F474978

General Info

Members Datasets Scaffolds Average Seq Length
683 476 542 227

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10154484|Ga0207693_101544842
Length 260
Sequence VSWLFAFTPEELTAIRLSLRVAFWAMLGSLPVGVAVALVLSRGRFWGKSLLNVLVHLPLIMPPVVTGYLLLLSFGRKGLIGAFLADTFGIVFAFRWTGAALACAVMGFPLLVRSIRLSLDAVDRRLEAAAGTLGANALWIFLTITLPLILPGIFAGMILSFARALGEFGATITFVSNIPGETQTLPTAIYMLIQVPGGDLAALRLTLVSIAISNPRSCSASISGGXXXSSGSPPVQTTKRAGAHGGQCEATRSASVSASG

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
12 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
13 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
14 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
17 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
18 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
19 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
20 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
21 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
22 2519899620 Rhizobium sp. Pop5 Isolate Nodule
23 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
24 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
25 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
26 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
27 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
28 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
29 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
30 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
31 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
32 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
33 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
34 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
35 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
36 2643221558 Rhizobium sp. Root149 Isolate Unclassified
37 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
38 2643221688 Rhizobium sp. Root482 Isolate Unclassified
39 2643221736 Bosea sp. Root483D1 Isolate Unclassified
40 2718217927 Rhizobium sp. N324 Isolate Nodule
41 2718218423 Rhizobium sp. N941 Isolate Nodule
42 2721755809 Rhizobium sp. N541 Isolate Nodule
43 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
44 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
45 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
46 2773857925 Microvirga vignae BR3299 Isolate Unclassified
47 2791355256 Rhizobium sp. M10 Isolate Nodule
48 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
49 2791355262 Rhizobium sp. M1 Isolate Nodule
50 2791355263 Rhizobium chutanense C5 Isolate Nodule
51 2791355265 Rhizobium sp. H4 Isolate Nodule
52 2791355266 Rhizobium sp. L43 Isolate Nodule
53 2791355267 Rhizobium sp. L18 Isolate Nodule
54 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
55 2802429633 Rhizobium anhuiense J3 Isolate Nodule
56 2802429634 Rhizobium anhuiense S10 Isolate Nodule
57 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
58 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
59 2802429637 Rhizobium anhuiense C15 Isolate Nodule
60 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
61 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
62 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
63 2838048938 Rhizobium pisi 27/80 Isolate Nodule
64 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
65 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
66 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
67 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
68 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
69 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
70 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
71 2841760612 Bosea sp. Tri-49 Isolate Nodule
72 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
73 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
74 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
75 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
76 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
77 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
78 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
79 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
80 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
81 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
82 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
83 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
84 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
85 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
86 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
87 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
88 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
89 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
90 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
91 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
92 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
93 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
94 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
95 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
96 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
97 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
98 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
99 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
100 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
101 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
102 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
103 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
104 2844104063 Bosea sp. Tri-39 Isolate Nodule
105 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
106 2851182111 Bosea sp. Tri-44 Isolate Nodule
107 2851246043 Bosea sp. Tri-54 Isolate Nodule
108 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
109 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
110 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
111 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
112 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
113 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
114 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
115 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
116 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
117 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
118 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
119 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
120 2936381700 Rhizobium chutanense C16 Isolate Unclassified
121 2996893221 Rhizobium sp. R635 Isolate Nodule
122 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
123 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
124 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
125 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
126 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
127 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
128 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
129 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
130 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
131 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
132 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
133 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
134 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
135 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
136 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
137 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
138 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
139 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
140 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
141 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
142 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
143 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
144 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
145 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
146 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
147 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
148 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
149 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
150 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
151 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
152 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
153 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
154 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
155 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
156 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
157 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
158 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
159 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
160 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
161 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
162 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
163 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
164 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
165 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
166 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
167 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
168 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
169 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
170 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
171 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
172 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
173 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
174 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
175 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
176 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
177 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
178 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
179 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
180 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
181 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
182 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
183 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
184 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
185 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
186 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
187 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
188 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
189 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
190 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
191 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
192 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
193 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
194 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
195 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
196 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
197 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
198 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
199 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
200 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
201 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
202 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
203 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
204 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
205 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
206 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
207 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
208 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
209 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
210 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
211 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
212 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
213 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
214 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
215 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
216 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
217 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
218 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
219 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
220 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
221 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
222 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
223 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
224 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
225 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
226 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
227 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
228 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
229 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
230 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
231 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
232 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
233 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
234 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
235 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
236 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
237 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
238 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
239 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
240 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
241 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
242 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
243 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
244 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
245 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
246 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
247 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
248 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
249 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
250 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
251 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
252 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
253 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
255 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
256 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
258 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
260 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
263 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
321 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
325 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
326 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
327 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
328 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
329 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
330 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
331 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
332 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
333 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
334 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
335 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
336 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
337 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
338 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
339 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
340 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
341 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
342 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
343 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
344 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
345 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
346 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
347 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
348 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
349 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
350 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
351 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
352 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
353 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
354 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
355 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
356 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
357 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
358 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
359 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
360 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
361 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
362 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
363 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
364 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
365 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
368 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
369 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
370 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
371 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
372 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
376 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
377 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
378 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
379 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
380 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
381 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
382 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
383 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
384 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
388 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
389 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
392 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
393 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
394 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
395 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
396 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
397 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
398 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
399 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
400 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
401 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
402 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
403 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
404 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
405 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
406 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
407 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
408 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
420 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
421 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
422 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
423 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
424 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
425 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
426 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
427 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
428 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
429 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
430 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
431 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
432 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
435 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
441 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
442 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
443 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
444 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
445 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
446 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
447 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
448 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
449 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
450 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
451 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
452 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
453 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
454 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
455 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
456 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
457 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
458 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
459 8005275841 Rhizobium sp. N4311 Isolate Nodule
460 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
461 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
462 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
463 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
464 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
465 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
466 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
467 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
468 8018176218 Rhizobium sp. N122 Isolate Nodule
469 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
470 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
471 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
472 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
473 8056382006 Rhizobium croatiense 13T Isolate Nodule
474 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
475 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
476 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.36
Metatranscriptomes 0
Isolates 20.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.13
Nodule 16.98
Rhizoplane 3.95
Rhizosphere 62.37
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10013276 3300002077 Bacteria 1661
2 JGI25152J39213_1001788 3300002773 Bacteria 8743
3 JGI25151J46595_10051225 3300003187 Bacteria 1399
4 Ga0055526_1000202 3300003771 Bacteria 51431
5 Ga0055526_1053295 3300003771 Bacteria 906
6 Ga0055524_1000144 3300003775 Bacteria 84213
7 Ga0055524_1004841 3300003775 Bacteria 6132
8 Ga0055528_1012493 3300003790 Bacteria 3289
9 Ga0055528_1012605 3300003790 Bacteria 3268
10 Ga0055530_10059805 3300003791 Bacteria 853
11 Ga0055540_1002133 3300003792 Bacteria 10794
12 Ga0065165_1000393 3300005262 Bacteria 71081
13 Ga0065165_1020586 3300005262 Bacteria 2317
14 Ga0070658_10006529 3300005327 Bacteria 9463
15 Ga0070658_10022683 3300005327 Bacteria 5038
16 Ga0070676_10005980 3300005328 Bacteria 6497
17 Ga0070676_10240874 3300005328 Bacteria 1203
18 Ga0070683_100151465 3300005329 Bacteria 2199
19 Ga0070683_100389399 3300005329 Bacteria 1329
20 Ga0070690_100048793 3300005330 Bacteria 2697
21 Ga0070670_100000061 3300005331 Bacteria 113254
22 Ga0070670_100016489 3300005331 Bacteria 6343
23 Ga0070666_10029451 3300005335 Bacteria 3610
24 Ga0070680_100002489 3300005336 Bacteria 13648
25 Ga0070680_100042741 3300005336 Bacteria 3678
26 Ga0070682_100002624 3300005337 Bacteria 9935
27 Ga0070660_100002918 3300005339 Bacteria 11774
28 Ga0070689_100008205 3300005340 Bacteria 7341
29 Ga0070691_10002663 3300005341 Bacteria 7954
30 Ga0070687_100002871 3300005343 Bacteria 6585
31 Ga0070661_100001269 3300005344 Bacteria 17747
32 Ga0070692_10001461 3300005345 Bacteria 8599
33 Ga0070692_10032335 3300005345 Bacteria 2630
34 Ga0070668_100057296 3300005347 Bacteria 3010
35 Ga0070668_100183187 3300005347 Bacteria 1712
36 Ga0070668_100449168 3300005347 Bacteria 1108
37 Ga0070669_100008503 3300005353 Bacteria 7326
38 Ga0070675_100105008 3300005354 Bacteria 2384
39 Ga0070671_100021552 3300005355 Bacteria 5263
40 Ga0070671_100291482 3300005355 Bacteria 1389
41 Ga0070674_100010365 3300005356 Bacteria 5631
42 Ga0070673_100015800 3300005364 Bacteria 5316
43 Ga0070673_100580569 3300005364 Bacteria 1021
44 Ga0070673_100835218 3300005364 Bacteria 852
45 Ga0070688_100006488 3300005365 Bacteria 6257
46 Ga0070659_100287181 3300005366 Bacteria 1369
47 Ga0070667_100005375 3300005367 Bacteria 10697
48 Ga0070667_100509062 3300005367 Bacteria 1104
49 Ga0070709_10005506 3300005434 Bacteria 6860
50 Ga0070709_10134202 3300005434 Bacteria 1693
51 Ga0070714_100018241 3300005435 Bacteria 5696
52 Ga0070714_100119609 3300005435 Bacteria 2341
53 Ga0070714_100169176 3300005435 Bacteria 1982
54 Ga0070714_100275499 3300005435 Bacteria 1561
55 Ga0070714_100405123 3300005435 Bacteria 1290
56 Ga0070713_100011376 3300005436 Bacteria 6479
57 Ga0070713_100027047 3300005436 Bacteria 4512
58 Ga0070713_100033540 3300005436 Bacteria 4114
59 Ga0070713_100263955 3300005436 Bacteria 1574
60 Ga0070713_100644162 3300005436 Bacteria 1009
61 Ga0070710_10008479 3300005437 Bacteria 5003
62 Ga0070701_10004911 3300005438 Bacteria 5473
63 Ga0070711_100002373 3300005439 Bacteria 10715
64 Ga0070711_100004371 3300005439 Bacteria 8326
65 Ga0070711_100177537 3300005439 Bacteria 1628
66 Ga0070705_100003239 3300005440 Bacteria 7996
67 Ga0070700_100013579 3300005441 Bacteria 4577
68 Ga0070694_100024108 3300005444 Bacteria 3924
69 Ga0070663_100030921 3300005455 Bacteria 3674
70 Ga0070678_100008820 3300005456 Bacteria 6063
71 Ga0070678_100043538 3300005456 Bacteria 3199
72 Ga0070662_100005948 3300005457 Bacteria 7824
73 Ga0070662_100421427 3300005457 Bacteria 1104
74 Ga0070681_10135921 3300005458 Bacteria 2389
75 Ga0070681_10161616 3300005458 Bacteria 2164
76 Ga0068867_100092852 3300005459 Bacteria 2293
77 Ga0070685_10013900 3300005466 Bacteria 4259
78 Ga0070706_100023669 3300005467 Bacteria 5654
79 Ga0070706_100456092 3300005467 Bacteria 1189
80 Ga0070707_100006734 3300005468 Bacteria 10649
81 Ga0070707_100055362 3300005468 Bacteria 3803
82 Ga0070698_100001306 3300005471 Bacteria 27744
83 Ga0070698_100127533 3300005471 Bacteria 2501
84 Ga0070679_100019879 3300005530 Bacteria 6539
85 Ga0070679_100052506 3300005530 Bacteria 4059
86 Ga0070684_100010433 3300005535 Bacteria 7360
87 Ga0070697_100007900 3300005536 Bacteria 8287
88 Ga0070697_100318225 3300005536 Bacteria 1339
89 Ga0070697_100673267 3300005536 Bacteria 912
90 Ga0068853_100001909 3300005539 Bacteria 15347
91 Ga0068853_100580446 3300005539 Bacteria 1064
92 Ga0070672_100008242 3300005543 Bacteria 7121
93 Ga0070686_100045315 3300005544 Bacteria 2770
94 Ga0070695_100010224 3300005545 Bacteria 5599
95 Ga0070696_100004768 3300005546 Bacteria 9059
96 Ga0070696_100086386 3300005546 Bacteria 2227
97 Ga0070693_100001532 3300005547 Bacteria 10430
98 Ga0070665_100022854 3300005548 Bacteria 6296
99 Ga0070665_100044241 3300005548 Bacteria 4471
100 Ga0070665_100098257 3300005548 Bacteria 2932
101 Ga0070704_100007835 3300005549 Bacteria 6369
102 Ga0068855_100040062 3300005563 Bacteria 5561
103 Ga0068855_100062494 3300005563 Bacteria 4347
104 Ga0070664_100005241 3300005564 Bacteria 10406
105 Ga0068857_100011135 3300005577 Bacteria 7821
106 Ga0068857_100205706 3300005577 Bacteria 1795
107 Ga0068857_100893409 3300005577 Bacteria 852
108 Ga0068854_100016106 3300005578 Bacteria 4973
109 Ga0068856_100022882 3300005614 Bacteria 6078
110 Ga0068856_100045829 3300005614 Bacteria 4306
111 Ga0068856_100446610 3300005614 Bacteria 1314
112 Ga0068856_100997078 3300005614 Bacteria 856
113 Ga0070702_100000110 3300005615 Bacteria 24545
114 Ga0070702_100408255 3300005615 Bacteria 974
115 Ga0068852_100016633 3300005616 Bacteria 5746
116 Ga0068859_100047063 3300005617 Bacteria 4332
117 Ga0068864_100006128 3300005618 Bacteria 9866
118 Ga0068866_10019633 3300005718 Bacteria 3082
119 Ga0068861_100004689 3300005719 Bacteria 9189
120 Ga0068863_100003256 3300005841 Bacteria 16051
121 Ga0068858_100012407 3300005842 Bacteria 8034
122 Ga0068860_100038778 3300005843 Bacteria 4557
123 Ga0068862_100001176 3300005844 Bacteria 24658
124 Ga0068862_100230038 3300005844 Bacteria 1682
125 Ga0081455_10017899 3300005937 Bacteria 6772
126 Ga0081455_10034079 3300005937 Bacteria 4566
127 Ga0081455_10068714 3300005937 Bacteria 2948
128 Ga0081539_10076970 3300005985 Bacteria 1766
129 Ga0070717_10003786 3300006028 Bacteria 10870
130 Ga0070717_10035079 3300006028 Bacteria 4058
131 Ga0070717_10117471 3300006028 Bacteria 2275
132 Ga0075365_10226495 3300006038 Bacteria 1312
133 Ga0075365_10486578 3300006038 Bacteria 872
134 Ga0075363_100163233 3300006048 Bacteria 1262
135 Ga0075363_100191730 3300006048 Bacteria 1166
136 Ga0070715_10042047 3300006163 Bacteria 1919
137 Ga0070716_100000813 3300006173 Bacteria 13438
138 Ga0070712_100003324 3300006175 Bacteria 9884
139 Ga0075362_10001791 3300006177 Bacteria 7002
140 Ga0075362_10007641 3300006177 Bacteria 4106
141 Ga0075362_10011418 3300006177 Bacteria 3498
142 Ga0075362_10141082 3300006177 Bacteria 1151
143 Ga0075367_10000418 3300006178 Bacteria 15724
144 Ga0075369_10008013 3300006186 Bacteria 4047
145 Ga0097621_100077120 3300006237 Bacteria 2766
146 Ga0075370_10017794 3300006353 Bacteria 3844
147 Ga0068865_100016645 3300006881 Bacteria 4711
148 Ga0075436_100094225 3300006914 Bacteria 2082
149 Ga0097620_100047065 3300006931 Bacteria 4332
150 Ga0099794_10034126 3300007265 Bacteria 2395
151 Ga0099795_10021327 3300007788 Bacteria 2123
152 Ga0105240_10003758 3300009093 Bacteria 23459
153 Ga0105245_10013417 3300009098 Bacteria 7138
154 Ga0105245_10892742 3300009098 Bacteria 930
155 Ga0105247_10131427 3300009101 Bacteria 1632
156 Ga0114129_10485677 3300009147 Bacteria 1615
157 Ga0105243_10008677 3300009148 Bacteria 7792
158 Ga0105243_10066931 3300009148 Bacteria 2891
159 Ga0105243_10329322 3300009148 Bacteria 1394
160 Ga0105243_10582493 3300009148 Bacteria 1074
161 Ga0105241_10010650 3300009174 Bacteria 6744
162 Ga0105242_10017182 3300009176 Bacteria 5633
163 Ga0105248_10004856 3300009177 Bacteria 14885
164 Ga0105237_10004828 3300009545 Bacteria 15484
165 Ga0105249_10000914 3300009553 Bacteria 26099
166 Ga0105249_10327125 3300009553 Bacteria 1545
167 Ga0123341_1000260 3300009765 Bacteria 28683
168 Ga0123342_1011038 3300009766 Bacteria 10076
169 Ga0099796_10007236 3300010159 Bacteria 2891
170 Ga0105239_10042206 3300010375 Bacteria 4998
171 Ga0105239_10475738 3300010375 Bacteria 1419
172 Ga0105246_10032088 3300011119 Bacteria 3481
173 Ga0105246_10099578 3300011119 Bacteria 2113
174 Ga0157321_1000150 3300012487 Bacteria 3020
175 Ga0157371_10002409 3300013102 Bacteria 17899
176 Ga0157370_10213804 3300013104 Bacteria 1787
177 Ga0157369_10010257 3300013105 Bacteria 10690
178 Ga0157369_10554286 3300013105 Bacteria 1188
179 Ga0157374_10019924 3300013296 Bacteria 5945
180 Ga0157378_10017362 3300013297 Bacteria 6314
181 Ga0163162_10063947 3300013306 Bacteria 3724
182 Ga0163162_11189620 3300013306 Bacteria 865
183 Ga0157372_10019029 3300013307 Bacteria 7391
184 Ga0157375_10005142 3300013308 Bacteria 11361
185 Ga0157380_10013155 3300014326 Bacteria 6026
186 Ga0157380_10171113 3300014326 Bacteria 1898
187 Ga0182008_10054802 3300014497 Bacteria 1972
188 Ga0157377_10020367 3300014745 Bacteria 3474
189 Ga0157379_10003396 3300014968 Bacteria 13467
190 Ga0157376_10844118 3300014969 Bacteria 931
191 Ga0163161_10002750 3300017792 Bacteria 12504
192 Ga0214542_1017465 3300021321 Bacteria 6468
193 Ga0214543_1000008 3300021327 Bacteria 385680
194 Ga0213873_10018333 3300021358 Bacteria 1609
195 Ga0213875_10000382 3300021388 Bacteria 39987
196 Ga0213875_10001328 3300021388 Bacteria 16300
197 Ga0213871_10023054 3300021441 Bacteria 1564
198 Ga0209129_1000050 3300025258 Bacteria 267408
199 Ga0209129_1016021 3300025258 Bacteria 1519
200 Ga0209673_1000033 3300025273 Bacteria 335369
201 Ga0209673_1003944 3300025273 Bacteria 8293
202 Ga0209673_1013749 3300025273 Bacteria 3178
203 Ga0209130_1000061 3300025284 Bacteria 200990
204 Ga0209675_1003298 3300025291 Bacteria 7751
205 Ga0209676_1048734 3300025292 Bacteria 1129
206 Ga0209025_1000014 3300025294 Bacteria 865448
207 Ga0209025_1002759 3300025294 Bacteria 17753
208 Ga0209025_1014200 3300025294 Bacteria 4928
209 Ga0209025_1040858 3300025294 Bacteria 1998
210 Ga0209564_1000187 3300025295 Bacteria 146950
211 Ga0209564_1005816 3300025295 Bacteria 6877
212 Ga0209564_1016479 3300025295 Bacteria 2938
213 Ga0209758_1011142 3300025297 Bacteria 5251
214 Ga0209758_1023249 3300025297 Bacteria 2810
215 Ga0209758_1089424 3300025297 Bacteria 906
216 Ga0209050_1004258 3300025298 Bacteria 9829
217 Ga0209256_1000055 3300025299 Bacteria 295530
218 Ga0209256_1001149 3300025299 Bacteria 30019
219 Ga0209256_1010664 3300025299 Bacteria 3809
220 Ga0207426_1020488 3300025302 Bacteria 2298
221 Ga0209051_1000118 3300025303 Bacteria 149426
222 Ga0209051_1038243 3300025303 Bacteria 1749
223 Ga0209257_1003745 3300025304 Bacteria 12591
224 Ga0207697_10046742 3300025315 Bacteria 1783
225 Ga0207710_10016320 3300025900 Bacteria 3141
226 Ga0207647_10019501 3300025904 Bacteria 4560
227 Ga0207685_10002027 3300025905 Bacteria 4512
228 Ga0207699_10005612 3300025906 Bacteria 6019
229 Ga0207699_10044035 3300025906 Bacteria 2596
230 Ga0207645_10003136 3300025907 Bacteria 12679
231 Ga0207645_10182112 3300025907 Bacteria 1378
232 Ga0207643_10093367 3300025908 Bacteria 1757
233 Ga0207705_10050469 3300025909 Bacteria 2995
234 Ga0207705_10299946 3300025909 Bacteria 1232
235 Ga0207654_10058148 3300025911 Bacteria 2250
236 Ga0207707_10016488 3300025912 Bacteria 6442
237 Ga0207707_10077556 3300025912 Bacteria 2900
238 Ga0207671_10014576 3300025914 Bacteria 6201
239 Ga0207693_10000133 3300025915 Bacteria 67586
240 Ga0207693_10012635 3300025915 Bacteria 6822
241 Ga0207693_10154484 3300025915 Bacteria 1805
242 Ga0207693_10261235 3300025915 Bacteria 1358
243 Ga0207663_10066927 3300025916 Bacteria 2301
244 Ga0207663_10069610 3300025916 Bacteria 2264
245 Ga0207663_10131305 3300025916 Bacteria 1731
246 Ga0207663_10152667 3300025916 Bacteria 1622
247 Ga0207660_10011346 3300025917 Bacteria 5797
248 Ga0207660_10031253 3300025917 Bacteria 3665
249 Ga0207660_10447087 3300025917 Bacteria 1045
250 Ga0207662_10001646 3300025918 Bacteria 10927
251 Ga0207657_10001128 3300025919 Bacteria 28356
252 Ga0207657_10145786 3300025919 Bacteria 1931
253 Ga0207649_10004890 3300025920 Bacteria 7248
254 Ga0207652_10062296 3300025921 Bacteria 3223
255 Ga0207646_10007660 3300025922 Bacteria 10932
256 Ga0207646_10021237 3300025922 Bacteria 6002
257 Ga0207681_10048910 3300025923 Bacteria 2856
258 Ga0207650_10000207 3300025925 Bacteria 67267
259 Ga0207650_10048517 3300025925 Bacteria 3132
260 Ga0207659_10021784 3300025926 Bacteria 4261
261 Ga0207687_10007754 3300025927 Bacteria 7042
262 Ga0207700_10003949 3300025928 Bacteria 8673
263 Ga0207700_10038709 3300025928 Bacteria 3463
264 Ga0207700_10047814 3300025928 Bacteria 3173
265 Ga0207700_10083677 3300025928 Bacteria 2498
266 Ga0207700_10120552 3300025928 Bacteria 2126
267 Ga0207700_10219804 3300025928 Bacteria 1610
268 Ga0207700_10253128 3300025928 Bacteria 1505
269 Ga0207664_10053300 3300025929 Bacteria 3201
270 Ga0207664_10072720 3300025929 Bacteria 2773
271 Ga0207664_10100066 3300025929 Bacteria 2393
272 Ga0207664_10384159 3300025929 Bacteria 1247
273 Ga0207644_10057756 3300025931 Bacteria 2802
274 Ga0207644_10167472 3300025931 Bacteria 1713
275 Ga0207690_10014673 3300025932 Bacteria 4736
276 Ga0207706_10000195 3300025933 Bacteria 67422
277 Ga0207706_10412583 3300025933 Bacteria 1170
278 Ga0207686_10010765 3300025934 Bacteria 4984
279 Ga0207709_10079825 3300025935 Bacteria 2105
280 Ga0207709_10195065 3300025935 Bacteria 1442
281 Ga0207670_10101280 3300025936 Bacteria 2058
282 Ga0207670_10206563 3300025936 Bacteria 1495
283 Ga0207669_10005710 3300025937 Bacteria 5613
284 Ga0207704_10038802 3300025938 Bacteria 2766
285 Ga0207665_10000068 3300025939 Bacteria 67429
286 Ga0207691_10022804 3300025940 Bacteria 5901
287 Ga0207711_10051281 3300025941 Bacteria 3533
288 Ga0207711_10370743 3300025941 Bacteria 1328
289 Ga0207661_10136930 3300025944 Bacteria 2104
290 Ga0207679_10129779 3300025945 Bacteria 2020
291 Ga0207667_10030011 3300025949 Bacteria 5888
292 Ga0207667_10077119 3300025949 Bacteria 3457
293 Ga0207651_10011247 3300025960 Bacteria 5001
294 Ga0207651_10702028 3300025960 Bacteria 891
295 Ga0207712_10050265 3300025961 Bacteria 2910
296 Ga0207712_10399435 3300025961 Bacteria 1155
297 Ga0207668_10009155 3300025972 Bacteria 5921
298 Ga0207668_10238515 3300025972 Bacteria 1470
299 Ga0207640_10011399 3300025981 Bacteria 5033
300 Ga0207658_10040692 3300025986 Bacteria 3361
301 Ga0207703_10032061 3300026035 Bacteria 4157
302 Ga0207639_10022144 3300026041 Bacteria 4575
303 Ga0207639_10858767 3300026041 Bacteria 847
304 Ga0207678_10000128 3300026067 Bacteria 63331
305 Ga0207708_10009009 3300026075 Bacteria 7385
306 Ga0207708_10078163 3300026075 Bacteria 2540
307 Ga0207702_10016712 3300026078 Bacteria 6074
308 Ga0207702_10040366 3300026078 Bacteria 3913
309 Ga0207702_10377298 3300026078 Bacteria 1363
310 Ga0207676_10029203 3300026095 Bacteria 4126
311 Ga0207674_10000779 3300026116 Bacteria 41558
312 Ga0207674_10017712 3300026116 Bacteria 7763
313 Ga0207675_100111144 3300026118 Bacteria 2586
314 Ga0207683_10017091 3300026121 Bacteria 6174
315 Ga0207683_10019070 3300026121 Bacteria 5855
316 Ga0207698_10883393 3300026142 Bacteria 900
317 Ga0209588_1016899 3300027671 Bacteria 2257
318 Ga0209588_1088279 3300027671 Bacteria 999
319 Ga0207428_10130558 3300027907 Bacteria 1923
320 Ga0268266_10009593 3300028379 Bacteria 8513
321 Ga0268266_10122557 3300028379 Bacteria 2315
322 Ga0268265_10017111 3300028380 Bacteria 4995
323 Ga0268265_10103069 3300028380 Bacteria 2310
324 Ga0268264_10018642 3300028381 Bacteria 5673
325 Ga0268264_10504698 3300028381 Bacteria 1180
326 Ga0265318_10010199 3300028577 Bacteria 4102
327 Ga0307515_10119504 3300028794 Bacteria 2997
328 Ga0265320_10214421 3300031240 Bacteria 858
329 Ga0307513_10127962 3300031456 Bacteria 2491
330 Ga0307407_10049079 3300031903 Bacteria 2407
331 Ga0307412_10258124 3300031911 Bacteria 1357
332 Ga0307416_100209196 3300032002 Bacteria 1859
333 Ga0307411_10165385 3300032005 Bacteria 1662
334 Ga0307411_10335583 3300032005 Bacteria 1226
335 Ga0307411_10634348 3300032005 Bacteria 923
336 Ga0307415_100035445 3300032126 Bacteria 3259
337 Ga0307415_100312759 3300032126 Bacteria 1306
338 Ga0373926_0028768 3300035083 Bacteria 1951
339 Ga0373944_0029620 3300035089 Bacteria 1638
340 Ga0373932_0004774 3300035112 Bacteria 3196
341 Ga0373956_0096927 3300035119 Bacteria 1365
342 Ga0373943_0085119 3300035170 Bacteria 1628
343 Ga0373943_0394458 3300035170 Bacteria 798
344 Ga0373946_0014455 3300035171 Bacteria 2978
345 Ga0373931_0013189 3300035691 Bacteria 4021
346 Ga0373931_0087537 3300035691 Bacteria 1730
347 Ga0373935_0035432 3300035692 Bacteria 3115
348 Ga0373933_0313548 3300035724 Bacteria 1016
349 Ga0373947_0225207 3300035725 Bacteria 1234
350 Ga0373937_0051618 3300036401 Bacteria 3769
351 Ga0373925_0015042 3300037068 Bacteria 5594
352 Ga0373925_0283188 3300037068 Bacteria 1335
353 Ga0373925_0693544 3300037068 Bacteria 839
354 Ga0395900_0046437 3300037418 Bacteria 4472
355 Ga0395898_0480138 3300037466 Bacteria 1182
356 Ga0436364_0042928 3300037853 Bacteria 71182
357 Ga0436364_0065786 3300037853 Bacteria 48260
358 Ga0436364_0518800 3300037853 Bacteria 2381
359 Ga0395901_0003123 3300038443 Bacteria 16633
360 Ga0395901_0052236 3300038443 Bacteria 4247
361 Ga0436365_0497119 3300039437 Bacteria 4952
362 Ga0436365_0797875 3300039437 Bacteria 2961
363 Ga0436365_1830300 3300039437 Bacteria 1036
364 Ga0436360_0007794 3300039438 Bacteria 2256
365 Ga0436360_1148383 3300039438 Bacteria 7486
366 Ga0436360_1369805 3300039438 Bacteria 878
367 Ga0436361_0830550 3300039447 Bacteria 2602
368 Ga0436361_0943746 3300039447 Bacteria 836
369 Ga0436363_1411444 3300039450 Bacteria 1569
370 Ga0436362_0281296 3300039453 Bacteria 2894
371 Ga0439436_0094370 3300041404 Bacteria 833
372 Ga0439465_0000941 3300041413 Bacteria 9221
373 Ga0439465_0119221 3300041413 Bacteria 924
374 Ga0439445_0049949 3300042004 Bacteria 1127
375 Ga0439432_037626 3300042006 Bacteria 1543
376 Ga0439449_0018491 3300042007 Bacteria 2616
377 Ga0439449_0039879 3300042007 Bacteria 1746
378 Ga0495638_0078069 3300046460 Bacteria 2015
379 Ga0495580_0048238 3300046472 Bacteria 3016
380 Ga0495584_0080050 3300046491 Bacteria 1644
381 Ga0495585_0013352 3300046492 Bacteria 4811
382 Ga0495585_0061253 3300046492 Bacteria 2070
383 Ga0495583_0050601 3300046506 Bacteria 1898
384 Ga0495583_0178265 3300046506 Bacteria 871
385 Ga0495606_0015810 3300046507 Bacteria 5791
386 Ga0495608_0269315 3300046511 Bacteria 1059
387 Ga0495610_0027974 3300046512 Bacteria 2988
388 Ga0495620_0023623 3300046515 Bacteria 2936
389 Ga0495632_0031399 3300046519 Bacteria 2746
390 Ga0495643_0025671 3300046522 Bacteria 3331
391 Ga0495648_0238978 3300046524 Bacteria 884
392 Ga0495587_0315285 3300046536 Bacteria 874
393 Ga0495597_0030319 3300046542 Bacteria 2465
394 Ga0495633_0036115 3300046558 Bacteria 2369
395 Ga0495668_0051536 3300046616 Bacteria 2279
396 Ga0495625_0033453 3300046660 Bacteria 3802
397 Ga0495625_0130006 3300046660 Bacteria 1706
398 Ga0495661_0067647 3300046665 Bacteria 2098
399 Ga0495661_0133315 3300046665 Bacteria 1359
400 Ga0495588_0004768 3300046674 Bacteria 5995
401 Ga0495658_0001152 3300046683 Bacteria 13968
402 Ga0495671_0077299 3300046692 Bacteria 1632
403 Ga0495660_0126246 3300046810 Bacteria 1288
404 Ga0495660_0168149 3300046810 Bacteria 1070
405 Ga0495636_0103467 3300047318 Bacteria 1247
406 Ga0495687_022670 3300047443 Bacteria 3011
407 Ga0495686_0063819 3300047472 Bacteria 2281
408 Ga0496100_0097862 3300048903 Bacteria 2015
409 Ga0496101_0078631 3300048904 Bacteria 2433
410 Ga0496102_0175855 3300048905 Bacteria 2015
411 Ga0496102_0271045 3300048905 Bacteria 1600
412 Ga0496103_0030105 3300048906 Bacteria 3301
413 Ga0496104_0018902 3300048907 Bacteria 6294
414 Ga0496105_0074129 3300048908 Bacteria 2811
415 Ga0496106_0037145 3300048909 Bacteria 3643
416 Ga0496106_0086941 3300048909 Bacteria 2408
417 Ga0496107_0028475 3300048910 Bacteria 3970
418 Ga0496107_0556115 3300048910 Bacteria 850
419 Ga0496108_0039012 3300048911 Bacteria 3958
420 Ga0496108_0719674 3300048911 Bacteria 865
421 Ga0496109_0055034 3300048912 Bacteria 3629
422 Ga0496109_0101585 3300048912 Bacteria 2669
423 Ga0496110_0038422 3300048913 Bacteria 4165
424 Ga0496110_0390330 3300048913 Bacteria 1269
425 Ga0496110_0440538 3300048913 Bacteria 1187
426 Ga0496111_0062526 3300048914 Bacteria 2699
427 Ga0496111_0076732 3300048914 Bacteria 2436
428 Ga0496112_0126917 3300048915 Bacteria 2521
429 Ga0496112_0134296 3300048915 Bacteria 2445
430 Ga0496113_0052700 3300048916 Bacteria 3040
431 Ga0496113_0055250 3300048916 Bacteria 2975
432 Ga0496113_0166157 3300048916 Bacteria 1746
433 Ga0496114_0208714 3300048917 Bacteria 1712
434 Ga0496115_0102150 3300048918 Bacteria 2351
435 Ga0496117_0075984 3300048920 Bacteria 2229
436 Ga0496118_0080464 3300048921 Bacteria 2293
437 Ga0496119_0165924 3300048922 Bacteria 1170
438 Ga0496121_0240004 3300048924 Bacteria 1263
439 Ga0496122_0006028 3300048925 Bacteria 14138
440 Ga0496124_0000130 3300048927 Bacteria 156467
441 Ga0496124_0009086 3300048927 Bacteria 10278
442 Ga0496124_0400796 3300048927 Bacteria 952
443 Ga0496126_0037873 3300048929 Bacteria 4493
444 Ga0496126_0433554 3300048929 Bacteria 1060
445 Ga0495678_133751 3300049459 Bacteria 819
446 Ga0501034_0008960 3300049571 Bacteria 10517
447 Ga0501034_0009746 3300049571 Bacteria 10043
448 Ga0501034_0024480 3300049571 Bacteria 6141
449 Ga0501034_0098476 3300049571 Bacteria 2920
450 Ga0501034_0496002 3300049571 Bacteria 1135
451 Ga0501034_0510767 3300049571 Bacteria 1114
452 Ga0501034_0818802 3300049571 Bacteria 823
453 Ga0501036_0009582 3300049572 Bacteria 7967
454 Ga0501036_0012973 3300049572 Bacteria 6918
455 Ga0501037_0170671 3300049573 Bacteria 1546
456 Ga0501038_0001082 3300049574 Bacteria 24639
457 Ga0501039_0000168 3300049575 Bacteria 45750
458 Ga0501039_0223604 3300049575 Bacteria 1480
459 Ga0501040_0001149 3300049576 Bacteria 16836
460 Ga0501040_0016387 3300049576 Bacteria 4906
461 Ga0501041_0000623 3300049577 Bacteria 18476
462 Ga0501042_0007758 3300049578 Bacteria 7052
463 Ga0501043_0155073 3300049579 Bacteria 1791
464 Ga0501046_0000480 3300049580 Bacteria 39915
465 Ga0501048_0000896 3300049582 Bacteria 21988
466 Ga0501048_0063986 3300049582 Bacteria 2601
467 Ga0501048_0400699 3300049582 Bacteria 981
468 Ga0501067_0040015 3300049583 Bacteria 2603
469 Ga0501070_0337576 3300049586 Bacteria 1224
470 Ga0501071_0006119 3300049587 Bacteria 7799
471 Ga0501071_0238458 3300049587 Bacteria 1371
472 Ga0501071_0451795 3300049587 Bacteria 983
473 Ga0501072_0002754 3300049588 Bacteria 13208
474 Ga0501072_0021236 3300049588 Bacteria 5035
475 Ga0501072_0052612 3300049588 Bacteria 3206
476 Ga0501074_0017319 3300049590 Bacteria 5227
477 Ga0501074_0205519 3300049590 Bacteria 1403
478 Ga0501075_0000046 3300049591 Bacteria 50813
479 Ga0501075_0206837 3300049591 Bacteria 1497
480 Ga0501076_0000566 3300049592 Bacteria 23610
481 Ga0501076_0148292 3300049592 Bacteria 1908
482 Ga0501077_0004492 3300049593 Bacteria 8471
483 Ga0501077_0058409 3300049593 Bacteria 2449
484 Ga0501238_001394 3300049671 Bacteria 2800
485 Ga0501079_0000808 3300049741 Bacteria 21315
486 Ga0501080_0031560 3300049742 Bacteria 4936
487 Ga0501080_0087780 3300049742 Bacteria 2889
488 Ga0501080_0184262 3300049742 Bacteria 1920
489 Ga0501080_0654637 3300049742 Bacteria 929
490 Ga0501081_0005566 3300049743 Bacteria 8134
491 Ga0501081_0011120 3300049743 Bacteria 5886
492 Ga0501083_0209612 3300049744 Bacteria 1270
493 Ga0501035_0156603 3300049822 Bacteria 1974
494 Ga0501044_0020009 3300049823 Bacteria 7147
495 Ga0501044_0059875 3300049823 Bacteria 3901
496 Ga0501045_0004353 3300049824 Bacteria 9761
497 Ga0501045_0043187 3300049824 Bacteria 3282
498 Ga0501045_0063202 3300049824 Bacteria 2716
499 nmdc:mga03683_24495_c1 3300050489 Bacteria 2362
500 nmdc:mga00v17_238233_c1 3300050491 Bacteria 1179
501 nmdc:mga00v17_263_c1 3300050491 Bacteria 30939
502 nmdc:mga0yw44_110948_c1 3300050492 Bacteria 1757
503 nmdc:mga0yw44_161274_c1 3300050492 Bacteria 1468
504 nmdc:mga0yw44_196858_c1 3300050492 Bacteria 1330
505 nmdc:mga0yw44_3398_c1 3300050492 Bacteria 3616
506 nmdc:mga0yw44_586967_c1 3300050492 Bacteria 757
507 nmdc:mga0k408_30823_c1 3300050493 Bacteria 3060
508 nmdc:mga0k408_3957_c1 3300050493 Bacteria 7171
509 nmdc:mga06z11_84407_c1 3300050494 Bacteria 1359
510 nmdc:mga07m45_72978_c1 3300050496 Bacteria 1954
511 nmdc:mga09592_52676_c1 3300050508 Bacteria 3434
512 nmdc:mga06r32_239430_c1 3300050510 Bacteria 1802
513 nmdc:mga08x19_189461_c1 3300050514 Bacteria 1407
514 nmdc:mga0sz30_120_c1 3300050516 Bacteria 29116
515 Ga0495619_0514202 3300053085 Bacteria 823
516 Ga0500641_0001723 3300053096 Bacteria 7779
517 Ga0500560_000918 3300053107 Bacteria 4646
518 Ga0500560_001758 3300053107 Bacteria 3897
519 Ga0500569_097138 3300053109 Bacteria 961
520 Ga0500572_001488 3300053111 Bacteria 6329
521 Ga0500658_0001898 3300053134 Bacteria 8201
522 Ga0500616_0001601 3300053153 Bacteria 21092
523 Ga0500616_0015981 3300053153 Bacteria 4282
524 Ga0500616_0030452 3300053153 Bacteria 2963
525 Ga0500616_0064991 3300053153 Bacteria 1877
526 Ga0500624_001170 3300053157 Bacteria 4784
527 Ga0500636_0000032 3300053177 Bacteria 74084
528 Ga0500636_0009619 3300053177 Bacteria 5626
529 Ga0500552_001444 3300053733 Bacteria 2267
530 Ga0501084_0005468 3300054114 Bacteria 10422
531 Ga0501084_0011377 3300054114 Bacteria 7369
532 Ga0501084_0169982 3300054114 Bacteria 1840
533 Ga0501084_0213048 3300054114 Bacteria 1630
534 Ga0501084_0242261 3300054114 Bacteria 1522
535 Ga0501082_0002802 3300060353 Bacteria 15217
536 Ga0501082_0035644 3300060353 Bacteria 4288
537 Ga0501082_0115722 3300060353 Bacteria 2322
538 Ga0501082_0120199 3300060353 Bacteria 2277
539 Ga0501082_0424413 3300060353 Bacteria 1161
540 Ga0530510_0002668 3300061734 Bacteria 12261
541 Ga0530510_0004584 3300061734 Bacteria 9564
542 Ga0530510_0190855 3300061734 Bacteria 1521

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0400796 Ga0496124_0400796_307_936 192
2 3300048925 Ga0496122_0006028 Ga0496122_0006028_9944_10573 198
3 3300046492 Ga0495585_0061253 Ga0495585_0061253_452_1153 205
4 3300049742 Ga0501080_0184262 Ga0501080_0184262_439_1107 207
5 3300005329 Ga0070683_100389399 Ga0070683_1003893992 208
6 3300006048 Ga0075363_100191730 Ga0075363_1001917302 208
7 3300009148 Ga0105243_10582493 Ga0105243_105824932 208
8 3300039450 Ga0436363_1411444 Ga0436363_1411444_27_656 208
9 3300049571 Ga0501034_0009746 Ga0501034_0009746_251_949 208
10 3300050492 nmdc:mga0yw44_586967_c1 nmdc:mga0yw44_586967_c1_100_729 208
11 3300053153 Ga0500616_0001601 Ga0500616_0001601_6461_7147 208
12 3300053153 Ga0500616_0015981 Ga0500616_0015981_2644_3333 208
13 3300031903 Ga0307407_10049079 Ga0307407_100490792 209
14 3300031911 Ga0307412_10258124 Ga0307412_102581242 209
15 3300032005 Ga0307411_10165385 Ga0307411_101653852 209
16 3300005347 Ga0070668_100183187 Ga0070668_1001831872 210
17 3300005536 Ga0070697_100673267 Ga0070697_1006732671 210
18 3300009148 Ga0105243_10066931 Ga0105243_100669313 210
19 3300009553 Ga0105249_10327125 Ga0105249_103271252 210
20 3300011119 Ga0105246_10032088 Ga0105246_100320884 210
21 3300014326 Ga0157380_10171113 Ga0157380_101711132 210
22 3300025935 Ga0207709_10079825 Ga0207709_100798253 210
23 3300025972 Ga0207668_10238515 Ga0207668_102385152 210
24 3300032005 Ga0307411_10634348 Ga0307411_106343481 210
25 3300046491 Ga0495584_0080050 Ga0495584_0080050_237_938 211
26 3300048921 Ga0496118_0080464 Ga0496118_0080464_926_1696 211
27 3300006177 Ga0075362_10007641 Ga0075362_100076412 212
28 3300006186 Ga0075369_10008013 Ga0075369_100080133 212
29 3300025935 Ga0207709_10195065 Ga0207709_101950652 212
30 3300046558 Ga0495633_0036115 Ga0495633_0036115_1123_1830 212
31 3300046674 Ga0495588_0004768 Ga0495588_0004768_4945_5652 212
32 3300048927 Ga0496124_0009086 Ga0496124_0009086_8736_9443 212
33 3300048929 Ga0496126_0433554 Ga0496126_0433554_36_743 212
34 3300050489 nmdc:mga03683_24495_c1 nmdc:mga03683_24495_c1_877_1584 212
35 3300050491 nmdc:mga00v17_263_c1 nmdc:mga00v17_263_c1_15836_16543 212
36 3300050493 nmdc:mga0k408_30823_c1 nmdc:mga0k408_30823_c1_1930_2637 212
37 3300050516 nmdc:mga0sz30_120_c1 nmdc:mga0sz30_120_c1_19144_19851 212
38 3300053107 Ga0500560_000918 Ga0500560_000918_3411_4118 212
39 3300053107 Ga0500560_001758 Ga0500560_001758_2197_2904 212
40 3300053111 Ga0500572_001488 Ga0500572_001488_3307_4008 212
41 3300053153 Ga0500616_0064991 Ga0500616_0064991_289_984 212
42 3300053157 Ga0500624_001170 Ga0500624_001170_3239_3946 212
43 3300053177 Ga0500636_0000032 Ga0500636_0000032_58280_58981 212
44 3300053177 Ga0500636_0009619 Ga0500636_0009619_296_997 212
45 3300021321 Ga0214542_1017465 Ga0214542_10174655 213
46 3300021327 Ga0214543_1000008 Ga0214543_1000008304 213
47 3300002773 JGI25152J39213_1001788 JGI25152J39213_10017886 214
48 3300003187 JGI25151J46595_10051225 JGI25151J46595_100512252 214
49 3300003771 Ga0055526_1053295 Ga0055526_10532951 214
50 3300003775 Ga0055524_1004841 Ga0055524_10048413 214
51 3300003790 Ga0055528_1012605 Ga0055528_10126052 214
52 3300005262 Ga0065165_1020586 Ga0065165_10205862 214
53 3300005331 Ga0070670_100000061 Ga0070670_10000006129 214
54 3300005347 Ga0070668_100449168 Ga0070668_1004491682 214
55 3300006178 Ga0075367_10000418 Ga0075367_100004187 214
56 3300006353 Ga0075370_10017794 Ga0075370_100177945 214
57 3300007788 Ga0099795_10021327 Ga0099795_100213272 214
58 3300010159 Ga0099796_10007236 Ga0099796_100072364 214
59 3300013104 Ga0157370_10213804 Ga0157370_102138042 214
60 3300025258 Ga0209129_1000050 Ga0209129_1000050118 214
61 3300025258 Ga0209129_1016021 Ga0209129_10160212 214
62 3300025273 Ga0209673_1000033 Ga0209673_1000033117 214
63 3300025292 Ga0209676_1048734 Ga0209676_10487342 214
64 3300025294 Ga0209025_1002759 Ga0209025_100275910 214
65 3300025295 Ga0209564_1005816 Ga0209564_10058167 214
66 3300025295 Ga0209564_1016479 Ga0209564_10164794 214
67 3300025297 Ga0209758_1011142 Ga0209758_10111426 214
68 3300025297 Ga0209758_1023249 Ga0209758_10232493 214
69 3300025299 Ga0209256_1001149 Ga0209256_10011494 214
70 3300025299 Ga0209256_1010664 Ga0209256_10106644 214
71 3300025303 Ga0209051_1038243 Ga0209051_10382432 214
72 3300025925 Ga0207650_10000207 Ga0207650_1000020737 214
73 3300025941 Ga0207711_10370743 Ga0207711_103707432 214
74 3300028794 Ga0307515_10119504 Ga0307515_101195043 214
75 3300035725 Ga0373947_0225207 Ga0373947_0225207_236_940 214
76 3300042007 Ga0439449_0018491 Ga0439449_0018491_43_738 214
77 3300046460 Ga0495638_0078069 Ga0495638_0078069_374_1069 214
78 3300046492 Ga0495585_0013352 Ga0495585_0013352_2105_2806 214
79 3300046507 Ga0495606_0015810 Ga0495606_0015810_4681_5376 214
80 3300046512 Ga0495610_0027974 Ga0495610_0027974_1290_1985 214
81 3300046515 Ga0495620_0023623 Ga0495620_0023623_220_915 214
82 3300046519 Ga0495632_0031399 Ga0495632_0031399_229_924 214
83 3300046522 Ga0495643_0025671 Ga0495643_0025671_1269_1964 214
84 3300046524 Ga0495648_0238978 Ga0495648_0238978_130_831 214
85 3300046542 Ga0495597_0030319 Ga0495597_0030319_772_1467 214
86 3300046616 Ga0495668_0051536 Ga0495668_0051536_94_795 214
87 3300046660 Ga0495625_0033453 Ga0495625_0033453_1786_2487 214
88 3300046660 Ga0495625_0130006 Ga0495625_0130006_886_1581 214
89 3300046665 Ga0495661_0067647 Ga0495661_0067647_1285_1980 214
90 3300046665 Ga0495661_0133315 Ga0495661_0133315_454_1155 214
91 3300046692 Ga0495671_0077299 Ga0495671_0077299_334_1029 214
92 3300046810 Ga0495660_0126246 Ga0495660_0126246_459_1154 214
93 3300047318 Ga0495636_0103467 Ga0495636_0103467_175_870 214
94 3300047443 Ga0495687_022670 Ga0495687_022670_633_1328 214
95 3300047472 Ga0495686_0063819 Ga0495686_0063819_1240_1935 214
96 3300048922 Ga0496119_0165924 Ga0496119_0165924_358_1059 214
97 3300048924 Ga0496121_0240004 Ga0496121_0240004_530_1231 214
98 3300048927 Ga0496124_0000130 Ga0496124_0000130_140446_141147 214
99 3300049459 Ga0495678_133751 Ga0495678_133751_52_747 214
100 3300050496 nmdc:mga07m45_72978_c1 nmdc:mga07m45_72978_c1_942_1643 214
101 3300053109 Ga0500569_097138 Ga0500569_097138_208_903 214
102 3300053134 Ga0500658_0001898 Ga0500658_0001898_1518_2213 214
103 3300053153 Ga0500616_0030452 Ga0500616_0030452_1004_1699 214
104 3300005468 Ga0070707_100006734 Ga0070707_10000673414 215
105 3300005471 Ga0070698_100127533 Ga0070698_1001275332 215
106 3300005536 Ga0070697_100318225 Ga0070697_1003182252 215
107 3300006028 Ga0070717_10003786 Ga0070717_1000378611 215
108 3300025922 Ga0207646_10007660 Ga0207646_100076603 215
109 3300046506 Ga0495583_0050601 Ga0495583_0050601_27_728 215
110 3300049744 Ga0501083_0209612 Ga0501083_0209612_35_730 215
111 3300060353 Ga0501082_0035644 Ga0501082_0035644_17_712 215
112 3300003790 Ga0055528_1012493 Ga0055528_10124932 216
113 3300003791 Ga0055530_10059805 Ga0055530_100598051 216
114 3300003792 Ga0055540_1002133 Ga0055540_10021336 216
115 3300025273 Ga0209673_1003944 Ga0209673_10039443 216
116 3300025297 Ga0209758_1089424 Ga0209758_10894242 216
117 3300025298 Ga0209050_1004258 Ga0209050_10042585 216
118 3300025303 Ga0209051_1000118 Ga0209051_100011869 216
119 3300025304 Ga0209257_1003745 Ga0209257_100374512 216
120 3300031456 Ga0307513_10127962 Ga0307513_101279622 216
121 3300035119 Ga0373956_0096927 Ga0373956_0096927_218_922 216
122 3300035724 Ga0373933_0313548 Ga0373933_0313548_293_997 216
123 3300036401 Ga0373937_0051618 Ga0373937_0051618_199_903 216
124 3300049571 Ga0501034_0818802 Ga0501034_0818802_42_734 216
125 3300049582 Ga0501048_0400699 Ga0501048_0400699_160_864 216
126 3300049823 Ga0501044_0059875 Ga0501044_0059875_375_1067 216
127 3300050492 nmdc:mga0yw44_196858_c1 nmdc:mga0yw44_196858_c1_211_897 216
128 3300009765 Ga0123341_1000260 Ga0123341_100026021 217
129 3300009766 Ga0123342_1011038 Ga0123342_101103812 217
130 3300049571 Ga0501034_0496002 Ga0501034_0496002_142_831 217
131 3300021358 Ga0213873_10018333 Ga0213873_100183332 218
132 3300039437 Ga0436365_0497119 Ga0436365_0497119_1443_2147 218
133 3300039453 Ga0436362_0281296 Ga0436362_0281296_1068_1772 218
134 3300041404 Ga0439436_0094370 Ga0439436_0094370_12_671 218
135 3300046810 Ga0495660_0168149 Ga0495660_0168149_303_1004 218
136 3300005937 Ga0081455_10017899 Ga0081455_100178992 220
137 3300005937 Ga0081455_10034079 Ga0081455_100340794 220
138 3300009147 Ga0114129_10485677 Ga0114129_104856772 220
139 3300050492 nmdc:mga0yw44_3398_c1 nmdc:mga0yw44_3398_c1_2272_2976 220
140 3300050508 nmdc:mga09592_52676_c1 nmdc:mga09592_52676_c1_1249_1953 220
141 3300050510 nmdc:mga06r32_239430_c1 nmdc:mga06r32_239430_c1_708_1412 220
142 3300005434 Ga0070709_10134202 Ga0070709_101342022 221
143 3300005435 Ga0070714_100119609 Ga0070714_1001196092 221
144 3300005436 Ga0070713_100027047 Ga0070713_1000270473 221
145 3300006028 Ga0070717_10117471 Ga0070717_101174712 221
146 3300014497 Ga0182008_10054802 Ga0182008_100548023 221
147 3300021388 Ga0213875_10001328 Ga0213875_1000132814 221
148 3300025912 Ga0207707_10077556 Ga0207707_100775563 221
149 3300025928 Ga0207700_10003949 Ga0207700_100039495 221
150 3300025929 Ga0207664_10100066 Ga0207664_101000663 221
151 3300035083 Ga0373926_0028768 Ga0373926_0028768_337_1041 221
152 3300035089 Ga0373944_0029620 Ga0373944_0029620_51_764 221
153 3300035170 Ga0373943_0085119 Ga0373943_0085119_326_1030 221
154 3300035171 Ga0373946_0014455 Ga0373946_0014455_1262_1966 221
155 3300035691 Ga0373931_0087537 Ga0373931_0087537_207_911 221
156 3300035692 Ga0373935_0035432 Ga0373935_0035432_1516_2220 221
157 3300037068 Ga0373925_0015042 Ga0373925_0015042_4444_5148 221
158 3300037853 Ga0436364_0065786 Ga0436364_0065786_30038_30742 221
159 3300037853 Ga0436364_0518800 Ga0436364_0518800_1105_1833 221
160 3300039437 Ga0436365_0797875 Ga0436365_0797875_2026_2754 221
161 3300046472 Ga0495580_0048238 Ga0495580_0048238_2154_2858 221
162 3300048915 Ga0496112_0134296 Ga0496112_0134296_1288_1992 221
163 3300050514 nmdc:mga08x19_189461_c1 nmdc:mga08x19_189461_c1_529_1233 221
164 3300049671 Ga0501238_001394 Ga0501238_001394_1763_2458 223
165 iso_pu_bacteria 2519899620 2520376472 223
166 iso_pu_bacteria 2838686498 2838693296 223
167 iso_pu_bacteria 2838729681 2838735290 223
168 iso_pu_bacteria 2838742623 2838748161 223
169 iso_pu_bacteria 2841851746 2841857362 223
170 iso_pu_bacteria 2842163707 2842166836 223
171 iso_pu_bacteria 2842229732 2842235562 223
172 iso_pu_bacteria 2842243621 2842249155 223
173 iso_pu_bacteria 2842257432 2842263110 223
174 iso_pu_bacteria 2842271015 2842277764 223
175 iso_pu_bacteria 2842304105 2842305693 223
176 iso_pu_bacteria 2842357229 2842358917 223
177 iso_pu_bacteria 2842509118 2842514737 223
178 iso_pu_bacteria 2844454524 2844456855 223
179 3300013105 Ga0157369_10554286 Ga0157369_105542862 224
180 iso_pu_bacteria 2529292951 2530647230 225
181 iso_pu_bacteria 2896384573 2896387632 225
182 3300006048 Ga0075363_100163233 Ga0075363_1001632332 226
183 3300006177 Ga0075362_10141082 Ga0075362_101410822 226
184 iso_pu_bacteria 2773857925 2774872902 226
185 iso_pu_bacteria 2842156927 2842162463 226
186 iso_pu_bacteria 2842180545 2842186103 226
187 iso_pu_bacteria 2842780639 2842783264 226
188 iso_pu_bacteria 2894232714 2894232886 226
189 3300005327 Ga0070658_10006529 Ga0070658_100065298 227
190 3300005328 Ga0070676_10240874 Ga0070676_102408742 227
191 3300005336 Ga0070680_100002489 Ga0070680_1000024895 227
192 3300005355 Ga0070671_100291482 Ga0070671_1002914822 227
193 3300005364 Ga0070673_100580569 Ga0070673_1005805692 227
194 3300005364 Ga0070673_100835218 Ga0070673_1008352181 227
195 3300005435 Ga0070714_100405123 Ga0070714_1004051232 227
196 3300005456 Ga0070678_100008820 Ga0070678_1000088205 227
197 3300005458 Ga0070681_10135921 Ga0070681_101359212 227
198 3300005467 Ga0070706_100456092 Ga0070706_1004560922 227
199 3300005471 Ga0070698_100001306 Ga0070698_10000130614 227
200 3300005530 Ga0070679_100052506 Ga0070679_1000525066 227
201 3300005539 Ga0068853_100580446 Ga0068853_1005804462 227
202 3300005548 Ga0070665_100022854 Ga0070665_1000228546 227
203 3300005548 Ga0070665_100098257 Ga0070665_1000982572 227
204 3300005563 Ga0068855_100040062 Ga0068855_1000400626 227
205 3300005577 Ga0068857_100205706 Ga0068857_1002057063 227
206 3300005577 Ga0068857_100893409 Ga0068857_1008934092 227
207 3300005614 Ga0068856_100446610 Ga0068856_1004466102 227
208 3300005614 Ga0068856_100997078 Ga0068856_1009970781 227
209 3300005844 Ga0068862_100230038 Ga0068862_1002300382 227
210 3300005937 Ga0081455_10068714 Ga0081455_100687143 227
211 3300005985 Ga0081539_10076970 Ga0081539_100769702 227
212 3300006177 Ga0075362_10001791 Ga0075362_100017915 227
213 3300006177 Ga0075362_10011418 Ga0075362_100114182 227
214 3300007265 Ga0099794_10034126 Ga0099794_100341263 227
215 3300009093 Ga0105240_10003758 Ga0105240_1000375824 227
216 3300014969 Ga0157376_10844118 Ga0157376_108441182 227
217 3300021441 Ga0213871_10023054 Ga0213871_100230542 227
218 3300025907 Ga0207645_10182112 Ga0207645_101821122 227
219 3300025908 Ga0207643_10093367 Ga0207643_100933673 227
220 3300025909 Ga0207705_10299946 Ga0207705_102999462 227
221 3300025912 Ga0207707_10016488 Ga0207707_100164884 227
222 3300025917 Ga0207660_10011346 Ga0207660_100113466 227
223 3300025919 Ga0207657_10145786 Ga0207657_101457862 227
224 3300025921 Ga0207652_10062296 Ga0207652_100622962 227
225 3300025929 Ga0207664_10384159 Ga0207664_103841592 227
226 3300025931 Ga0207644_10167472 Ga0207644_101674722 227
227 3300025933 Ga0207706_10412583 Ga0207706_104125832 227
228 3300025949 Ga0207667_10077119 Ga0207667_100771193 227
229 3300025960 Ga0207651_10702028 Ga0207651_107020282 227
230 3300025961 Ga0207712_10399435 Ga0207712_103994352 227
231 3300026041 Ga0207639_10858767 Ga0207639_108587671 227
232 3300026078 Ga0207702_10377298 Ga0207702_103772982 227
233 3300026116 Ga0207674_10017712 Ga0207674_100177128 227
234 3300026121 Ga0207683_10019070 Ga0207683_100190706 227
235 3300027671 Ga0209588_1016899 Ga0209588_10168993 227
236 3300028380 Ga0268265_10103069 Ga0268265_101030691 227
237 3300032126 Ga0307415_100312759 Ga0307415_1003127592 227
238 3300037068 Ga0373925_0693544 Ga0373925_0693544_38_724 227
239 3300037418 Ga0395900_0046437 Ga0395900_0046437_2545_3231 227
240 3300037466 Ga0395898_0480138 Ga0395898_0480138_237_923 227
241 3300038443 Ga0395901_0003123 Ga0395901_0003123_10582_11268 227
242 3300038443 Ga0395901_0052236 Ga0395901_0052236_2923_3609 227
243 3300039438 Ga0436360_1148383 Ga0436360_1148383_3840_4526 227
244 3300039447 Ga0436361_0830550 Ga0436361_0830550_682_1368 227
245 3300041413 Ga0439465_0119221 Ga0439465_0119221_130_816 227
246 3300048929 Ga0496126_0037873 Ga0496126_0037873_129_815 227
247 3300049571 Ga0501034_0008960 Ga0501034_0008960_9213_9899 227
248 3300049571 Ga0501034_0510767 Ga0501034_0510767_78_764 227
249 3300050491 nmdc:mga00v17_238233_c1 nmdc:mga00v17_238233_c1_376_1062 227
250 3300050492 nmdc:mga0yw44_110948_c1 nmdc:mga0yw44_110948_c1_412_1098 227
251 3300050492 nmdc:mga0yw44_161274_c1 nmdc:mga0yw44_161274_c1_37_723 227
252 3300050494 nmdc:mga06z11_84407_c1 nmdc:mga06z11_84407_c1_612_1298 227
253 3300053096 Ga0500641_0001723 Ga0500641_0001723_5829_6515 227
254 3300053733 Ga0500552_001444 Ga0500552_001444_1207_1896 227
255 iso_pu_bacteria 2508501114 2509077857 227
256 iso_pu_bacteria 2513237144 2513912843 227
257 iso_pu_bacteria 2513237146 2513928631 227
258 iso_pu_bacteria 2599185170 2599420017 227
259 iso_pu_bacteria 2643221736 2644746906 227
260 iso_pu_bacteria 2835312727 2835316274 227
261 iso_pu_bacteria 2838035591 2838040224 227
262 iso_pu_bacteria 2838661181 2838667040 227
263 iso_pu_bacteria 2841760612 2841762355 227
264 iso_pu_bacteria 2844104063 2844109893 227
265 iso_pu_bacteria 2851182111 2851186922 227
266 iso_pu_bacteria 2851246043 2851248368 227
267 iso_pu_bacteria 2882456835 2882457942 227
268 iso_pu_bacteria 2884298095 2884300863 227
269 iso_pu_bacteria 2933016740 2933018610 227
270 iso_pu_bacteria 8057529695 8057535492 227
271 iso_pu_bacteria 2509276021 2509389285 228
272 iso_pu_bacteria 2509276033 2509446323 228
273 iso_pu_bacteria 2510461076 2510896828 228
274 iso_pu_bacteria 2510917028 2511182946 228
275 iso_pu_bacteria 2513237088 2513596943 228
276 iso_pu_bacteria 2513237093 2513634966 228
277 iso_pu_bacteria 2513237103 2513711474 228
278 iso_pu_bacteria 2513237138 2513865202 228
279 iso_pu_bacteria 2513237162 2514019538 228
280 iso_pu_bacteria 2515075009 2515114545 228
281 iso_pu_bacteria 2515154114 2515644399 228
282 iso_pu_bacteria 2515154116 2515657521 228
283 iso_pu_bacteria 2515154134 2515741726 228
284 iso_pu_bacteria 2516653085 2517078464 228
285 iso_pu_bacteria 2517093000 2517097203 228
286 iso_pu_bacteria 2524023209 2524461138 228
287 iso_pu_bacteria 2582581294 2585201613 228
288 iso_pu_bacteria 2582581299 2585233470 228
289 iso_pu_bacteria 2582581306 2585269653 228
290 iso_pu_bacteria 2582581865 2585388683 228
291 iso_pu_bacteria 2582581866 2585392531 228
292 iso_pu_bacteria 2585427526 2585529238 228
293 iso_pu_bacteria 2585427528 2585543054 228
294 iso_pu_bacteria 2585427593 2585839177 228
295 iso_pu_bacteria 2585427594 2585845011 228
296 iso_pu_bacteria 2615840624 2616297445 228
297 iso_pu_bacteria 2643221558 2643813872 228
298 iso_pu_bacteria 2643221643 2644240388 228
299 iso_pu_bacteria 2718217927 2719387801 228
300 iso_pu_bacteria 2718218423 2721401434 228
301 iso_pu_bacteria 2721755809 2724040248 228
302 iso_pu_bacteria 2724679232 2725945732 228
303 iso_pu_bacteria 2738541333 2739037750 228
304 iso_pu_bacteria 2791355256 2793295512 228
305 iso_pu_bacteria 2791355259 2793317617 228
306 iso_pu_bacteria 2791355262 2793332354 228
307 iso_pu_bacteria 2791355263 2793338948 228
308 iso_pu_bacteria 2791355265 2793356110 228
309 iso_pu_bacteria 2791355266 2793359255 228
310 iso_pu_bacteria 2791355267 2793366022 228
311 iso_pu_bacteria 2802429606 2805934056 228
312 iso_pu_bacteria 2802429633 2806047706 228
313 iso_pu_bacteria 2802429634 2806055282 228
314 iso_pu_bacteria 2802429635 2806062163 228
315 iso_pu_bacteria 2802429636 2806070078 228
316 iso_pu_bacteria 2802429637 2806076622 228
317 iso_pu_bacteria 2838042994 2838046702 228
318 iso_pu_bacteria 2838048938 2838050935 228
319 iso_pu_bacteria 2838680041 2838683758 228
320 iso_pu_bacteria 2838694306 2838698286 228
321 iso_pu_bacteria 2838707686 2838711401 228
322 iso_pu_bacteria 2841864319 2841867633 228
323 iso_pu_bacteria 2842077413 2842081202 228
324 iso_pu_bacteria 2842118031 2842122021 228
325 iso_pu_bacteria 2842205361 2842207537 228
326 iso_pu_bacteria 2842217011 2842221908 228
327 iso_pu_bacteria 2842237096 2842241035 228
328 iso_pu_bacteria 2842278818 2842280752 228
329 iso_pu_bacteria 2842285085 2842288637 228
330 iso_pu_bacteria 2842291075 2842294859 228
331 iso_pu_bacteria 2842298080 2842302581 228
332 iso_pu_bacteria 2842341865 2842346819 228
333 iso_pu_bacteria 2842363717 2842366148 228
334 iso_pu_bacteria 2842370503 2842375123 228
335 iso_pu_bacteria 2842377471 2842381258 228
336 iso_pu_bacteria 2842384541 2842388328 228
337 iso_pu_bacteria 2842395702 2842395817 228
338 iso_pu_bacteria 2842402390 2842406017 228
339 iso_pu_bacteria 2842409023 2842412601 228
340 iso_pu_bacteria 2842415677 2842419520 228
341 iso_pu_bacteria 2852387548 2852392055 228
342 iso_pu_bacteria 2933570622 2933572199 228
343 iso_pu_bacteria 2935894831 2935898062 228
344 iso_pu_bacteria 2936381700 2936381818 228
345 iso_pu_bacteria 2996893221 2996896127 228
346 iso_pu_bacteria 3005409236 3005415916 228
347 iso_pu_bacteria 639633055 639650563 228
348 iso_pu_bacteria 8005275841 8005282559 228
349 iso_pu_bacteria 8005307578 8005309650 228
350 iso_pu_bacteria 8005460587 8005465238 228
351 iso_pu_bacteria 8005570704 8005571973 228
352 iso_pu_bacteria 8005695170 8005695873 228
353 iso_pu_bacteria 8018127388 8018128714 228
354 iso_pu_bacteria 8018176218 8018177599 228
355 iso_pu_bacteria 8023680758 8023686681 228
356 iso_pu_bacteria 8046767195 8046768417 228
357 iso_pu_bacteria 8056375014 8056380534 228
358 iso_pu_bacteria 8056382006 8056383407 228
359 iso_pu_bacteria 8057575449 8057581914 228
360 iso_pu_bacteria 8057874678 8057879418 228
361 3300009098 Ga0105245_10892742 Ga0105245_108927422 229
362 3300009148 Ga0105243_10329322 Ga0105243_103293222 229
363 3300010375 Ga0105239_10475738 Ga0105239_104757382 229
364 3300032002 Ga0307416_100209196 Ga0307416_1002091963 229
365 3300032005 Ga0307411_10335583 Ga0307411_103355832 229
366 3300032126 Ga0307415_100035445 Ga0307415_1000354453 229
367 3300041413 Ga0439465_0000941 Ga0439465_0000941_8285_9037 229
368 3300042004 Ga0439445_0049949 Ga0439445_0049949_195_947 229
369 3300042006 Ga0439432_037626 Ga0439432_037626_33_785 229
370 3300042007 Ga0439449_0039879 Ga0439449_0039879_654_1406 229
371 3300049575 Ga0501039_0223604 Ga0501039_0223604_641_1333 229
372 3300049587 Ga0501071_0451795 Ga0501071_0451795_270_962 229
373 3300050493 nmdc:mga0k408_3957_c1 nmdc:mga0k408_3957_c1_193_885 229
374 iso_pu_bacteria 2510065019 2510135375 229
375 iso_pu_bacteria 2513237084 2513572930 229
376 iso_pu_bacteria 2516653077 2517038186 229
377 iso_pu_bacteria 2765235942 2766064133 229
378 iso_pu_bacteria 2842110456 2842116546 229
379 iso_pu_bacteria 2857516855 2857519711 229
380 iso_pu_bacteria 2933586486 2933592847 229
381 iso_pu_bacteria 2936367885 2936370030 229
382 iso_pu_bacteria 2936375103 2936379206 229
383 iso_pu_bacteria 8005376324 8005381440 229
384 iso_pu_bacteria 8005556819 8005561302 229
385 iso_pu_bacteria 8005563573 8005565925 229
386 iso_pu_bacteria 8024479707 8024484500 229
387 3300002077 JGI24744J21845_10013276 JGI24744J21845_100132761 230
388 3300003771 Ga0055526_1000202 Ga0055526_100020221 230
389 3300003775 Ga0055524_1000144 Ga0055524_100014439 230
390 3300005262 Ga0065165_1000393 Ga0065165_100039338 230
391 3300005327 Ga0070658_10022683 Ga0070658_100226832 230
392 3300005328 Ga0070676_10005980 Ga0070676_100059806 230
393 3300005329 Ga0070683_100151465 Ga0070683_1001514652 230
394 3300005330 Ga0070690_100048793 Ga0070690_1000487935 230
395 3300005331 Ga0070670_100016489 Ga0070670_1000164894 230
396 3300005335 Ga0070666_10029451 Ga0070666_100294515 230
397 3300005336 Ga0070680_100042741 Ga0070680_1000427412 230
398 3300005337 Ga0070682_100002624 Ga0070682_1000026243 230
399 3300005339 Ga0070660_100002918 Ga0070660_1000029188 230
400 3300005340 Ga0070689_100008205 Ga0070689_1000082054 230
401 3300005341 Ga0070691_10002663 Ga0070691_100026633 230
402 3300005343 Ga0070687_100002871 Ga0070687_1000028718 230
403 3300005344 Ga0070661_100001269 Ga0070661_10000126911 230
404 3300005345 Ga0070692_10001461 Ga0070692_1000146110 230
405 3300005345 Ga0070692_10032335 Ga0070692_100323354 230
406 3300005347 Ga0070668_100057296 Ga0070668_1000572963 230
407 3300005353 Ga0070669_100008503 Ga0070669_1000085033 230
408 3300005354 Ga0070675_100105008 Ga0070675_1001050082 230
409 3300005355 Ga0070671_100021552 Ga0070671_1000215524 230
410 3300005356 Ga0070674_100010365 Ga0070674_1000103653 230
411 3300005364 Ga0070673_100015800 Ga0070673_1000158007 230
412 3300005365 Ga0070688_100006488 Ga0070688_1000064889 230
413 3300005366 Ga0070659_100287181 Ga0070659_1002871811 230
414 3300005367 Ga0070667_100005375 Ga0070667_1000053758 230
415 3300005367 Ga0070667_100509062 Ga0070667_1005090622 230
416 3300005434 Ga0070709_10005506 Ga0070709_100055064 230
417 3300005435 Ga0070714_100018241 Ga0070714_1000182414 230
418 3300005435 Ga0070714_100169176 Ga0070714_1001691762 230
419 3300005435 Ga0070714_100275499 Ga0070714_1002754992 230
420 3300005436 Ga0070713_100011376 Ga0070713_1000113763 230
421 3300005436 Ga0070713_100033540 Ga0070713_1000335403 230
422 3300005436 Ga0070713_100263955 Ga0070713_1002639552 230
423 3300005436 Ga0070713_100644162 Ga0070713_1006441622 230
424 3300005437 Ga0070710_10008479 Ga0070710_100084793 230
425 3300005438 Ga0070701_10004911 Ga0070701_100049117 230
426 3300005439 Ga0070711_100002373 Ga0070711_1000023738 230
427 3300005439 Ga0070711_100004371 Ga0070711_1000043715 230
428 3300005439 Ga0070711_100177537 Ga0070711_1001775372 230
429 3300005440 Ga0070705_100003239 Ga0070705_1000032397 230
430 3300005441 Ga0070700_100013579 Ga0070700_1000135793 230
431 3300005444 Ga0070694_100024108 Ga0070694_1000241084 230
432 3300005455 Ga0070663_100030921 Ga0070663_1000309214 230
433 3300005456 Ga0070678_100043538 Ga0070678_1000435382 230
434 3300005457 Ga0070662_100005948 Ga0070662_1000059489 230
435 3300005457 Ga0070662_100421427 Ga0070662_1004214272 230
436 3300005458 Ga0070681_10161616 Ga0070681_101616162 230
437 3300005459 Ga0068867_100092852 Ga0068867_1000928522 230
438 3300005466 Ga0070685_10013900 Ga0070685_100139003 230
439 3300005467 Ga0070706_100023669 Ga0070706_1000236695 230
440 3300005468 Ga0070707_100055362 Ga0070707_1000553623 230
441 3300005530 Ga0070679_100019879 Ga0070679_1000198794 230
442 3300005535 Ga0070684_100010433 Ga0070684_1000104334 230
443 3300005536 Ga0070697_100007900 Ga0070697_1000079005 230
444 3300005539 Ga0068853_100001909 Ga0068853_1000019096 230
445 3300005543 Ga0070672_100008242 Ga0070672_1000082426 230
446 3300005544 Ga0070686_100045315 Ga0070686_1000453151 230
447 3300005545 Ga0070695_100010224 Ga0070695_1000102249 230
448 3300005546 Ga0070696_100004768 Ga0070696_1000047689 230
449 3300005546 Ga0070696_100086386 Ga0070696_1000863862 230
450 3300005547 Ga0070693_100001532 Ga0070693_1000015329 230
451 3300005548 Ga0070665_100044241 Ga0070665_1000442412 230
452 3300005549 Ga0070704_100007835 Ga0070704_1000078356 230
453 3300005563 Ga0068855_100062494 Ga0068855_1000624944 230
454 3300005564 Ga0070664_100005241 Ga0070664_1000052419 230
455 3300005577 Ga0068857_100011135 Ga0068857_1000111359 230
456 3300005578 Ga0068854_100016106 Ga0068854_1000161064 230
457 3300005614 Ga0068856_100022882 Ga0068856_1000228825 230
458 3300005614 Ga0068856_100045829 Ga0068856_1000458292 230
459 3300005615 Ga0070702_100000110 Ga0070702_10000011021 230
460 3300005615 Ga0070702_100408255 Ga0070702_1004082552 230
461 3300005616 Ga0068852_100016633 Ga0068852_1000166333 230
462 3300005617 Ga0068859_100047063 Ga0068859_1000470634 230
463 3300005618 Ga0068864_100006128 Ga0068864_1000061285 230
464 3300005718 Ga0068866_10019633 Ga0068866_100196332 230
465 3300005719 Ga0068861_100004689 Ga0068861_1000046897 230
466 3300005841 Ga0068863_100003256 Ga0068863_10000325616 230
467 3300005842 Ga0068858_100012407 Ga0068858_1000124073 230
468 3300005843 Ga0068860_100038778 Ga0068860_1000387783 230
469 3300005844 Ga0068862_100001176 Ga0068862_10000117621 230
470 3300006028 Ga0070717_10035079 Ga0070717_100350794 230
471 3300006038 Ga0075365_10226495 Ga0075365_102264952 230
472 3300006038 Ga0075365_10486578 Ga0075365_104865782 230
473 3300006163 Ga0070715_10042047 Ga0070715_100420472 230
474 3300006173 Ga0070716_100000813 Ga0070716_1000008139 230
475 3300006175 Ga0070712_100003324 Ga0070712_1000033249 230
476 3300006237 Ga0097621_100077120 Ga0097621_1000771202 230
477 3300006881 Ga0068865_100016645 Ga0068865_1000166454 230
478 3300006914 Ga0075436_100094225 Ga0075436_1000942252 230
479 3300006931 Ga0097620_100047065 Ga0097620_1000470654 230
480 3300009098 Ga0105245_10013417 Ga0105245_100134176 230
481 3300009101 Ga0105247_10131427 Ga0105247_101314272 230
482 3300009148 Ga0105243_10008677 Ga0105243_100086776 230
483 3300009174 Ga0105241_10010650 Ga0105241_100106505 230
484 3300009176 Ga0105242_10017182 Ga0105242_100171824 230
485 3300009177 Ga0105248_10004856 Ga0105248_1000485613 230
486 3300009545 Ga0105237_10004828 Ga0105237_1000482811 230
487 3300009553 Ga0105249_10000914 Ga0105249_1000091422 230
488 3300010375 Ga0105239_10042206 Ga0105239_100422064 230
489 3300011119 Ga0105246_10099578 Ga0105246_100995782 230
490 3300012487 Ga0157321_1000150 Ga0157321_10001503 230
491 3300013102 Ga0157371_10002409 Ga0157371_1000240915 230
492 3300013105 Ga0157369_10010257 Ga0157369_100102573 230
493 3300013296 Ga0157374_10019924 Ga0157374_100199245 230
494 3300013297 Ga0157378_10017362 Ga0157378_100173626 230
495 3300013306 Ga0163162_10063947 Ga0163162_100639473 230
496 3300013306 Ga0163162_11189620 Ga0163162_111896202 230
497 3300013307 Ga0157372_10019029 Ga0157372_100190299 230
498 3300013308 Ga0157375_10005142 Ga0157375_100051426 230
499 3300014326 Ga0157380_10013155 Ga0157380_100131555 230
500 3300014745 Ga0157377_10020367 Ga0157377_100203672 230
501 3300014968 Ga0157379_10003396 Ga0157379_1000339611 230
502 3300017792 Ga0163161_10002750 Ga0163161_1000275012 230
503 3300021388 Ga0213875_10000382 Ga0213875_1000038215 230
504 3300025273 Ga0209673_1013749 Ga0209673_10137492 230
505 3300025284 Ga0209130_1000061 Ga0209130_100006140 230
506 3300025291 Ga0209675_1003298 Ga0209675_10032985 230
507 3300025294 Ga0209025_1000014 Ga0209025_1000014544 230
508 3300025294 Ga0209025_1014200 Ga0209025_10142004 230
509 3300025294 Ga0209025_1040858 Ga0209025_10408582 230
510 3300025295 Ga0209564_1000187 Ga0209564_100018749 230
511 3300025299 Ga0209256_1000055 Ga0209256_1000055242 230
512 3300025302 Ga0207426_1020488 Ga0207426_10204883 230
513 3300025315 Ga0207697_10046742 Ga0207697_100467422 230
514 3300025900 Ga0207710_10016320 Ga0207710_100163202 230
515 3300025904 Ga0207647_10019501 Ga0207647_100195012 230
516 3300025905 Ga0207685_10002027 Ga0207685_100020274 230
517 3300025906 Ga0207699_10005612 Ga0207699_100056125 230
518 3300025906 Ga0207699_10044035 Ga0207699_100440352 230
519 3300025907 Ga0207645_10003136 Ga0207645_1000313611 230
520 3300025909 Ga0207705_10050469 Ga0207705_100504691 230
521 3300025911 Ga0207654_10058148 Ga0207654_100581482 230
522 3300025914 Ga0207671_10014576 Ga0207671_100145766 230
523 3300025915 Ga0207693_10000133 Ga0207693_1000013369 230
524 3300025915 Ga0207693_10012635 Ga0207693_100126352 230
525 3300025915 Ga0207693_10154484 Ga0207693_101544842 230
526 3300025915 Ga0207693_10261235 Ga0207693_102612352 230
527 3300025916 Ga0207663_10066927 Ga0207663_100669271 230
528 3300025916 Ga0207663_10069610 Ga0207663_100696102 230
529 3300025916 Ga0207663_10131305 Ga0207663_101313052 230
530 3300025916 Ga0207663_10152667 Ga0207663_101526671 230
531 3300025917 Ga0207660_10031253 Ga0207660_100312533 230
532 3300025917 Ga0207660_10447087 Ga0207660_104470872 230
533 3300025918 Ga0207662_10001646 Ga0207662_100016463 230
534 3300025919 Ga0207657_10001128 Ga0207657_1000112817 230
535 3300025920 Ga0207649_10004890 Ga0207649_100048907 230
536 3300025922 Ga0207646_10021237 Ga0207646_100212375 230
537 3300025923 Ga0207681_10048910 Ga0207681_100489104 230
538 3300025925 Ga0207650_10048517 Ga0207650_100485172 230
539 3300025926 Ga0207659_10021784 Ga0207659_100217842 230
540 3300025927 Ga0207687_10007754 Ga0207687_100077544 230
541 3300025928 Ga0207700_10038709 Ga0207700_100387092 230
542 3300025928 Ga0207700_10047814 Ga0207700_100478143 230
543 3300025928 Ga0207700_10083677 Ga0207700_100836772 230
544 3300025928 Ga0207700_10120552 Ga0207700_101205522 230
545 3300025928 Ga0207700_10219804 Ga0207700_102198041 230
546 3300025928 Ga0207700_10253128 Ga0207700_102531282 230
547 3300025929 Ga0207664_10053300 Ga0207664_100533002 230
548 3300025929 Ga0207664_10072720 Ga0207664_100727202 230
549 3300025931 Ga0207644_10057756 Ga0207644_100577562 230
550 3300025932 Ga0207690_10014673 Ga0207690_100146734 230
551 3300025933 Ga0207706_10000195 Ga0207706_1000019572 230
552 3300025934 Ga0207686_10010765 Ga0207686_100107654 230
553 3300025936 Ga0207670_10101280 Ga0207670_101012803 230
554 3300025936 Ga0207670_10206563 Ga0207670_102065632 230
555 3300025937 Ga0207669_10005710 Ga0207669_100057104 230
556 3300025938 Ga0207704_10038802 Ga0207704_100388023 230
557 3300025939 Ga0207665_10000068 Ga0207665_100000687 230
558 3300025940 Ga0207691_10022804 Ga0207691_100228043 230
559 3300025941 Ga0207711_10051281 Ga0207711_100512814 230
560 3300025944 Ga0207661_10136930 Ga0207661_101369302 230
561 3300025945 Ga0207679_10129779 Ga0207679_101297792 230
562 3300025949 Ga0207667_10030011 Ga0207667_100300116 230
563 3300025960 Ga0207651_10011247 Ga0207651_100112474 230
564 3300025961 Ga0207712_10050265 Ga0207712_100502654 230
565 3300025972 Ga0207668_10009155 Ga0207668_100091554 230
566 3300025981 Ga0207640_10011399 Ga0207640_100113993 230
567 3300025986 Ga0207658_10040692 Ga0207658_100406922 230
568 3300026035 Ga0207703_10032061 Ga0207703_100320615 230
569 3300026041 Ga0207639_10022144 Ga0207639_100221443 230
570 3300026067 Ga0207678_10000128 Ga0207678_1000012831 230
571 3300026075 Ga0207708_10009009 Ga0207708_100090093 230
572 3300026075 Ga0207708_10078163 Ga0207708_100781632 230
573 3300026078 Ga0207702_10016712 Ga0207702_1001671210 230
574 3300026078 Ga0207702_10040366 Ga0207702_100403663 230
575 3300026095 Ga0207676_10029203 Ga0207676_100292032 230
576 3300026116 Ga0207674_10000779 Ga0207674_1000077917 230
577 3300026118 Ga0207675_100111144 Ga0207675_1001111444 230
578 3300026121 Ga0207683_10017091 Ga0207683_100170915 230
579 3300026142 Ga0207698_10883393 Ga0207698_108833931 230
580 3300027671 Ga0209588_1088279 Ga0209588_10882792 230
581 3300027907 Ga0207428_10130558 Ga0207428_101305582 230
582 3300028379 Ga0268266_10009593 Ga0268266_100095934 230
583 3300028379 Ga0268266_10122557 Ga0268266_101225572 230
584 3300028380 Ga0268265_10017111 Ga0268265_100171111 230
585 3300028381 Ga0268264_10018642 Ga0268264_1001864210 230
586 3300028381 Ga0268264_10504698 Ga0268264_105046982 230
587 3300028577 Ga0265318_10010199 Ga0265318_100101992 230
588 3300031240 Ga0265320_10214421 Ga0265320_102144212 230
589 3300035112 Ga0373932_0004774 Ga0373932_0004774_908_1600 230
590 3300035170 Ga0373943_0394458 Ga0373943_0394458_20_724 230
591 3300035691 Ga0373931_0013189 Ga0373931_0013189_794_1486 230
592 3300037068 Ga0373925_0283188 Ga0373925_0283188_268_972 230
593 3300037853 Ga0436364_0042928 Ga0436364_0042928_41574_42278 230
594 3300039437 Ga0436365_1830300 Ga0436365_1830300_183_878 230
595 3300039438 Ga0436360_0007794 Ga0436360_0007794_116_814 230
596 3300039438 Ga0436360_1369805 Ga0436360_1369805_65_763 230
597 3300039447 Ga0436361_0943746 Ga0436361_0943746_56_754 230
598 3300046506 Ga0495583_0178265 Ga0495583_0178265_120_815 230
599 3300046511 Ga0495608_0269315 Ga0495608_0269315_284_985 230
600 3300046536 Ga0495587_0315285 Ga0495587_0315285_40_741 230
601 3300046683 Ga0495658_0001152 Ga0495658_0001152_10133_10834 230
602 3300048903 Ga0496100_0097862 Ga0496100_0097862_130_822 230
603 3300048904 Ga0496101_0078631 Ga0496101_0078631_1391_2083 230
604 3300048905 Ga0496102_0175855 Ga0496102_0175855_130_822 230
605 3300048905 Ga0496102_0271045 Ga0496102_0271045_101_796 230
606 3300048906 Ga0496103_0030105 Ga0496103_0030105_1546_2238 230
607 3300048907 Ga0496104_0018902 Ga0496104_0018902_2546_3238 230
608 3300048908 Ga0496105_0074129 Ga0496105_0074129_891_1583 230
609 3300048909 Ga0496106_0037145 Ga0496106_0037145_2546_3238 230
610 3300048909 Ga0496106_0086941 Ga0496106_0086941_1329_2024 230
611 3300048910 Ga0496107_0028475 Ga0496107_0028475_3021_3713 230
612 3300048910 Ga0496107_0556115 Ga0496107_0556115_122_817 230
613 3300048911 Ga0496108_0039012 Ga0496108_0039012_1418_2110 230
614 3300048911 Ga0496108_0719674 Ga0496108_0719674_48_743 230
615 3300048912 Ga0496109_0055034 Ga0496109_0055034_1919_2611 230
616 3300048912 Ga0496109_0101585 Ga0496109_0101585_1189_1884 230
617 3300048913 Ga0496110_0038422 Ga0496110_0038422_3216_3908 230
618 3300048913 Ga0496110_0390330 Ga0496110_0390330_551_1246 230
619 3300048913 Ga0496110_0440538 Ga0496110_0440538_429_1133 230
620 3300048914 Ga0496111_0062526 Ga0496111_0062526_258_950 230
621 3300048914 Ga0496111_0076732 Ga0496111_0076732_1133_1828 230
622 3300048915 Ga0496112_0126917 Ga0496112_0126917_412_1104 230
623 3300048916 Ga0496113_0052700 Ga0496113_0052700_2055_2759 230
624 3300048916 Ga0496113_0055250 Ga0496113_0055250_2026_2718 230
625 3300048916 Ga0496113_0166157 Ga0496113_0166157_197_892 230
626 3300048917 Ga0496114_0208714 Ga0496114_0208714_891_1583 230
627 3300048918 Ga0496115_0102150 Ga0496115_0102150_258_950 230
628 3300048920 Ga0496117_0075984 Ga0496117_0075984_667_1365 230
629 3300049571 Ga0501034_0024480 Ga0501034_0024480_5165_5866 230
630 3300049571 Ga0501034_0098476 Ga0501034_0098476_1839_2537 230
631 3300049572 Ga0501036_0009582 Ga0501036_0009582_4244_4945 230
632 3300049572 Ga0501036_0012973 Ga0501036_0012973_5796_6497 230
633 3300049573 Ga0501037_0170671 Ga0501037_0170671_359_1057 230
634 3300049574 Ga0501038_0001082 Ga0501038_0001082_2744_3445 230
635 3300049575 Ga0501039_0000168 Ga0501039_0000168_4542_5243 230
636 3300049576 Ga0501040_0001149 Ga0501040_0001149_11459_12160 230
637 3300049576 Ga0501040_0016387 Ga0501040_0016387_70_771 230
638 3300049577 Ga0501041_0000623 Ga0501041_0000623_6197_6898 230
639 3300049578 Ga0501042_0007758 Ga0501042_0007758_1826_2527 230
640 3300049579 Ga0501043_0155073 Ga0501043_0155073_636_1337 230
641 3300049580 Ga0501046_0000480 Ga0501046_0000480_16318_17019 230
642 3300049582 Ga0501048_0000896 Ga0501048_0000896_8502_9203 230
643 3300049582 Ga0501048_0063986 Ga0501048_0063986_1746_2447 230
644 3300049583 Ga0501067_0040015 Ga0501067_0040015_1078_1776 230
645 3300049586 Ga0501070_0337576 Ga0501070_0337576_150_851 230
646 3300049587 Ga0501071_0006119 Ga0501071_0006119_3911_4612 230
647 3300049587 Ga0501071_0238458 Ga0501071_0238458_457_1158 230
648 3300049588 Ga0501072_0002754 Ga0501072_0002754_8456_9157 230
649 3300049588 Ga0501072_0021236 Ga0501072_0021236_1069_1770 230
650 3300049588 Ga0501072_0052612 Ga0501072_0052612_2315_3016 230
651 3300049590 Ga0501074_0017319 Ga0501074_0017319_583_1284 230
652 3300049590 Ga0501074_0205519 Ga0501074_0205519_613_1317 230
653 3300049591 Ga0501075_0000046 Ga0501075_0000046_6102_6803 230
654 3300049591 Ga0501075_0206837 Ga0501075_0206837_269_970 230
655 3300049592 Ga0501076_0000566 Ga0501076_0000566_14550_15251 230
656 3300049592 Ga0501076_0148292 Ga0501076_0148292_169_867 230
657 3300049593 Ga0501077_0004492 Ga0501077_0004492_4239_4940 230
658 3300049593 Ga0501077_0058409 Ga0501077_0058409_1057_1755 230
659 3300049741 Ga0501079_0000808 Ga0501079_0000808_4813_5514 230
660 3300049742 Ga0501080_0031560 Ga0501080_0031560_4057_4758 230
661 3300049742 Ga0501080_0087780 Ga0501080_0087780_2104_2805 230
662 3300049742 Ga0501080_0654637 Ga0501080_0654637_66_764 230
663 3300049743 Ga0501081_0005566 Ga0501081_0005566_3211_3912 230
664 3300049743 Ga0501081_0011120 Ga0501081_0011120_2361_3062 230
665 3300049822 Ga0501035_0156603 Ga0501035_0156603_1191_1892 230
666 3300049823 Ga0501044_0020009 Ga0501044_0020009_1735_2436 230
667 3300049824 Ga0501045_0004353 Ga0501045_0004353_8515_9216 230
668 3300049824 Ga0501045_0043187 Ga0501045_0043187_753_1454 230
669 3300049824 Ga0501045_0063202 Ga0501045_0063202_461_1162 230
670 3300053085 Ga0495619_0514202 Ga0495619_0514202_103_807 230
671 3300054114 Ga0501084_0005468 Ga0501084_0005468_4726_5427 230
672 3300054114 Ga0501084_0011377 Ga0501084_0011377_1109_1807 230
673 3300054114 Ga0501084_0169982 Ga0501084_0169982_599_1297 230
674 3300054114 Ga0501084_0213048 Ga0501084_0213048_303_1004 230
675 3300054114 Ga0501084_0242261 Ga0501084_0242261_464_1165 230
676 3300060353 Ga0501082_0002802 Ga0501082_0002802_2935_3636 230
677 3300060353 Ga0501082_0115722 Ga0501082_0115722_1148_1846 230
678 3300060353 Ga0501082_0120199 Ga0501082_0120199_351_1052 230
679 3300060353 Ga0501082_0424413 Ga0501082_0424413_128_826 230
680 3300061734 Ga0530510_0002668 Ga0530510_0002668_7589_8290 230
681 3300061734 Ga0530510_0004584 Ga0530510_0004584_213_914 230
682 3300061734 Ga0530510_0190855 Ga0530510_0190855_498_1199 230
683 iso_pu_bacteria 2643221688 2644496460 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

29

214

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.9592 7 216
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.9125 5 217
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8459 7 216
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8367 9 219
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8316 6 216
ID Description Score Start End Superfamily
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9831 3 224 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9744 3 224 1.10.3720.10
af_P9WG13_10_255_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9648 5 218 1.10.3720.10
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9632 6 226 1.10.3720.10
3d31C00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9592 7 216 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A528EAM7-F1-model_v4 Molybdate ABC transporter permease subunit 0.9942 4 171 GO:0005886
GO:0055085
AF-A0A0Q7NJ65-F1-model_v4 Molybdenum transport system permease 0.993 2 229 GO:0005886
GO:0015098
AF-A0A255XIF6-F1-model_v4 Molybdenum transport system permease 0.9928 2 227 GO:0005886
GO:0015098
AF-A0A4Q3HP68-F1-model_v4 Molybdenum transport system permease 0.9919 3 208 GO:0005886
GO:0015098
AF-A0A1Q9APR5-F1-model_v4 Molybdenum transport system permease 0.9918 2 229 GO:0005886
GO:0015098

Feature Viewer

pLDDT pTM Quality
88.9 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map