496121_0084366 3300048924 Bacteria 2504
195 Ga0496121_0142059 3300048924 Bacteria 1779
196 Ga0496122_0000001 3300048925 Bacteria 1827766
197 Ga0496122_0000009 3300048925 Bacteria 584024
198 Ga0496122_0001278 3300048925 Bacteria 41879
199 Ga0496122_0013033 3300048925 Bacteria 8189
200 Ga0496122_0025823 3300048925 Bacteria 5086
201 Ga0496122_0062193 3300048925 Bacteria 2734
202 Ga0496123_0000001 3300048926 Bacteria 1831497
203 Ga0496123_0000020 3300048926 Bacteria 388748
204 Ga0496123_0001041 3300048926 Bacteria 41987
205 Ga0496123_0016088 3300048926 Bacteria 6095
206 Ga0496124_0000187 3300048927 Bacteria 122984
207 Ga0496124_0003596 3300048927 Bacteria 18842
208 Ga0496124_0067412 3300048927 Bacteria 2978
209 Ga0496124_0099686 3300048927 Bacteria 2355
210 Ga0496124_0138710 3300048927 Bacteria 1922
211 Ga0496124_0153462 3300048927 Bacteria 1803
212 Ga0496125_0000001 3300048928 Bacteria 1766138
213 Ga0496125_0000306 3300048928 Bacteria 96360
214 Ga0496125_0001018 3300048928 Bacteria 43593
215 Ga0496125_0033579 3300048928 Bacteria 4537
216 Ga0496125_0071635 3300048928 Bacteria 2706
217 Ga0496126_0000289 3300048929 Bacteria 106590
218 Ga0496126_0003565 3300048929 Bacteria 19520
219 Ga0496126_0007323 3300048929 Bacteria 12119
220 Ga0496126_0176159 3300048929 Bacteria 1819
221 Ga0496126_0219280 3300048929 Bacteria 1598
222 Ga0495678_019334 3300049459 Bacteria 3041
223 Ga0501031_0000010 3300049568 Bacteria 146435
224 Ga0501031_0033507 3300049568 Bacteria 3351
225 Ga0501031_0051073 3300049568 Bacteria 2693
226 Ga0501031_0070166 3300049568 Bacteria 2282
227 Ga0501031_0082501 3300049568 Bacteria 2096
228 Ga0501032_0000023 3300049569 Bacteria 146435
229 Ga0501032_0001269 3300049569 Bacteria 20225
230 Ga0501032_0065107 3300049569 Bacteria 2439
231 Ga0501032_0140647 3300049569 Bacteria 1589
232 Ga0501033_0000308 3300049570 Bacteria 46219
233 Ga0501033_0000318 3300049570 Bacteria 45707
234 Ga0501033_0000327 3300049570 Bacteria 45361
235 Ga0501033_0056474 3300049570 Bacteria 2901
236 Ga0501033_0075141 3300049570 Bacteria 2480
237 Ga0501033_0088547 3300049570 Bacteria 2265
238 Ga0501033_0167806 3300049570 Bacteria 1577
239 Ga0501033_0198160 3300049570 Bacteria 1435
240 Ga0501034_0000116 3300049571 Bacteria 146442
241 Ga0501034_0000222 3300049571 Bacteria 108857
242 Ga0501034_0028106 3300049571 Bacteria 5720
243 Ga0501034_0057570 3300049571 Bacteria 3907
244 Ga0501036_0000015 3300049572 Bacteria 146442
245 Ga0501036_0094841 3300049572 Bacteria 2522
246 Ga0501037_0000023 3300049573 Bacteria 146542
247 Ga0501037_0000136 3300049573 Bacteria 68536
248 Ga0501037_0272294 3300049573 Bacteria 1181
249 Ga0501038_0000025 3300049574 Bacteria 146542
250 Ga0501038_0082693 3300049574 Bacteria 2703
251 Ga0501039_0000037 3300049575 Bacteria 122286
252 Ga0501039_0132896 3300049575 Bacteria 1953
253 Ga0501043_0000006 3300049579 Bacteria 234413
254 Ga0501043_0000449 3300049579 Bacteria 36900
255 Ga0501046_0027024 3300049580 Bacteria 4685
256 Ga0501047_0001418 3300049581 Bacteria 23519
257 Ga0501047_0006051 3300049581 Bacteria 11377
258 Ga0501047_0242433 3300049581 Bacteria 1653
259 Ga0501067_0016882 3300049583 Bacteria 4033
260 Ga0501068_0035137 3300049584 Bacteria 2991
261 Ga0501069_0000024 3300049585 Bacteria 117140
262 Ga0501069_0025017 3300049585 Bacteria 3260
263 Ga0501070_0000093 3300049586 Bacteria 76623
264 Ga0501070_0001707 3300049586 Bacteria 19484
265 Ga0501070_0111586 3300049586 Bacteria 2260
266 Ga0501070_0147529 3300049586 Bacteria 1941
267 Ga0501071_0026366 3300049587 Bacteria 4078
268 Ga0501074_0001523 3300049590 Bacteria 15668
269 Ga0501076_0025165 3300049592 Bacteria 4605
270 Ga0501080_0005371 3300049742 Bacteria 11425
271 Ga0501083_0000097 3300049744 Bacteria 59474
272 Ga0501035_0000068 3300049822 Bacteria 128392
273 Ga0501035_0000074 3300049822 Bacteria 122269
274 Ga0501035_0001644 3300049822 Bacteria 22585
275 Ga0501035_0014747 3300049822 Bacteria 7215
276 Ga0501035_0073595 3300049822 Bacteria 3023
277 Ga0501035_0140566 3300049822 Bacteria 2100
278 Ga0501044_0000069 3300049823 Bacteria 125974
279 Ga0501044_0000096 3300049823 Bacteria 109532
280 Ga0501044_0002553 3300049823 Bacteria 20731
281 Ga0501044_0039574 3300049823 Bacteria 4917
282 Ga0501044_0077145 3300049823 Bacteria 3380
283 Ga0501044_0168738 3300049823 Bacteria 2161
284 nmdc:mga00v17_23736_c1 3300050491 Bacteria 3551
285 nmdc:mga00v17_532_c1 3300050491 Bacteria 21380
286 nmdc:mga00v17_841_c1 3300050491 Bacteria 16657
287 nmdc:mga0yw44_15153_c1 3300050492 Bacteria 4120
288 nmdc:mga0yw44_172518_c1 3300050492 Bacteria 1421
289 nmdc:mga0yw44_5970_c1 3300050492 Bacteria 5829
290 nmdc:mga06z11_116454_c1 3300050494 Bacteria 1486
291 nmdc:mga06z11_139900_c1 3300050494 Bacteria 1367
292 nmdc:mga06z11_53776_c1 3300050494 Bacteria 2072
293 nmdc:mga0sz30_6268_c1 3300050516 Bacteria 4411
294 Ga0500643_020022 3300053087 Bacteria 2195
295 Ga0500641_0003763 3300053096 Bacteria 5363
296 Ga0500556_0009617 3300053104 Bacteria 2816
297 Ga0500560_005973 3300053107 Bacteria 2743
298 Ga0500594_0012666 3300053118 Bacteria 1992
299 Ga0500608_038279 3300053122 Bacteria 2294
300 Ga0500618_000007 3300053125 Bacteria 226268
301 Ga0500618_000199 3300053125 Bacteria 47633
302 Ga0500618_010124 3300053125 Bacteria 2539
303 Ga0500618_016353 3300053125 Bacteria 1858
304 Ga0500559_0025206 3300053136 Bacteria 2530
305 Ga0500561_0000035 3300053137 Bacteria 27996
306 Ga0500568_0001718 3300053139 Bacteria 13603
307 Ga0500573_0049870 3300053140 Bacteria 2408
308 Ga0500573_0058518 3300053140 Bacteria 2209
309 Ga0500604_0000361 3300053151 Bacteria 12489
310 Ga0500616_0000120 3300053153 Bacteria 142980
311 Ga0500616_0123812 3300053153 Bacteria 1231
312 Ga0500620_000059 3300053155 Bacteria 20299
313 Ga0500622_0000466 3300053156 Bacteria 38413
314 Ga0500624_001812 3300053157 Bacteria 3101
315 Ga0500634_0000030 3300053161 Bacteria 76925
316 Ga0500634_0024408 3300053161 Bacteria 3288
317 Ga0500636_0000149 3300053177 Bacteria 36257
318 Ga0500636_0005980 3300053177 Bacteria 6973
319 Ga0501082_0021564 3300060353 Bacteria 5556
320 2643986455 2643221595 Bacteria 6565519
321 2503200145 2503198000 Bacteria 6884444
322 2509113087 2508501123 Bacteria 6283661
323 2509143939 2508501127 Bacteria 7037543
324 2509367872 2509276018 Bacteria 6910194
325 2509396261 2509276022 Bacteria 6200534
326 2510315556 2510065059 Bacteria 6847884
327 2510840195 2510461069 Bacteria 5505000
328 2510842477 2510461069 Bacteria 5505000
329 2511168951 2510917026 Bacteria 7046020
330 2512931549 2512875016 Bacteria 6529530
331 2512959382 2512875024 Bacteria 7195110
332 2513569641 2513237084 Bacteria 7231967
333 2513611340 2513237090 Bacteria 7096802
334 2514033561 2513237164 Bacteria 7563725
335 2514419699 2513237305 Bacteria 7293571
336 2515633255 2515154113 Bacteria 7807172
337 2517098611 2517093000 Bacteria 7412387
338 2537873778 2537561587 Bacteria 5425293
339 2554246847 2554235003 Bacteria 5877155
340 2559294073 2558860242 Bacteria 5568029
341 2561469182 2558860983 Bacteria 4133860
342 2585539217 2585427528 Bacteria 6842387
343 2585837170 2585427593 Bacteria 7141551
344 2585994771 2585427633 Bacteria 6413184
345 2585999312 2585427634 Bacteria 6455027
346 2588517388 2588253730 Bacteria 6881675
347 2597813277 2597489875 Bacteria 7010078
348 2599603599 2599185210 Bacteria 5624189
349 2599719292 2599185236 Bacteria 6875203
350 2599936797 2599185301 Bacteria 6161860
351 2600374975 2600254933 Bacteria 4750527
352 2601608947 2600255279 Bacteria 5605316
353 2601745722 2600255308 Bacteria 5611129
354 2643771145 2643221550 Bacteria 4619371
355 2643776158 2643221551 Bacteria 3750538
356 2643794605 2643221555 Bacteria 3749717
357 2643813982 2643221558 Bacteria 5460675
358 2643839985 2643221564 Bacteria 4193379
359 2643856126 2643221568 Bacteria 5187270
360 2643910052 2643221580 Bacteria 3816678
361 2643920932 2643221582 Bacteria 5804683
362 2643964777 2643221591 Bacteria 4397626
363 2644129423 2643221623 Bacteria 5239945
364 2644152687 2643221627 Bacteria 6761570
365 2644196311 2643221634 Bacteria 6705461
366 2644413798 2643221674 Bacteria 3919126
367 2644519011 2643221693 Bacteria 5513853
368 2688598395 2687453392 Bacteria 6880454
369 2694631028 2693429783 Bacteria 7019804
370 2694636474 2693429784 Bacteria 7241525
371 2723575330 2721755686 Bacteria 7343952
372 2725952217 2724679232 Bacteria 7646494
373 2738801813 2738541293 Bacteria 7065685
374 2739033665 2738541333 Bacteria 7106503
375 2739307129 2738543024 Bacteria 5603683
376 2756678151 2756170246 Bacteria 7451806
377 2766068387 2765235942 Bacteria 7445910
378 2776912460 2775507049 Bacteria 6284736
379 2792752739 2791355123 Bacteria 8049106
380 2793355464 2791355265 Bacteria 6539969
381 2806044836 2802429633 Bacteria 7341974
382 2806054004 2802429634 Bacteria 7083200
383 2806059904 2802429635 Bacteria 7650140
384 2806066043 2802429636 Bacteria 7597525
385 2806073375 2802429637 Bacteria 7067217
386 2808986152 2808606387 Bacteria 5697198
387 2819241557 2818991272 Bacteria 4622173
388 2819556278 2818991439 Bacteria 6907412
389 2819684405 2818991461 Bacteria 7026071
390 2821123921 2821123053 Bacteria 7836056
391 2838677003 2838675328 Bacteria 4909118
392 2838684414 2838680041 Bacteria 6545511
393 2838699905 2838694306 Bacteria 6853137
394 2838711810 2838707686 Bacteria 6619912
395 2838715890 2838714209 Bacteria 5525906
396 2838720309 2838719591 Bacteria 5523910
397 2838726643 2838724970 Bacteria 4908691
398 2838739050 2838736955 Bacteria 5760694
399 2841739152 2841734538 Bacteria 6784580
400 2841842948 2841840854 Bacteria 5761912
401 2841847239 2841846520 Bacteria 5345850
402 2841860225 2841859092 Bacteria 5436171
403 2842081881 2842077413 Bacteria 6508645
404 2842115810 2842110456 Bacteria 7656360
405 2842122457 2842118031 Bacteria 7033875
406 2842126731 2842124991 Bacteria 5346824
407 2842131896 2842130223 Bacteria 4909145
408 2842142730 2842140634 Bacteria 5759631
409 2842152934 2842152218 Bacteria 4908957
410 2842172134 2842170452 Bacteria 5525737
411 2842176553 2842175837 Bacteria 4908771
412 2842188999 2842187318 Bacteria 5524014
413 2842213311 2842211629 Bacteria 5523832
414 2842225071 2842224351 Bacteria 5524473
415 2842241222 2842237096 Bacteria 6620661
416 2842295536 2842291075 Bacteria 7076806
417 2842376672 2842370503 Bacteria 7038661
418 2842381688 2842377471 Bacteria 7140707
419 2842389005 2842384541 Bacteria 7057858
420 2842396359 2842395702 Bacteria 6780583
421 2842517010 2842515876 Bacteria 5436280
422 2844005010 2844002411 Bacteria 7168230
423 2844007481 2844002411 Bacteria 7168230
424 2844013650 2844009547 Bacteria 6728125
425 2847675567 2847670302 Bacteria 6165597
426 2847692209 2847686936 Bacteria 6278406
427 2854898556 2854896431 Bacteria 5869725
428 2854921843 2854916844 Bacteria 5725939
429 2856319453 2856314179 Bacteria 6477897
430 2856327530 2856320880 Bacteria 7263508
431 2856334514 2856328259 Bacteria 6528202
432 2856340364 2856334872 Bacteria 7037011
433 2856343893 2856342000 Bacteria 7176905
434 2857351197 2857349434 Bacteria 7926032
435 2857371496 2857367948 Bacteria 6965560
436 2857519188 2857516855 Bacteria 7787325
437 2857531483 2857531043 Bacteria 6754041
438 2869168241 2869162929 Bacteria 6399702
439 2869171915 2869169390 Bacteria 6659796
440 2869242554 2869242130 Bacteria 6609239
441 2869254086 2869249662 Bacteria 6868783
442 2869260799 2869256925 Bacteria 6981691
443 2869269412 2869264136 Bacteria 6880765
444 2869276481 2869271264 Bacteria 6908218
445 2869280419 2869278585 Bacteria 7077053
446 2869286516 2869285874 Bacteria 6901219
447 2871434669 2871429161 Bacteria 6547891
448 2871437350 2871435913 Bacteria 6880295
449 2871459211 2871451962 Bacteria 7336357
450 2871463864 2871459585 Bacteria 6866887
451 2871471905 2871466892 Bacteria 6923287
452 2871474621 2871474448 Bacteria 6806570
453 2871482595 2871481445 Bacteria 6700002
454 2871494590 2871488783 Bacteria 6929816
455 2874109173 2874102143 Bacteria 6342645
456 2874122994 2874116593 Bacteria 6674494
457 2874130556 2874123672 Bacteria 7238285
458 2874137856 2874131515 Bacteria 6820270
459 2874144169 2874139085 Bacteria 7021506
460 2874149874 2874146452 Bacteria 7533118
461 2874158132 2874155637 Bacteria 6724144
462 2874164475 2874162495 Bacteria 6174670
463 2874169800 2874168670 Bacteria 8062617
464 2876368531 2876363079 Bacteria 6544991
465 2876384392 2876377896 Bacteria 6565995
466 2876398393 2876392853 Bacteria 6660880
467 2876403678 2876399893 Bacteria 6927900
468 2876416336 2876413966 Bacteria 6831344
469 2876427812 2876420981 Bacteria 6687741
470 2878040688 2878035449 Bacteria 6555736
471 2878745164 2878738818 Bacteria 7136951
472 2878751802 2878745973 Bacteria 6867388
473 2878758828 2878753008 Bacteria 6922523
474 2878765424 2878760144 Bacteria 6823465
475 2878773132 2878767105 Bacteria 6898628
476 2878775660 2878774303 Bacteria 6108671
477 2878786823 2878781027 Bacteria 6834456
478 2881151283 2881147464 Bacteria 7779814
479 2881155097 2881147464 Bacteria 7779814
480 2881161756 2881155292 Bacteria 6461656
481 2881167483 2881161766 Bacteria 7127907
482 2881856723 2881853255 Bacteria 6698367
483 2881864645 2881861095 Bacteria 7128710
484 2882636225 2882632389 Bacteria 8154593
485 2882918522 2882912400 Bacteria 6801539
486 2885309382 2885305155 Bacteria 7348390
487 2885318030 2885312484 Bacteria 6415165
488 2885322406 2885318864 Bacteria 6729568
489 2885330044 2885326080 Bacteria 7134805
490 2885339600 2885334103 Bacteria 7216818
491 2885350084 2885342637 Bacteria 7011821
492 2888339374 2888337043 Bacteria 6629336
493 2888346750 2888343758 Bacteria 6611049
494 2888355712 2888350351 Bacteria 7372807
495 2889010649 2889010040 Bacteria 6749192
496 2889017652 2889016732 Bacteria 6700763
497 2891373440 2891373044 Bacteria 5202277
498 2894817705 2894817345 Bacteria 4892941
499 2899792290 2899792073 Bacteria 4926588
500 2899805513 2899803654 Bacteria 5577784
501 2899846565 2899845264 Bacteria 5672268
502 2903451263 2903448605 Bacteria 7357801
503 2903503933 2903492973 Bacteria 13473544
504 2903504748 2903492973 Bacteria 13473544
505 2903527530 2903521522 Bacteria 6525694
506 2903533984 2903528002 Bacteria 6586099
507 2903546255 2903540706 Bacteria 7062119
508 2904664948 2904659560 Bacteria 6685615
509 2906314200 2906308376 Bacteria 6841989
510 2906327366 2906321335 Bacteria 6579571
511 2906330056 2906328253 Bacteria 6585166
512 2906371559 2906370794 Bacteria 6881062
513 2906381073 2906378014 Bacteria 6911440
514 2906391604 2906386501 Bacteria 5977019
515 2906398248 2906393657 Bacteria 6790866
516 2906402850 2906401398 Bacteria 6693206
517 2906408853 2906408224 Bacteria 6162342
518 2906420173 2906414383 Bacteria 6580790
519 2919116092 2919114240 Bacteria 5700270
520 2919167108 2919166419 Bacteria 4952238
521 2919171782 2919171160 Bacteria 6499771
522 2922152230 2922151315 Bacteria 6902399
523 2922161163 2922158528 Bacteria 6573167
524 2922175285 2922172374 Bacteria 6167644
525 2922190244 2922185730 Bacteria 7113964
526 2923556731 2923556063 Bacteria 6793593
527 2924724122 2924718760 Bacteria 6331356
528 2924733253 2924726620 Bacteria 6271473
529 2924735892 2924733363 Bacteria 7574837
530 2924742220 2924741084 Bacteria 6661321
531 2924748377 2924748358 Bacteria 6154725
532 2924765070 2924762789 Bacteria 6561353
533 2924783301 2924776078 Bacteria 7492003
534 2924789030 2924784321 Bacteria 7416538
535 2926757046 2926754445 Bacteria 5964435
536 2926761272 2926760298 Bacteria 5505990
537 2929139189 2929138655 Bacteria 5810547
538 2932404093 2932401849 Bacteria 4262978
539 2933007579 2933006813 Bacteria 4912075
540 2933012347 2933011516 Bacteria 5439334
541 2933591776 2933586486 Bacteria 7667493
542 2933594791 2933594066 Bacteria 5594265
543 2935898246 2935894831 Bacteria 6620579
544 2936370195 2936367885 Bacteria 7324495
545 2936377867 2936375103 Bacteria 6652732
546 2937815690 2937813078 Bacteria 7783518
547 2937824403 2937822353 Bacteria 7290551
548 2937839339 2937836603 Bacteria 6811263
549 2937851872 2937848649 Bacteria 6983481
550 2937867932 2937861824 Bacteria 6660327
551 2937882172 2937877337 Bacteria 7246526
552 2937898051 2937891427 Bacteria 6357007
553 2937978633 2937972304 Bacteria 7532020
554 2937985649 2937980651 Bacteria 6517427
555 2938000113 2937994558 Bacteria 7036190
556 2958036289 2958034702 Bacteria 6989922
557 2958045653 2958041894 Bacteria 13082850
558 2958064420 2958064165 Bacteria 7158582
559 2958072076 2958071322 Bacteria 6815895
560 2958089294 2958084443 Bacteria 7312792
561 2958104492 2958100919 Bacteria 6800575
562 2958111581 2958108152 Bacteria 6681128
563 2958118411 2958115193 Bacteria 6923548
564 2958122756 2958122699 Bacteria 7280457
565 2958130919 2958130278 Bacteria 6897202
566 2958150002 2958144490 Bacteria 6677056
567 2958160181 2958158011 Bacteria 6058449
568 2958170577 2958165035 Bacteria 6906348
569 2958179071 2958172287 Bacteria 6716688
570 2958184840 2958179912 Bacteria 6874908
571 2961083007 2961077736 Bacteria 7079850
572 2961119947 2961114664 Bacteria 6680456
573 2961142486 2961136820 Bacteria 6775228
574 2961169032 2961163497 Bacteria 6901077
575 2961176094 2961170736 Bacteria 7072258
576 2961184323 2961183825 Bacteria 6688536
577 2963647662 2963644680 Bacteria 6530403
578 2965024319 2965018300 Bacteria 6883036
579 2965031805 2965025482 Bacteria 6532201
580 2965041823 2965040258 Bacteria 6855979
581 2965052883 2965047637 Bacteria 6623551
582 2965064198 2965062239 Bacteria 7412989
583 2968001981 2967996073 Bacteria 6787468
584 2968008995 2968003550 Bacteria 6929263
585 2968018500 2968016561 Bacteria 7022047
586 2968090293 2968083720 Bacteria 7351627
587 2968096319 2968091066 Bacteria 6052692
588 2968098818 2968097103 Bacteria 6107094
589 2968116304 2968110612 Bacteria 6814636
590 2968119906 2968117919 Bacteria 6536078
591 2968129139 2968128360 Bacteria 6270294
592 2968143955 2968138860 Bacteria 6605449
593 2968177426 2968171901 Bacteria 6894245
594 2970471327 2970469710 Bacteria 6969209
595 2970492934 2970489779 Bacteria 6517260
596 2970508760 2970503327 Bacteria 7099517
597 2970515556 2970510686 Bacteria 7006402
598 2970528533 2970524798 Bacteria 6840927
599 2970544688 2970540015 Bacteria 6977556
600 2970548955 2970547951 Bacteria 6931819
601 2970560272 2970554993 Bacteria 6814252
602 2970595016 2970593180 Bacteria 7073582
603 2970620500 2970619444 Bacteria 6986144
604 2970628097 2970627176 Bacteria 6680862
605 2977827368 2977821940 Bacteria 6906439
606 2977830473 2977828996 Bacteria 7007971
607 2977845926 2977843712 Bacteria 6753583
608 2977855867 2977851361 Bacteria 6694324
609 2977874827 2977872689 Bacteria 7270173
610 2977924170 2977922695 Bacteria 6956781
611 2977936066 2977935797 Bacteria 6252826
612 2977942704 2977942078 Bacteria 7570577
613 2977954879 2977950692 Bacteria 6893264
614 2978973526 2978969890 Bacteria 5400756
615 2979093448 2979089926 Bacteria 5670289
616 2979099166 2979095461 Bacteria 5669583
617 2979105422 2979100975 Bacteria 5423623
618 2979713629 2979710463 Bacteria 6785254
619 2979749497 2979742915 Bacteria 7301278
620 2979770879 2979764755 Bacteria 6610066
621 2979778867 2979772303 Bacteria 6618277
622 2979785542 2979779861 Bacteria 6219781
623 2979799343 2979793036 Bacteria 6808957
624 2979811592 2979808191 Bacteria 7179355
625 2984512727 2984509177 Bacteria 5274802
626 2984520911 2984518228 Bacteria 5277463
627 2984540206 2984537506 Bacteria 5277481
628 2984591809 2984587000 Bacteria 5263363
629 2984602400 2984601300 Bacteria 5455244
630 2987638381 2987636660 Bacteria 8088555
631 2987665063 2987659509 Bacteria 6966464
632 2987667976 2987666974 Bacteria 6509233
633 2987675181 2987673487 Bacteria 6884027
634 2989349777 2989349275 Bacteria 6349068
635 2989775429 2989771324 Bacteria 5605128
636 2996314114 2996310559 Bacteria 6357320
637 2996339053 2996336353 Bacteria 5511628
638 2996342326 2996341866 Bacteria 6643098
639 2996350119 2996348954 Bacteria 7239054
640 2996392299 2996386984 Bacteria 6978667
641 3000140711 3000135777 Bacteria 6891109
642 3002142197 3002141150 Bacteria 5254435
643 3003932360 3003930520 Bacteria 5667563
644 3004168842 3004167301 Bacteria 8330599
645 3004194120 3004188549 Bacteria 6952365
646 3004197474 3004195979 Bacteria 6776956
647 3004205375 3004203850 Bacteria 7307914
648 3004215904 3004211236 Bacteria 7417683
649 3004221930 3004218560 Bacteria 7421728
650 3004242817 3004239961 Bacteria 6892290
651 3004250494 3004248173 Bacteria 6563236
652 3004274889 3004268573 Bacteria 7043476
653 3004276818 3004275668 Bacteria 7114440
654 3004293185 3004289098 Bacteria 6135450
655 3004334414 3004334049 Bacteria 8449246
656 637074649 637000159 Bacteria 7596297
657 649872922 649633066 Bacteria 6690028
658 650739266 650716007 Bacteria 5573770
659 8002289084 8002285264 Bacteria 6717907
660 8003570301 8003570095 Bacteria 5747666
661 8004320380 8004312739 Bacteria 7444653
662 8004362395 8004361976 Bacteria 6858373
663 8004380349 8004374579 Bacteria 6898112
664 8004393690 8004387939 Bacteria 7049250
665 8004451720 8004445564 Bacteria 6322258
666 8004638625 8004633249 Bacteria 6723080
667 8004640871 8004640170 Bacteria 6723001
668 8004709313 8004703790 Bacteria 8006957
669 8004720458 8004714634 Bacteria 6776161
670 8005248664 8005246636 Bacteria 4933972
671 8005381875 8005376324 Bacteria 6590079
672 8005562117 8005556819 Bacteria 6908598
673 8005576304 8005570704 Bacteria 6957481
674 8005662118 8005658619 Bacteria 4500593
675 8005701929 8005695170 Bacteria 6912330
676 8018150880 8018150411 Bacteria 5549903
677 8024483697 8024479707 Bacteria 6954785
678 8045864743 8045864390 Bacteria 5043873
679 8054461610 8054460903 Bacteria 4872905
680 8054563875 8054563764 Bacteria 5592885
681 8055620729 8055617313 Bacteria 7548464
682 JGI24739J22299_10015586
683 JGI25156J39149_1002906
684 JGI25157J39369_1001345
685 JGI25152J39213_1000107
686 JGI25151J46595_10000023
687 JGI25151J46595_10005137
688 JGI25165J46597_1000015
689 JGI25153J46596_10002930
690 JGI25153J46596_10003277
691 JGI25160J50197_1004162
692 Ga0055526_1005720
693 Ga0055526_1013475
694 Ga0055524_1020717
695 Ga0055536_1003545
696 Ga0055528_1000514
697 Ga0055540_1002759
698 Ga0055531_10006663
699 Ga0058692_1027145
700 Ga0055543_1001872
701 Ga0070682_100217697
702 Ga0070660_100225548
703 Ga0070661_100002605
704 Ga0070668_100258276
705 Ga0070672_100259190
706 Ga0070665_100012214
707 Ga0070665_100048847
708 Ga0068855_100028171
709 Ga0068857_100055754
710 Ga0068854_100007457
711 Ga0068856_100078650
712 Ga0068852_100002797
713 Ga0068852_100169080
714 Ga0068851_10002485
715 Ga0068860_100348622
716 Ga0081540_1088515
717 Ga0081539_10001815
718 Ga0075365_10009120
719 Ga0075365_10038867
720 Ga0075365_10132616
721 Ga0075363_100047888
722 Ga0075364_10000374
723 Ga0075364_10021680
724 Ga0075364_10079814
725 Ga0075367_10005310
726 Ga0075369_10003698
727 Ga0075366_10005534
728 Ga0075370_10003108
729 Ga0075370_10028633
730 Ga0079104_1000010
731 Ga0099826_10000070
732 Ga0099826_10004568
733 Ga0105240_10252007
734 Ga0105241_10051143
735 Ga0105237_10021807
736 Ga0105238_10008714
737 Ga0105239_10162575
738 Ga0105239_10235907
739 Ga0157373_10008462
740 Ga0157371_10000200
741 Ga0157371_10048186
742 Ga0157370_10000090
743 Ga0157369_10104463
744 Ga0157369_10136660
745 Ga0157369_10368524
746 Ga0207425_1000038
747 Ga0209026_1000025
748 Ga0209148_1000181
749 Ga0209129_1000036
750 Ga0209233_1000010
751 Ga0209233_1020899
752 Ga0209455_1000127
753 Ga0209673_1000023
754 Ga0209673_1000132
755 Ga0209673_1003829
756 Ga0209676_1009947
757 Ga0209025_1000108
758 Ga0209025_1001057
759 Ga0209025_1001927
760 Ga0209564_1000100
761 Ga0209564_1024682
762 Ga0209758_1000104
763 Ga0209758_1000303
764 Ga0209758_1008060
765 Ga0209256_1000458
766 Ga0209256_1000818
767 Ga0209256_1002923
768 Ga0209051_1001670
769 Ga0207656_10018732
770 Ga0207647_10004726
771 Ga0207647_10039896
772 Ga0207705_10288636
773 Ga0207654_10039277
774 Ga0207657_10079377
775 Ga0207649_10001800
776 Ga0207694_10013751
777 Ga0207694_10239555
778 Ga0207667_10400376
779 Ga0207640_10279022
780 Ga0207639_10026652
781 Ga0207639_10302416
782 Ga0207702_10096643
783 Ga0207648_10391778
784 Ga0207674_10184193
785 Ga0207698_10005573
786 Ga0209281_1000078
787 Ga0209371_1000009
788 Ga0209371_1003091
789 Ga0209282_1000143
790 Ga0209282_1018668
791 Ga0268266_10035496
792 Ga0268266_10217857
793 Ga0307515_10000252
794 Ga0307515_10211427
795 Ga0265338_10122497
796 Ga0268256_1000010
797 Ga0265330_10028065
798 Ga0265332_10034389
799 Ga0265328_10052816
800 Ga0265325_10000866
801 Ga0265329_10005267
802 Ga0265339_10002644
803 Ga0265313_10000070
804 Ga0265314_10019269
805 Ga0265342_10016810
806 Ga0307516_10062921
807 Ga0307516_10099260
808 Ga0307406_10016696
809 Ga0307406_10066741
810 Ga0307414_10091785
811 Ga0307414_10133730
812 Ga0373927_0000253
813 Ga0373925_0090657
814 Ga0395899_0000442
815 Ga0395900_0000643
816 Ga0395900_0082159
817 Ga0395898_0000914
818 Ga0395905_0000621
819 Ga0395905_0001015
820 Ga0395905_0008999
821 Ga0395905_0011274
822 Ga0395905_0049494
823 Ga0395905_0300258
824 Ga0395901_0000466
825 Ga0395901_0002791
826 Ga0395901_0075618
827 Ga0395901_0515622
828 Ga0451847_0065524
829 Ga0451855_0473552
830 Ga0439435_0001050
831 Ga0466972_0013553
832 Ga0466970_0173388
833 Ga0495638_0049351
834 Ga0495638_0053162
835 Ga0495638_0104465
836 Ga0495585_0024722
837 Ga0495631_0004529
838 Ga0495632_0018382
839 Ga0495654_0000134
840 Ga0495668_0009854
841 Ga0495668_0203927
842 Ga0495611_0086645
843 Ga0495625_0013911
844 Ga0495588_0022539
845 Ga0495671_0073681
846 Ga0495686_0087271
847 Ga0496110_0144255
848 Ga0496111_0001801
849 Ga0496111_0218788
850 Ga0496112_0106756
851 Ga0496116_0000036
852 Ga0496116_0017655
853 Ga0496116_0027532
854 Ga0496116_0048447
855 Ga0496116_0108955
856 Ga0496117_0000002
857 Ga0496117_0002129
858 Ga0496117_0031028
859 Ga0496117_0051715
860 Ga0496117_0147913
861 Ga0496118_0002809
862 Ga0496118_0012231
863 Ga0496118_0036698
864 Ga0496118_0038531
865 Ga0496118_0114607
866 Ga0496119_0008885
867 Ga0496119_0016100
868 Ga0496119_0030332
869 Ga0496119_0032048
870 Ga0496119_0065574
871 Ga0496120_0003418
872 Ga0496120_0004133
873 Ga0496121_0000001
874 Ga0496121_0004009
875 Ga0496121_0084366
876 Ga0496121_0142059
877 Ga0496122_0000001
878 Ga0496122_0000009
879 Ga0496122_0001278
880 Ga0496122_0013033
881 Ga0496122_0025823
882 Ga0496122_0062193
883 Ga0496123_0000001
884 Ga0496123_0000020
885 Ga0496123_0001041
886 Ga0496123_0016088
887 Ga0496124_0000187
888 Ga0496124_0003596
889 Ga0496124_0067412
890 Ga0496124_0099686
891 Ga0496124_0138710
892 Ga0496124_0153462
893 Ga0496125_0000001
894 Ga0496125_0000306
895 Ga0496125_0001018
896 Ga0496125_0033579
897 Ga0496125_0071635
898 Ga0496126_0000289
899 Ga0496126_0003565
900 Ga0496126_0007323
901 Ga0496126_0176159
902 Ga0496126_0219280
903 Ga0495678_019334
904 Ga0501031_0000010
905 Ga0501031_0033507
906 Ga0501031_0051073
907 Ga0501031_0070166
908 Ga0501031_0082501
909 Ga0501032_0000023
910 Ga0501032_0001269
911 Ga0501032_0065107
912 Ga0501032_0140647
913 Ga0501033_0000308
914 Ga0501033_0000318
915 Ga0501033_0000327
916 Ga0501033_0056474
917 Ga0501033_0075141
918 Ga0501033_0088547
919 Ga0501033_0167806
920 Ga0501033_0198160
921 Ga0501034_0000116
922 Ga0501034_0000222
923 Ga0501034_0028106
924 Ga0501034_0057570
925 Ga0501036_0000015
926 Ga0501036_0094841
927 Ga0501037_0000023
928 Ga0501037_0000136
929 Ga0501037_0272294
930 Ga0501038_0000025
931 Ga0501038_0082693
932 Ga0501039_0000037
933 Ga0501039_0132896
934 Ga0501043_0000006
935 Ga0501043_0000449
936 Ga0501046_0027024
937 Ga0501047_0001418
938 Ga0501047_0006051
939 Ga0501047_0242433
940 Ga0501067_0016882
941 Ga0501068_0035137
942 Ga0501069_0000024
943 Ga0501069_0025017
944 Ga0501070_0000093
945 Ga0501070_0001707
946 Ga0501070_0111586
947 Ga0501070_0147529
948 Ga0501071_0026366
949 Ga0501074_0001523
950 Ga0501076_0025165
951 Ga0501080_0005371
952 Ga0501083_0000097
953 Ga0501035_0000068
954 Ga0501035_0000074
955 Ga0501035_0001644
956 Ga0501035_0014747
957 Ga0501035_0073595
958 Ga0501035_0140566
959 Ga0501044_0000069
960 Ga0501044_0000096
961 Ga0501044_0002553
962 Ga0501044_0039574
963 Ga0501044_0077145
964 Ga0501044_0168738
965 nmdc:mga00v17_23736_c1
966 nmdc:mga00v17_532_c1
967 nmdc:mga00v17_841_c1
968 nmdc:mga0yw44_15153_c1
969 nmdc:mga0yw44_172518_c1
970 nmdc:mga0yw44_5970_c1
971 nmdc:mga06z11_116454_c1
972 nmdc:mga06z11_139900_c1
973 nmdc:mga06z11_53776_c1
974 nmdc:mga0sz30_6268_c1
975 Ga0500643_020022
976 Ga0500641_0003763
977 Ga0500556_0009617
978 Ga0500560_005973
979 Ga0500594_0012666
980 Ga0500608_038279
981 Ga0500618_000007
982 Ga0500618_000199
983 Ga0500618_010124
984 Ga0500618_016353
985 Ga0500559_0025206
986 Ga0500561_0000035
987 Ga0500568_0001718
988 Ga0500573_0049870
989 Ga0500573_0058518
990 Ga0500604_0000361
991 Ga0500616_0000120
992 Ga0500616_0123812
993 Ga0500620_000059
994 Ga0500622_0000466
995 Ga0500624_001812
996 Ga0500634_0000030
997 Ga0500634_0024408
998 Ga0500636_0000149
999 Ga0500636_0005980
1000 Ga0501082_0021564
1001 2643986455
1002 2503200145
1003 2509113087
1004 2509143939
1005 2509367872
1006 2509396261
1007 2510315556
1008 2510840195
1009 2510842477
1010 2511168951
1011 2512931549
1012 2512959382
1013 2513569641
1014 2513611340
1015 2514033561
1016 2514419699
1017 2515633255
1018 2517098611
1019 2537873778
1020 2554246847
1021 2559294073
1022 2561469182
1023 2585539217
1024 2585837170
1025 2585994771
1026 2585999312
1027 2588517388
1028 2597813277
1029 2599603599
1030 2599719292
1031 2599936797
1032 2600374975
1033 2601608947
1034 2601745722
1035 2643771145
1036 2643776158
1037 2643794605
1038 2643813982
1039 2643839985
1040 2643856126
1041 2643910052
1042 2643920932
1043 2643964777
1044 2644129423
1045 2644152687
1046 2644196311
1047 2644413798
1048 2644519011
1049 2688598395
1050 2694631028
1051 2694636474
1052 2723575330
1053 2725952217
1054 2738801813
1055 2739033665
1056 2739307129
1057 2756678151
1058 2766068387
1059 2776912460
1060 2792752739
1061 2793355464
1062 2806044836
1063 2806054004
1064 2806059904
1065 2806066043
1066 2806073375
1067 2808986152
1068 2819241557
1069 2819556278
1070 2819684405
1071 2821123921
1072 2838677003
1073 2838684414
1074 2838699905
1075 2838711810
1076 2838715890
1077 2838720309
1078 2838726643
1079 2838739050
1080 2841739152
1081 2841842948
1082 2841847239
1083 2841860225
1084 2842081881
1085 2842115810
1086 2842122457
1087 2842126731
1088 2842131896
1089 2842142730
1090 2842152934
1091 2842172134
1092 2842176553
1093 2842188999
1094 2842213311
1095 2842225071
1096 2842241222
1097 2842295536
1098 2842376672
1099 2842381688
1100 2842389005
1101 2842396359
1102 2842517010
1103 2844005010
1104 2844007481
1105 2844013650
1106 2847675567
1107 2847692209
1108 2854898556
1109 2854921843
1110 2856319453
1111 2856327530
1112 2856334514
1113 2856340364
1114 2856343893
1115 2857351197
1116 2857371496
1117 2857519188
1118 2857531483
1119 2869168241
1120 2869171915
1121 2869242554
1122 2869254086
1123 2869260799
1124 2869269412
1125 2869276481
1126 2869280419
1127 2869286516
1128 2871434669
1129 2871437350
1130 2871459211
1131 2871463864
1132 2871471905
1133 2871474621
1134 2871482595
1135 2871494590
1136 2874109173
1137 2874122994
1138 2874130556
1139 2874137856
1140 2874144169
1141 2874149874
1142 2874158132
1143 2874164475
1144 2874169800
1145 2876368531
1146 2876384392
1147 2876398393
1148 2876403678
1149 2876416336
1150 2876427812
1151 2878040688
1152 2878745164
1153 2878751802
1154 2878758828
1155 2878765424
1156 2878773132
1157 2878775660
1158 2878786823
1159 2881151283
1160 2881155097
1161 2881161756
1162 2881167483
1163 2881856723
1164 2881864645
1165 2882636225
1166 2882918522
1167 2885309382
1168 2885318030
1169 2885322406
1170 2885330044
1171 2885339600
1172 2885350084
1173 2888339374
1174 2888346750
1175 2888355712
1176 2889010649
1177 2889017652
1178 2891373440
1179 2894817705
1180 2899792290
1181 2899805513
1182 2899846565
1183 2903451263
1184 2903503933
1185 2903504748
1186 2903527530
1187 2903533984
1188 2903546255
1189 2904664948
1190 2906314200
1191 2906327366
1192 2906330056
1193 2906371559
1194 2906381073
1195 2906391604
1196 2906398248
1197 2906402850
1198 2906408853
1199 2906420173
1200 2919116092
1201 2919167108
1202 2919171782
1203 2922152230
1204 2922161163
1205 2922175285
1206 2922190244
1207 2923556731
1208 2924724122
1209 2924733253
1210 2924735892
1211 2924742220
1212 2924748377
1213 2924765070
1214 2924783301
1215 2924789030
1216 2926757046
1217 2926761272
1218 2929139189
1219 2932404093
1220 2933007579
1221 2933012347
1222 2933591776
1223 2933594791
1224 2935898246
1225 2936370195
1226 2936377867
1227 2937815690
1228 2937824403
1229 2937839339
1230 2937851872
1231 2937867932
1232 2937882172
1233 2937898051
1234 2937978633
1235 2937985649
1236 2938000113
1237 2958036289
1238 2958045653
1239 2958064420
1240 2958072076
1241 2958089294
1242 2958104492
1243 2958111581
1244 2958118411
1245 2958122756
1246 2958130919
1247 2958150002
1248 2958160181
1249 2958170577
1250 2958179071
1251 2958184840
1252 2961083007
1253 2961119947
1254 2961142486
1255 2961169032
1256 2961176094
1257 2961184323
1258 2963647662
1259 2965024319
1260 2965031805
1261 2965041823
1262 2965052883
1263 2965064198
1264 2968001981
1265 2968008995
1266 2968018500
1267 2968090293
1268 2968096319
1269 2968098818
1270 2968116304
1271 2968119906
1272 2968129139
1273 2968143955
1274 2968177426
1275 2970471327
1276 2970492934
1277 2970508760
1278 2970515556
1279 2970528533
1280 2970544688
1281 2970548955
1282 2970560272
1283 2970595016
1284 2970620500
1285 2970628097
1286 2977827368
1287 2977830473
1288 2977845926
1289 2977855867
1290 2977874827
1291 2977924170
1292 2977936066
1293 2977942704
1294 2977954879
1295 2978973526
1296 2979093448
1297 2979099166
1298 2979105422
1299 2979713629
1300 2979749497
1301 2979770879
1302 2979778867
1303 2979785542
1304 2979799343
1305 2979811592
1306 2984512727
1307 2984520911
1308 2984540206
1309 2984591809
1310 2984602400
1311 2987638381
1312 2987665063
1313 2987667976
1314 2987675181
1315 2989349777
1316 2989775429
1317 2996314114
1318 2996339053
1319 2996342326
1320 2996350119
1321 2996392299
1322 3000140711
1323 3002142197
1324 3003932360
1325 3004168842
1326 3004194120
1327 3004197474
1328 3004205375
1329 3004215904
1330 3004221930
1331 3004242817
1332 3004250494
1333 3004274889
1334 3004276818
1335 3004293185
1336 3004334414
1337 637074649
1338 649872922
1339 650739266
1340 8002289084
1341 8003570301
1342 8004320380
1343 8004362395
1344 8004380349
1345 8004393690
1346 8004451720
1347 8004638625
1348 8004640871
1349 8004709313
1350 8004720458
1351 8005248664
1352 8005381875
1353 8005562117
1354 8005576304
1355 8005662118
1356 8005701929
1357 8018150880
1358 8024483697
1359 8045864743
1360 8054461610
1361 8054563875
1362 8055620729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

14

161

0.98

PF12857

TOBE_3

TOBE-like domain

280

334

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9481 1 236
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9284 3 236
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9276 1 224
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9251 3 237
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.925 3 237
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9767 1 219 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9699 1 219 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9653 1 220 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9609 1 220 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9596 3 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.9743 1 155 GO:0005524
GO:0016887
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.9725 3 162 GO:0005524
GO:0016887
AF-A0A656JPS2-F1-model_v4 ABC transporter 0.967 2 155 GO:0005524
GO:0016887
AF-A0A349H0M9-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9669 3 148 GO:0005524
GO:0016887
AF-A0A1V4RJG8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9651 2 150 GO:0005524
GO:0016887
GO:0055052

Map