F474978
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 476 | 542 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300025915|Ga0207693_10154484|Ga0207693_101544842 |
| Length | 260 |
| Sequence | VSWLFAFTPEELTAIRLSLRVAFWAMLGSLPVGVAVALVLSRGRFWGKSLLNVLVHLPLIMPPVVTGYLLLLSFGRKGLIGAFLADTFGIVFAFRWTGAALACAVMGFPLLVRSIRLSLDAVDRRLEAAAGTLGANALWIFLTITLPLILPGIFAGMILSFARALGEFGATITFVSNIPGETQTLPTAIYMLIQVPGGDLAALRLTLVSIAISNPRSCSASISGGXXXSSGSPPVQTTKRAGAHGGQCEATRSASVSASG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 3 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 4 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 5 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 6 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 7 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 8 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 9 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 10 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 11 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 12 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 13 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 14 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 15 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 16 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 17 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 18 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 19 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 20 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 21 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 22 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 23 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 24 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 25 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 26 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 27 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 28 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 29 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 30 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 31 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 32 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 33 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 34 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 35 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 36 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 37 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 38 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 39 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 40 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 41 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 42 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 43 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 44 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 45 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 46 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 47 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 48 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 49 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 50 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 51 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 52 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 53 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 54 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 55 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 56 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 57 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 58 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 59 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 60 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 61 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 62 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 63 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 64 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 65 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 66 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 67 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 68 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 69 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 70 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 71 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 72 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 73 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 74 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 75 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 76 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 77 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 78 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 79 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 80 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 81 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 82 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 83 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 84 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 85 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 86 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 87 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 88 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 89 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 90 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 91 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 92 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 93 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 94 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 95 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 96 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 97 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 98 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 99 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 100 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 101 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 102 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 103 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 104 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 105 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 106 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 107 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 108 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 109 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 110 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 111 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 112 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 113 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 114 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 115 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 116 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 117 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 118 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 119 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 120 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 121 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 122 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 123 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 124 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 125 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 126 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 127 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 128 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 129 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 130 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 131 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 132 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 135 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 136 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 142 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 146 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 153 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 156 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 158 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 159 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 163 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 164 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 168 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 169 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 170 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 171 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 172 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 173 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 174 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 175 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 176 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 177 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 179 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 180 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 184 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 185 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 187 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 188 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 189 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 191 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 192 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 193 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 194 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 195 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 196 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 197 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 198 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 199 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 200 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 201 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 203 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 204 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 205 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 207 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 208 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 209 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 210 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 212 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 213 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 214 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 216 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 217 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 228 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 229 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 230 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 233 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 243 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 248 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 249 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 250 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 251 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 252 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 253 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 254 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 256 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 259 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 262 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 321 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 325 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 326 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 327 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 328 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 329 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 330 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 331 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 332 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 333 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 334 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 335 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 336 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 337 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 338 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 339 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 340 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 341 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 342 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 343 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 344 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 345 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 346 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 347 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 348 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 349 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 350 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 351 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 352 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 353 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 354 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 355 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 356 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 357 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 358 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 359 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 387 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 388 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 392 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 395 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 396 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 397 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 398 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 399 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 400 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 401 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 402 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 403 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 404 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 405 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 406 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 407 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 428 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 437 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 439 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 440 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 441 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 447 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 448 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 449 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 452 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 453 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 454 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 455 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 458 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 459 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 460 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 461 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 462 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 463 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 464 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 465 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 466 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 467 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 468 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 469 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 470 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 471 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 472 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 473 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 474 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 475 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 476 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.36 |
| Metatranscriptomes | 0 |
| Isolates | 20.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.13 |
| Nodule | 16.98 |
| Rhizoplane | 3.95 |
| Rhizosphere | 62.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10013276 | 3300002077 | Bacteria | 1661 |
| 2 | JGI25152J39213_1001788 | 3300002773 | Bacteria | 8743 |
| 3 | JGI25151J46595_10051225 | 3300003187 | Bacteria | 1399 |
| 4 | Ga0055526_1000202 | 3300003771 | Bacteria | 51431 |
| 5 | Ga0055526_1053295 | 3300003771 | Bacteria | 906 |
| 6 | Ga0055524_1000144 | 3300003775 | Bacteria | 84213 |
| 7 | Ga0055524_1004841 | 3300003775 | Bacteria | 6132 |
| 8 | Ga0055528_1012493 | 3300003790 | Bacteria | 3289 |
| 9 | Ga0055528_1012605 | 3300003790 | Bacteria | 3268 |
| 10 | Ga0055530_10059805 | 3300003791 | Bacteria | 853 |
| 11 | Ga0055540_1002133 | 3300003792 | Bacteria | 10794 |
| 12 | Ga0065165_1000393 | 3300005262 | Bacteria | 71081 |
| 13 | Ga0065165_1020586 | 3300005262 | Bacteria | 2317 |
| 14 | Ga0070658_10006529 | 3300005327 | Bacteria | 9463 |
| 15 | Ga0070658_10022683 | 3300005327 | Bacteria | 5038 |
| 16 | Ga0070676_10005980 | 3300005328 | Bacteria | 6497 |
| 17 | Ga0070676_10240874 | 3300005328 | Bacteria | 1203 |
| 18 | Ga0070683_100151465 | 3300005329 | Bacteria | 2199 |
| 19 | Ga0070683_100389399 | 3300005329 | Bacteria | 1329 |
| 20 | Ga0070690_100048793 | 3300005330 | Bacteria | 2697 |
| 21 | Ga0070670_100000061 | 3300005331 | Bacteria | 113254 |
| 22 | Ga0070670_100016489 | 3300005331 | Bacteria | 6343 |
| 23 | Ga0070666_10029451 | 3300005335 | Bacteria | 3610 |
| 24 | Ga0070680_100002489 | 3300005336 | Bacteria | 13648 |
| 25 | Ga0070680_100042741 | 3300005336 | Bacteria | 3678 |
| 26 | Ga0070682_100002624 | 3300005337 | Bacteria | 9935 |
| 27 | Ga0070660_100002918 | 3300005339 | Bacteria | 11774 |
| 28 | Ga0070689_100008205 | 3300005340 | Bacteria | 7341 |
| 29 | Ga0070691_10002663 | 3300005341 | Bacteria | 7954 |
| 30 | Ga0070687_100002871 | 3300005343 | Bacteria | 6585 |
| 31 | Ga0070661_100001269 | 3300005344 | Bacteria | 17747 |
| 32 | Ga0070692_10001461 | 3300005345 | Bacteria | 8599 |
| 33 | Ga0070692_10032335 | 3300005345 | Bacteria | 2630 |
| 34 | Ga0070668_100057296 | 3300005347 | Bacteria | 3010 |
| 35 | Ga0070668_100183187 | 3300005347 | Bacteria | 1712 |
| 36 | Ga0070668_100449168 | 3300005347 | Bacteria | 1108 |
| 37 | Ga0070669_100008503 | 3300005353 | Bacteria | 7326 |
| 38 | Ga0070675_100105008 | 3300005354 | Bacteria | 2384 |
| 39 | Ga0070671_100021552 | 3300005355 | Bacteria | 5263 |
| 40 | Ga0070671_100291482 | 3300005355 | Bacteria | 1389 |
| 41 | Ga0070674_100010365 | 3300005356 | Bacteria | 5631 |
| 42 | Ga0070673_100015800 | 3300005364 | Bacteria | 5316 |
| 43 | Ga0070673_100580569 | 3300005364 | Bacteria | 1021 |
| 44 | Ga0070673_100835218 | 3300005364 | Bacteria | 852 |
| 45 | Ga0070688_100006488 | 3300005365 | Bacteria | 6257 |
| 46 | Ga0070659_100287181 | 3300005366 | Bacteria | 1369 |
| 47 | Ga0070667_100005375 | 3300005367 | Bacteria | 10697 |
| 48 | Ga0070667_100509062 | 3300005367 | Bacteria | 1104 |
| 49 | Ga0070709_10005506 | 3300005434 | Bacteria | 6860 |
| 50 | Ga0070709_10134202 | 3300005434 | Bacteria | 1693 |
| 51 | Ga0070714_100018241 | 3300005435 | Bacteria | 5696 |
| 52 | Ga0070714_100119609 | 3300005435 | Bacteria | 2341 |
| 53 | Ga0070714_100169176 | 3300005435 | Bacteria | 1982 |
| 54 | Ga0070714_100275499 | 3300005435 | Bacteria | 1561 |
| 55 | Ga0070714_100405123 | 3300005435 | Bacteria | 1290 |
| 56 | Ga0070713_100011376 | 3300005436 | Bacteria | 6479 |
| 57 | Ga0070713_100027047 | 3300005436 | Bacteria | 4512 |
| 58 | Ga0070713_100033540 | 3300005436 | Bacteria | 4114 |
| 59 | Ga0070713_100263955 | 3300005436 | Bacteria | 1574 |
| 60 | Ga0070713_100644162 | 3300005436 | Bacteria | 1009 |
| 61 | Ga0070710_10008479 | 3300005437 | Bacteria | 5003 |
| 62 | Ga0070701_10004911 | 3300005438 | Bacteria | 5473 |
| 63 | Ga0070711_100002373 | 3300005439 | Bacteria | 10715 |
| 64 | Ga0070711_100004371 | 3300005439 | Bacteria | 8326 |
| 65 | Ga0070711_100177537 | 3300005439 | Bacteria | 1628 |
| 66 | Ga0070705_100003239 | 3300005440 | Bacteria | 7996 |
| 67 | Ga0070700_100013579 | 3300005441 | Bacteria | 4577 |
| 68 | Ga0070694_100024108 | 3300005444 | Bacteria | 3924 |
| 69 | Ga0070663_100030921 | 3300005455 | Bacteria | 3674 |
| 70 | Ga0070678_100008820 | 3300005456 | Bacteria | 6063 |
| 71 | Ga0070678_100043538 | 3300005456 | Bacteria | 3199 |
| 72 | Ga0070662_100005948 | 3300005457 | Bacteria | 7824 |
| 73 | Ga0070662_100421427 | 3300005457 | Bacteria | 1104 |
| 74 | Ga0070681_10135921 | 3300005458 | Bacteria | 2389 |
| 75 | Ga0070681_10161616 | 3300005458 | Bacteria | 2164 |
| 76 | Ga0068867_100092852 | 3300005459 | Bacteria | 2293 |
| 77 | Ga0070685_10013900 | 3300005466 | Bacteria | 4259 |
| 78 | Ga0070706_100023669 | 3300005467 | Bacteria | 5654 |
| 79 | Ga0070706_100456092 | 3300005467 | Bacteria | 1189 |
| 80 | Ga0070707_100006734 | 3300005468 | Bacteria | 10649 |
| 81 | Ga0070707_100055362 | 3300005468 | Bacteria | 3803 |
| 82 | Ga0070698_100001306 | 3300005471 | Bacteria | 27744 |
| 83 | Ga0070698_100127533 | 3300005471 | Bacteria | 2501 |
| 84 | Ga0070679_100019879 | 3300005530 | Bacteria | 6539 |
| 85 | Ga0070679_100052506 | 3300005530 | Bacteria | 4059 |
| 86 | Ga0070684_100010433 | 3300005535 | Bacteria | 7360 |
| 87 | Ga0070697_100007900 | 3300005536 | Bacteria | 8287 |
| 88 | Ga0070697_100318225 | 3300005536 | Bacteria | 1339 |
| 89 | Ga0070697_100673267 | 3300005536 | Bacteria | 912 |
| 90 | Ga0068853_100001909 | 3300005539 | Bacteria | 15347 |
| 91 | Ga0068853_100580446 | 3300005539 | Bacteria | 1064 |
| 92 | Ga0070672_100008242 | 3300005543 | Bacteria | 7121 |
| 93 | Ga0070686_100045315 | 3300005544 | Bacteria | 2770 |
| 94 | Ga0070695_100010224 | 3300005545 | Bacteria | 5599 |
| 95 | Ga0070696_100004768 | 3300005546 | Bacteria | 9059 |
| 96 | Ga0070696_100086386 | 3300005546 | Bacteria | 2227 |
| 97 | Ga0070693_100001532 | 3300005547 | Bacteria | 10430 |
| 98 | Ga0070665_100022854 | 3300005548 | Bacteria | 6296 |
| 99 | Ga0070665_100044241 | 3300005548 | Bacteria | 4471 |
| 100 | Ga0070665_100098257 | 3300005548 | Bacteria | 2932 |
| 101 | Ga0070704_100007835 | 3300005549 | Bacteria | 6369 |
| 102 | Ga0068855_100040062 | 3300005563 | Bacteria | 5561 |
| 103 | Ga0068855_100062494 | 3300005563 | Bacteria | 4347 |
| 104 | Ga0070664_100005241 | 3300005564 | Bacteria | 10406 |
| 105 | Ga0068857_100011135 | 3300005577 | Bacteria | 7821 |
| 106 | Ga0068857_100205706 | 3300005577 | Bacteria | 1795 |
| 107 | Ga0068857_100893409 | 3300005577 | Bacteria | 852 |
| 108 | Ga0068854_100016106 | 3300005578 | Bacteria | 4973 |
| 109 | Ga0068856_100022882 | 3300005614 | Bacteria | 6078 |
| 110 | Ga0068856_100045829 | 3300005614 | Bacteria | 4306 |
| 111 | Ga0068856_100446610 | 3300005614 | Bacteria | 1314 |
| 112 | Ga0068856_100997078 | 3300005614 | Bacteria | 856 |
| 113 | Ga0070702_100000110 | 3300005615 | Bacteria | 24545 |
| 114 | Ga0070702_100408255 | 3300005615 | Bacteria | 974 |
| 115 | Ga0068852_100016633 | 3300005616 | Bacteria | 5746 |
| 116 | Ga0068859_100047063 | 3300005617 | Bacteria | 4332 |
| 117 | Ga0068864_100006128 | 3300005618 | Bacteria | 9866 |
| 118 | Ga0068866_10019633 | 3300005718 | Bacteria | 3082 |
| 119 | Ga0068861_100004689 | 3300005719 | Bacteria | 9189 |
| 120 | Ga0068863_100003256 | 3300005841 | Bacteria | 16051 |
| 121 | Ga0068858_100012407 | 3300005842 | Bacteria | 8034 |
| 122 | Ga0068860_100038778 | 3300005843 | Bacteria | 4557 |
| 123 | Ga0068862_100001176 | 3300005844 | Bacteria | 24658 |
| 124 | Ga0068862_100230038 | 3300005844 | Bacteria | 1682 |
| 125 | Ga0081455_10017899 | 3300005937 | Bacteria | 6772 |
| 126 | Ga0081455_10034079 | 3300005937 | Bacteria | 4566 |
| 127 | Ga0081455_10068714 | 3300005937 | Bacteria | 2948 |
| 128 | Ga0081539_10076970 | 3300005985 | Bacteria | 1766 |
| 129 | Ga0070717_10003786 | 3300006028 | Bacteria | 10870 |
| 130 | Ga0070717_10035079 | 3300006028 | Bacteria | 4058 |
| 131 | Ga0070717_10117471 | 3300006028 | Bacteria | 2275 |
| 132 | Ga0075365_10226495 | 3300006038 | Bacteria | 1312 |
| 133 | Ga0075365_10486578 | 3300006038 | Bacteria | 872 |
| 134 | Ga0075363_100163233 | 3300006048 | Bacteria | 1262 |
| 135 | Ga0075363_100191730 | 3300006048 | Bacteria | 1166 |
| 136 | Ga0070715_10042047 | 3300006163 | Bacteria | 1919 |
| 137 | Ga0070716_100000813 | 3300006173 | Bacteria | 13438 |
| 138 | Ga0070712_100003324 | 3300006175 | Bacteria | 9884 |
| 139 | Ga0075362_10001791 | 3300006177 | Bacteria | 7002 |
| 140 | Ga0075362_10007641 | 3300006177 | Bacteria | 4106 |
| 141 | Ga0075362_10011418 | 3300006177 | Bacteria | 3498 |
| 142 | Ga0075362_10141082 | 3300006177 | Bacteria | 1151 |
| 143 | Ga0075367_10000418 | 3300006178 | Bacteria | 15724 |
| 144 | Ga0075369_10008013 | 3300006186 | Bacteria | 4047 |
| 145 | Ga0097621_100077120 | 3300006237 | Bacteria | 2766 |
| 146 | Ga0075370_10017794 | 3300006353 | Bacteria | 3844 |
| 147 | Ga0068865_100016645 | 3300006881 | Bacteria | 4711 |
| 148 | Ga0075436_100094225 | 3300006914 | Bacteria | 2082 |
| 149 | Ga0097620_100047065 | 3300006931 | Bacteria | 4332 |
| 150 | Ga0099794_10034126 | 3300007265 | Bacteria | 2395 |
| 151 | Ga0099795_10021327 | 3300007788 | Bacteria | 2123 |
| 152 | Ga0105240_10003758 | 3300009093 | Bacteria | 23459 |
| 153 | Ga0105245_10013417 | 3300009098 | Bacteria | 7138 |
| 154 | Ga0105245_10892742 | 3300009098 | Bacteria | 930 |
| 155 | Ga0105247_10131427 | 3300009101 | Bacteria | 1632 |
| 156 | Ga0114129_10485677 | 3300009147 | Bacteria | 1615 |
| 157 | Ga0105243_10008677 | 3300009148 | Bacteria | 7792 |
| 158 | Ga0105243_10066931 | 3300009148 | Bacteria | 2891 |
| 159 | Ga0105243_10329322 | 3300009148 | Bacteria | 1394 |
| 160 | Ga0105243_10582493 | 3300009148 | Bacteria | 1074 |
| 161 | Ga0105241_10010650 | 3300009174 | Bacteria | 6744 |
| 162 | Ga0105242_10017182 | 3300009176 | Bacteria | 5633 |
| 163 | Ga0105248_10004856 | 3300009177 | Bacteria | 14885 |
| 164 | Ga0105237_10004828 | 3300009545 | Bacteria | 15484 |
| 165 | Ga0105249_10000914 | 3300009553 | Bacteria | 26099 |
| 166 | Ga0105249_10327125 | 3300009553 | Bacteria | 1545 |
| 167 | Ga0123341_1000260 | 3300009765 | Bacteria | 28683 |
| 168 | Ga0123342_1011038 | 3300009766 | Bacteria | 10076 |
| 169 | Ga0099796_10007236 | 3300010159 | Bacteria | 2891 |
| 170 | Ga0105239_10042206 | 3300010375 | Bacteria | 4998 |
| 171 | Ga0105239_10475738 | 3300010375 | Bacteria | 1419 |
| 172 | Ga0105246_10032088 | 3300011119 | Bacteria | 3481 |
| 173 | Ga0105246_10099578 | 3300011119 | Bacteria | 2113 |
| 174 | Ga0157321_1000150 | 3300012487 | Bacteria | 3020 |
| 175 | Ga0157371_10002409 | 3300013102 | Bacteria | 17899 |
| 176 | Ga0157370_10213804 | 3300013104 | Bacteria | 1787 |
| 177 | Ga0157369_10010257 | 3300013105 | Bacteria | 10690 |
| 178 | Ga0157369_10554286 | 3300013105 | Bacteria | 1188 |
| 179 | Ga0157374_10019924 | 3300013296 | Bacteria | 5945 |
| 180 | Ga0157378_10017362 | 3300013297 | Bacteria | 6314 |
| 181 | Ga0163162_10063947 | 3300013306 | Bacteria | 3724 |
| 182 | Ga0163162_11189620 | 3300013306 | Bacteria | 865 |
| 183 | Ga0157372_10019029 | 3300013307 | Bacteria | 7391 |
| 184 | Ga0157375_10005142 | 3300013308 | Bacteria | 11361 |
| 185 | Ga0157380_10013155 | 3300014326 | Bacteria | 6026 |
| 186 | Ga0157380_10171113 | 3300014326 | Bacteria | 1898 |
| 187 | Ga0182008_10054802 | 3300014497 | Bacteria | 1972 |
| 188 | Ga0157377_10020367 | 3300014745 | Bacteria | 3474 |
| 189 | Ga0157379_10003396 | 3300014968 | Bacteria | 13467 |
| 190 | Ga0157376_10844118 | 3300014969 | Bacteria | 931 |
| 191 | Ga0163161_10002750 | 3300017792 | Bacteria | 12504 |
| 192 | Ga0214542_1017465 | 3300021321 | Bacteria | 6468 |
| 193 | Ga0214543_1000008 | 3300021327 | Bacteria | 385680 |
| 194 | Ga0213873_10018333 | 3300021358 | Bacteria | 1609 |
| 195 | Ga0213875_10000382 | 3300021388 | Bacteria | 39987 |
| 196 | Ga0213875_10001328 | 3300021388 | Bacteria | 16300 |
| 197 | Ga0213871_10023054 | 3300021441 | Bacteria | 1564 |
| 198 | Ga0209129_1000050 | 3300025258 | Bacteria | 267408 |
| 199 | Ga0209129_1016021 | 3300025258 | Bacteria | 1519 |
| 200 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 201 | Ga0209673_1003944 | 3300025273 | Bacteria | 8293 |
| 202 | Ga0209673_1013749 | 3300025273 | Bacteria | 3178 |
| 203 | Ga0209130_1000061 | 3300025284 | Bacteria | 200990 |
| 204 | Ga0209675_1003298 | 3300025291 | Bacteria | 7751 |
| 205 | Ga0209676_1048734 | 3300025292 | Bacteria | 1129 |
| 206 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 207 | Ga0209025_1002759 | 3300025294 | Bacteria | 17753 |
| 208 | Ga0209025_1014200 | 3300025294 | Bacteria | 4928 |
| 209 | Ga0209025_1040858 | 3300025294 | Bacteria | 1998 |
| 210 | Ga0209564_1000187 | 3300025295 | Bacteria | 146950 |
| 211 | Ga0209564_1005816 | 3300025295 | Bacteria | 6877 |
| 212 | Ga0209564_1016479 | 3300025295 | Bacteria | 2938 |
| 213 | Ga0209758_1011142 | 3300025297 | Bacteria | 5251 |
| 214 | Ga0209758_1023249 | 3300025297 | Bacteria | 2810 |
| 215 | Ga0209758_1089424 | 3300025297 | Bacteria | 906 |
| 216 | Ga0209050_1004258 | 3300025298 | Bacteria | 9829 |
| 217 | Ga0209256_1000055 | 3300025299 | Bacteria | 295530 |
| 218 | Ga0209256_1001149 | 3300025299 | Bacteria | 30019 |
| 219 | Ga0209256_1010664 | 3300025299 | Bacteria | 3809 |
| 220 | Ga0207426_1020488 | 3300025302 | Bacteria | 2298 |
| 221 | Ga0209051_1000118 | 3300025303 | Bacteria | 149426 |
| 222 | Ga0209051_1038243 | 3300025303 | Bacteria | 1749 |
| 223 | Ga0209257_1003745 | 3300025304 | Bacteria | 12591 |
| 224 | Ga0207697_10046742 | 3300025315 | Bacteria | 1783 |
| 225 | Ga0207710_10016320 | 3300025900 | Bacteria | 3141 |
| 226 | Ga0207647_10019501 | 3300025904 | Bacteria | 4560 |
| 227 | Ga0207685_10002027 | 3300025905 | Bacteria | 4512 |
| 228 | Ga0207699_10005612 | 3300025906 | Bacteria | 6019 |
| 229 | Ga0207699_10044035 | 3300025906 | Bacteria | 2596 |
| 230 | Ga0207645_10003136 | 3300025907 | Bacteria | 12679 |
| 231 | Ga0207645_10182112 | 3300025907 | Bacteria | 1378 |
| 232 | Ga0207643_10093367 | 3300025908 | Bacteria | 1757 |
| 233 | Ga0207705_10050469 | 3300025909 | Bacteria | 2995 |
| 234 | Ga0207705_10299946 | 3300025909 | Bacteria | 1232 |
| 235 | Ga0207654_10058148 | 3300025911 | Bacteria | 2250 |
| 236 | Ga0207707_10016488 | 3300025912 | Bacteria | 6442 |
| 237 | Ga0207707_10077556 | 3300025912 | Bacteria | 2900 |
| 238 | Ga0207671_10014576 | 3300025914 | Bacteria | 6201 |
| 239 | Ga0207693_10000133 | 3300025915 | Bacteria | 67586 |
| 240 | Ga0207693_10012635 | 3300025915 | Bacteria | 6822 |
| 241 | Ga0207693_10154484 | 3300025915 | Bacteria | 1805 |
| 242 | Ga0207693_10261235 | 3300025915 | Bacteria | 1358 |
| 243 | Ga0207663_10066927 | 3300025916 | Bacteria | 2301 |
| 244 | Ga0207663_10069610 | 3300025916 | Bacteria | 2264 |
| 245 | Ga0207663_10131305 | 3300025916 | Bacteria | 1731 |
| 246 | Ga0207663_10152667 | 3300025916 | Bacteria | 1622 |
| 247 | Ga0207660_10011346 | 3300025917 | Bacteria | 5797 |
| 248 | Ga0207660_10031253 | 3300025917 | Bacteria | 3665 |
| 249 | Ga0207660_10447087 | 3300025917 | Bacteria | 1045 |
| 250 | Ga0207662_10001646 | 3300025918 | Bacteria | 10927 |
| 251 | Ga0207657_10001128 | 3300025919 | Bacteria | 28356 |
| 252 | Ga0207657_10145786 | 3300025919 | Bacteria | 1931 |
| 253 | Ga0207649_10004890 | 3300025920 | Bacteria | 7248 |
| 254 | Ga0207652_10062296 | 3300025921 | Bacteria | 3223 |
| 255 | Ga0207646_10007660 | 3300025922 | Bacteria | 10932 |
| 256 | Ga0207646_10021237 | 3300025922 | Bacteria | 6002 |
| 257 | Ga0207681_10048910 | 3300025923 | Bacteria | 2856 |
| 258 | Ga0207650_10000207 | 3300025925 | Bacteria | 67267 |
| 259 | Ga0207650_10048517 | 3300025925 | Bacteria | 3132 |
| 260 | Ga0207659_10021784 | 3300025926 | Bacteria | 4261 |
| 261 | Ga0207687_10007754 | 3300025927 | Bacteria | 7042 |
| 262 | Ga0207700_10003949 | 3300025928 | Bacteria | 8673 |
| 263 | Ga0207700_10038709 | 3300025928 | Bacteria | 3463 |
| 264 | Ga0207700_10047814 | 3300025928 | Bacteria | 3173 |
| 265 | Ga0207700_10083677 | 3300025928 | Bacteria | 2498 |
| 266 | Ga0207700_10120552 | 3300025928 | Bacteria | 2126 |
| 267 | Ga0207700_10219804 | 3300025928 | Bacteria | 1610 |
| 268 | Ga0207700_10253128 | 3300025928 | Bacteria | 1505 |
| 269 | Ga0207664_10053300 | 3300025929 | Bacteria | 3201 |
| 270 | Ga0207664_10072720 | 3300025929 | Bacteria | 2773 |
| 271 | Ga0207664_10100066 | 3300025929 | Bacteria | 2393 |
| 272 | Ga0207664_10384159 | 3300025929 | Bacteria | 1247 |
| 273 | Ga0207644_10057756 | 3300025931 | Bacteria | 2802 |
| 274 | Ga0207644_10167472 | 3300025931 | Bacteria | 1713 |
| 275 | Ga0207690_10014673 | 3300025932 | Bacteria | 4736 |
| 276 | Ga0207706_10000195 | 3300025933 | Bacteria | 67422 |
| 277 | Ga0207706_10412583 | 3300025933 | Bacteria | 1170 |
| 278 | Ga0207686_10010765 | 3300025934 | Bacteria | 4984 |
| 279 | Ga0207709_10079825 | 3300025935 | Bacteria | 2105 |
| 280 | Ga0207709_10195065 | 3300025935 | Bacteria | 1442 |
| 281 | Ga0207670_10101280 | 3300025936 | Bacteria | 2058 |
| 282 | Ga0207670_10206563 | 3300025936 | Bacteria | 1495 |
| 283 | Ga0207669_10005710 | 3300025937 | Bacteria | 5613 |
| 284 | Ga0207704_10038802 | 3300025938 | Bacteria | 2766 |
| 285 | Ga0207665_10000068 | 3300025939 | Bacteria | 67429 |
| 286 | Ga0207691_10022804 | 3300025940 | Bacteria | 5901 |
| 287 | Ga0207711_10051281 | 3300025941 | Bacteria | 3533 |
| 288 | Ga0207711_10370743 | 3300025941 | Bacteria | 1328 |
| 289 | Ga0207661_10136930 | 3300025944 | Bacteria | 2104 |
| 290 | Ga0207679_10129779 | 3300025945 | Bacteria | 2020 |
| 291 | Ga0207667_10030011 | 3300025949 | Bacteria | 5888 |
| 292 | Ga0207667_10077119 | 3300025949 | Bacteria | 3457 |
| 293 | Ga0207651_10011247 | 3300025960 | Bacteria | 5001 |
| 294 | Ga0207651_10702028 | 3300025960 | Bacteria | 891 |
| 295 | Ga0207712_10050265 | 3300025961 | Bacteria | 2910 |
| 296 | Ga0207712_10399435 | 3300025961 | Bacteria | 1155 |
| 297 | Ga0207668_10009155 | 3300025972 | Bacteria | 5921 |
| 298 | Ga0207668_10238515 | 3300025972 | Bacteria | 1470 |
| 299 | Ga0207640_10011399 | 3300025981 | Bacteria | 5033 |
| 300 | Ga0207658_10040692 | 3300025986 | Bacteria | 3361 |
| 301 | Ga0207703_10032061 | 3300026035 | Bacteria | 4157 |
| 302 | Ga0207639_10022144 | 3300026041 | Bacteria | 4575 |
| 303 | Ga0207639_10858767 | 3300026041 | Bacteria | 847 |
| 304 | Ga0207678_10000128 | 3300026067 | Bacteria | 63331 |
| 305 | Ga0207708_10009009 | 3300026075 | Bacteria | 7385 |
| 306 | Ga0207708_10078163 | 3300026075 | Bacteria | 2540 |
| 307 | Ga0207702_10016712 | 3300026078 | Bacteria | 6074 |
| 308 | Ga0207702_10040366 | 3300026078 | Bacteria | 3913 |
| 309 | Ga0207702_10377298 | 3300026078 | Bacteria | 1363 |
| 310 | Ga0207676_10029203 | 3300026095 | Bacteria | 4126 |
| 311 | Ga0207674_10000779 | 3300026116 | Bacteria | 41558 |
| 312 | Ga0207674_10017712 | 3300026116 | Bacteria | 7763 |
| 313 | Ga0207675_100111144 | 3300026118 | Bacteria | 2586 |
| 314 | Ga0207683_10017091 | 3300026121 | Bacteria | 6174 |
| 315 | Ga0207683_10019070 | 3300026121 | Bacteria | 5855 |
| 316 | Ga0207698_10883393 | 3300026142 | Bacteria | 900 |
| 317 | Ga0209588_1016899 | 3300027671 | Bacteria | 2257 |
| 318 | Ga0209588_1088279 | 3300027671 | Bacteria | 999 |
| 319 | Ga0207428_10130558 | 3300027907 | Bacteria | 1923 |
| 320 | Ga0268266_10009593 | 3300028379 | Bacteria | 8513 |
| 321 | Ga0268266_10122557 | 3300028379 | Bacteria | 2315 |
| 322 | Ga0268265_10017111 | 3300028380 | Bacteria | 4995 |
| 323 | Ga0268265_10103069 | 3300028380 | Bacteria | 2310 |
| 324 | Ga0268264_10018642 | 3300028381 | Bacteria | 5673 |
| 325 | Ga0268264_10504698 | 3300028381 | Bacteria | 1180 |
| 326 | Ga0265318_10010199 | 3300028577 | Bacteria | 4102 |
| 327 | Ga0307515_10119504 | 3300028794 | Bacteria | 2997 |
| 328 | Ga0265320_10214421 | 3300031240 | Bacteria | 858 |
| 329 | Ga0307513_10127962 | 3300031456 | Bacteria | 2491 |
| 330 | Ga0307407_10049079 | 3300031903 | Bacteria | 2407 |
| 331 | Ga0307412_10258124 | 3300031911 | Bacteria | 1357 |
| 332 | Ga0307416_100209196 | 3300032002 | Bacteria | 1859 |
| 333 | Ga0307411_10165385 | 3300032005 | Bacteria | 1662 |
| 334 | Ga0307411_10335583 | 3300032005 | Bacteria | 1226 |
| 335 | Ga0307411_10634348 | 3300032005 | Bacteria | 923 |
| 336 | Ga0307415_100035445 | 3300032126 | Bacteria | 3259 |
| 337 | Ga0307415_100312759 | 3300032126 | Bacteria | 1306 |
| 338 | Ga0373926_0028768 | 3300035083 | Bacteria | 1951 |
| 339 | Ga0373944_0029620 | 3300035089 | Bacteria | 1638 |
| 340 | Ga0373932_0004774 | 3300035112 | Bacteria | 3196 |
| 341 | Ga0373956_0096927 | 3300035119 | Bacteria | 1365 |
| 342 | Ga0373943_0085119 | 3300035170 | Bacteria | 1628 |
| 343 | Ga0373943_0394458 | 3300035170 | Bacteria | 798 |
| 344 | Ga0373946_0014455 | 3300035171 | Bacteria | 2978 |
| 345 | Ga0373931_0013189 | 3300035691 | Bacteria | 4021 |
| 346 | Ga0373931_0087537 | 3300035691 | Bacteria | 1730 |
| 347 | Ga0373935_0035432 | 3300035692 | Bacteria | 3115 |
| 348 | Ga0373933_0313548 | 3300035724 | Bacteria | 1016 |
| 349 | Ga0373947_0225207 | 3300035725 | Bacteria | 1234 |
| 350 | Ga0373937_0051618 | 3300036401 | Bacteria | 3769 |
| 351 | Ga0373925_0015042 | 3300037068 | Bacteria | 5594 |
| 352 | Ga0373925_0283188 | 3300037068 | Bacteria | 1335 |
| 353 | Ga0373925_0693544 | 3300037068 | Bacteria | 839 |
| 354 | Ga0395900_0046437 | 3300037418 | Bacteria | 4472 |
| 355 | Ga0395898_0480138 | 3300037466 | Bacteria | 1182 |
| 356 | Ga0436364_0042928 | 3300037853 | Bacteria | 71182 |
| 357 | Ga0436364_0065786 | 3300037853 | Bacteria | 48260 |
| 358 | Ga0436364_0518800 | 3300037853 | Bacteria | 2381 |
| 359 | Ga0395901_0003123 | 3300038443 | Bacteria | 16633 |
| 360 | Ga0395901_0052236 | 3300038443 | Bacteria | 4247 |
| 361 | Ga0436365_0497119 | 3300039437 | Bacteria | 4952 |
| 362 | Ga0436365_0797875 | 3300039437 | Bacteria | 2961 |
| 363 | Ga0436365_1830300 | 3300039437 | Bacteria | 1036 |
| 364 | Ga0436360_0007794 | 3300039438 | Bacteria | 2256 |
| 365 | Ga0436360_1148383 | 3300039438 | Bacteria | 7486 |
| 366 | Ga0436360_1369805 | 3300039438 | Bacteria | 878 |
| 367 | Ga0436361_0830550 | 3300039447 | Bacteria | 2602 |
| 368 | Ga0436361_0943746 | 3300039447 | Bacteria | 836 |
| 369 | Ga0436363_1411444 | 3300039450 | Bacteria | 1569 |
| 370 | Ga0436362_0281296 | 3300039453 | Bacteria | 2894 |
| 371 | Ga0439436_0094370 | 3300041404 | Bacteria | 833 |
| 372 | Ga0439465_0000941 | 3300041413 | Bacteria | 9221 |
| 373 | Ga0439465_0119221 | 3300041413 | Bacteria | 924 |
| 374 | Ga0439445_0049949 | 3300042004 | Bacteria | 1127 |
| 375 | Ga0439432_037626 | 3300042006 | Bacteria | 1543 |
| 376 | Ga0439449_0018491 | 3300042007 | Bacteria | 2616 |
| 377 | Ga0439449_0039879 | 3300042007 | Bacteria | 1746 |
| 378 | Ga0495638_0078069 | 3300046460 | Bacteria | 2015 |
| 379 | Ga0495580_0048238 | 3300046472 | Bacteria | 3016 |
| 380 | Ga0495584_0080050 | 3300046491 | Bacteria | 1644 |
| 381 | Ga0495585_0013352 | 3300046492 | Bacteria | 4811 |
| 382 | Ga0495585_0061253 | 3300046492 | Bacteria | 2070 |
| 383 | Ga0495583_0050601 | 3300046506 | Bacteria | 1898 |
| 384 | Ga0495583_0178265 | 3300046506 | Bacteria | 871 |
| 385 | Ga0495606_0015810 | 3300046507 | Bacteria | 5791 |
| 386 | Ga0495608_0269315 | 3300046511 | Bacteria | 1059 |
| 387 | Ga0495610_0027974 | 3300046512 | Bacteria | 2988 |
| 388 | Ga0495620_0023623 | 3300046515 | Bacteria | 2936 |
| 389 | Ga0495632_0031399 | 3300046519 | Bacteria | 2746 |
| 390 | Ga0495643_0025671 | 3300046522 | Bacteria | 3331 |
| 391 | Ga0495648_0238978 | 3300046524 | Bacteria | 884 |
| 392 | Ga0495587_0315285 | 3300046536 | Bacteria | 874 |
| 393 | Ga0495597_0030319 | 3300046542 | Bacteria | 2465 |
| 394 | Ga0495633_0036115 | 3300046558 | Bacteria | 2369 |
| 395 | Ga0495668_0051536 | 3300046616 | Bacteria | 2279 |
| 396 | Ga0495625_0033453 | 3300046660 | Bacteria | 3802 |
| 397 | Ga0495625_0130006 | 3300046660 | Bacteria | 1706 |
| 398 | Ga0495661_0067647 | 3300046665 | Bacteria | 2098 |
| 399 | Ga0495661_0133315 | 3300046665 | Bacteria | 1359 |
| 400 | Ga0495588_0004768 | 3300046674 | Bacteria | 5995 |
| 401 | Ga0495658_0001152 | 3300046683 | Bacteria | 13968 |
| 402 | Ga0495671_0077299 | 3300046692 | Bacteria | 1632 |
| 403 | Ga0495660_0126246 | 3300046810 | Bacteria | 1288 |
| 404 | Ga0495660_0168149 | 3300046810 | Bacteria | 1070 |
| 405 | Ga0495636_0103467 | 3300047318 | Bacteria | 1247 |
| 406 | Ga0495687_022670 | 3300047443 | Bacteria | 3011 |
| 407 | Ga0495686_0063819 | 3300047472 | Bacteria | 2281 |
| 408 | Ga0496100_0097862 | 3300048903 | Bacteria | 2015 |
| 409 | Ga0496101_0078631 | 3300048904 | Bacteria | 2433 |
| 410 | Ga0496102_0175855 | 3300048905 | Bacteria | 2015 |
| 411 | Ga0496102_0271045 | 3300048905 | Bacteria | 1600 |
| 412 | Ga0496103_0030105 | 3300048906 | Bacteria | 3301 |
| 413 | Ga0496104_0018902 | 3300048907 | Bacteria | 6294 |
| 414 | Ga0496105_0074129 | 3300048908 | Bacteria | 2811 |
| 415 | Ga0496106_0037145 | 3300048909 | Bacteria | 3643 |
| 416 | Ga0496106_0086941 | 3300048909 | Bacteria | 2408 |
| 417 | Ga0496107_0028475 | 3300048910 | Bacteria | 3970 |
| 418 | Ga0496107_0556115 | 3300048910 | Bacteria | 850 |
| 419 | Ga0496108_0039012 | 3300048911 | Bacteria | 3958 |
| 420 | Ga0496108_0719674 | 3300048911 | Bacteria | 865 |
| 421 | Ga0496109_0055034 | 3300048912 | Bacteria | 3629 |
| 422 | Ga0496109_0101585 | 3300048912 | Bacteria | 2669 |
| 423 | Ga0496110_0038422 | 3300048913 | Bacteria | 4165 |
| 424 | Ga0496110_0390330 | 3300048913 | Bacteria | 1269 |
| 425 | Ga0496110_0440538 | 3300048913 | Bacteria | 1187 |
| 426 | Ga0496111_0062526 | 3300048914 | Bacteria | 2699 |
| 427 | Ga0496111_0076732 | 3300048914 | Bacteria | 2436 |
| 428 | Ga0496112_0126917 | 3300048915 | Bacteria | 2521 |
| 429 | Ga0496112_0134296 | 3300048915 | Bacteria | 2445 |
| 430 | Ga0496113_0052700 | 3300048916 | Bacteria | 3040 |
| 431 | Ga0496113_0055250 | 3300048916 | Bacteria | 2975 |
| 432 | Ga0496113_0166157 | 3300048916 | Bacteria | 1746 |
| 433 | Ga0496114_0208714 | 3300048917 | Bacteria | 1712 |
| 434 | Ga0496115_0102150 | 3300048918 | Bacteria | 2351 |
| 435 | Ga0496117_0075984 | 3300048920 | Bacteria | 2229 |
| 436 | Ga0496118_0080464 | 3300048921 | Bacteria | 2293 |
| 437 | Ga0496119_0165924 | 3300048922 | Bacteria | 1170 |
| 438 | Ga0496121_0240004 | 3300048924 | Bacteria | 1263 |
| 439 | Ga0496122_0006028 | 3300048925 | Bacteria | 14138 |
| 440 | Ga0496124_0000130 | 3300048927 | Bacteria | 156467 |
| 441 | Ga0496124_0009086 | 3300048927 | Bacteria | 10278 |
| 442 | Ga0496124_0400796 | 3300048927 | Bacteria | 952 |
| 443 | Ga0496126_0037873 | 3300048929 | Bacteria | 4493 |
| 444 | Ga0496126_0433554 | 3300048929 | Bacteria | 1060 |
| 445 | Ga0495678_133751 | 3300049459 | Bacteria | 819 |
| 446 | Ga0501034_0008960 | 3300049571 | Bacteria | 10517 |
| 447 | Ga0501034_0009746 | 3300049571 | Bacteria | 10043 |
| 448 | Ga0501034_0024480 | 3300049571 | Bacteria | 6141 |
| 449 | Ga0501034_0098476 | 3300049571 | Bacteria | 2920 |
| 450 | Ga0501034_0496002 | 3300049571 | Bacteria | 1135 |
| 451 | Ga0501034_0510767 | 3300049571 | Bacteria | 1114 |
| 452 | Ga0501034_0818802 | 3300049571 | Bacteria | 823 |
| 453 | Ga0501036_0009582 | 3300049572 | Bacteria | 7967 |
| 454 | Ga0501036_0012973 | 3300049572 | Bacteria | 6918 |
| 455 | Ga0501037_0170671 | 3300049573 | Bacteria | 1546 |
| 456 | Ga0501038_0001082 | 3300049574 | Bacteria | 24639 |
| 457 | Ga0501039_0000168 | 3300049575 | Bacteria | 45750 |
| 458 | Ga0501039_0223604 | 3300049575 | Bacteria | 1480 |
| 459 | Ga0501040_0001149 | 3300049576 | Bacteria | 16836 |
| 460 | Ga0501040_0016387 | 3300049576 | Bacteria | 4906 |
| 461 | Ga0501041_0000623 | 3300049577 | Bacteria | 18476 |
| 462 | Ga0501042_0007758 | 3300049578 | Bacteria | 7052 |
| 463 | Ga0501043_0155073 | 3300049579 | Bacteria | 1791 |
| 464 | Ga0501046_0000480 | 3300049580 | Bacteria | 39915 |
| 465 | Ga0501048_0000896 | 3300049582 | Bacteria | 21988 |
| 466 | Ga0501048_0063986 | 3300049582 | Bacteria | 2601 |
| 467 | Ga0501048_0400699 | 3300049582 | Bacteria | 981 |
| 468 | Ga0501067_0040015 | 3300049583 | Bacteria | 2603 |
| 469 | Ga0501070_0337576 | 3300049586 | Bacteria | 1224 |
| 470 | Ga0501071_0006119 | 3300049587 | Bacteria | 7799 |
| 471 | Ga0501071_0238458 | 3300049587 | Bacteria | 1371 |
| 472 | Ga0501071_0451795 | 3300049587 | Bacteria | 983 |
| 473 | Ga0501072_0002754 | 3300049588 | Bacteria | 13208 |
| 474 | Ga0501072_0021236 | 3300049588 | Bacteria | 5035 |
| 475 | Ga0501072_0052612 | 3300049588 | Bacteria | 3206 |
| 476 | Ga0501074_0017319 | 3300049590 | Bacteria | 5227 |
| 477 | Ga0501074_0205519 | 3300049590 | Bacteria | 1403 |
| 478 | Ga0501075_0000046 | 3300049591 | Bacteria | 50813 |
| 479 | Ga0501075_0206837 | 3300049591 | Bacteria | 1497 |
| 480 | Ga0501076_0000566 | 3300049592 | Bacteria | 23610 |
| 481 | Ga0501076_0148292 | 3300049592 | Bacteria | 1908 |
| 482 | Ga0501077_0004492 | 3300049593 | Bacteria | 8471 |
| 483 | Ga0501077_0058409 | 3300049593 | Bacteria | 2449 |
| 484 | Ga0501238_001394 | 3300049671 | Bacteria | 2800 |
| 485 | Ga0501079_0000808 | 3300049741 | Bacteria | 21315 |
| 486 | Ga0501080_0031560 | 3300049742 | Bacteria | 4936 |
| 487 | Ga0501080_0087780 | 3300049742 | Bacteria | 2889 |
| 488 | Ga0501080_0184262 | 3300049742 | Bacteria | 1920 |
| 489 | Ga0501080_0654637 | 3300049742 | Bacteria | 929 |
| 490 | Ga0501081_0005566 | 3300049743 | Bacteria | 8134 |
| 491 | Ga0501081_0011120 | 3300049743 | Bacteria | 5886 |
| 492 | Ga0501083_0209612 | 3300049744 | Bacteria | 1270 |
| 493 | Ga0501035_0156603 | 3300049822 | Bacteria | 1974 |
| 494 | Ga0501044_0020009 | 3300049823 | Bacteria | 7147 |
| 495 | Ga0501044_0059875 | 3300049823 | Bacteria | 3901 |
| 496 | Ga0501045_0004353 | 3300049824 | Bacteria | 9761 |
| 497 | Ga0501045_0043187 | 3300049824 | Bacteria | 3282 |
| 498 | Ga0501045_0063202 | 3300049824 | Bacteria | 2716 |
| 499 | nmdc:mga03683_24495_c1 | 3300050489 | Bacteria | 2362 |
| 500 | nmdc:mga00v17_238233_c1 | 3300050491 | Bacteria | 1179 |
| 501 | nmdc:mga00v17_263_c1 | 3300050491 | Bacteria | 30939 |
| 502 | nmdc:mga0yw44_110948_c1 | 3300050492 | Bacteria | 1757 |
| 503 | nmdc:mga0yw44_161274_c1 | 3300050492 | Bacteria | 1468 |
| 504 | nmdc:mga0yw44_196858_c1 | 3300050492 | Bacteria | 1330 |
| 505 | nmdc:mga0yw44_3398_c1 | 3300050492 | Bacteria | 3616 |
| 506 | nmdc:mga0yw44_586967_c1 | 3300050492 | Bacteria | 757 |
| 507 | nmdc:mga0k408_30823_c1 | 3300050493 | Bacteria | 3060 |
| 508 | nmdc:mga0k408_3957_c1 | 3300050493 | Bacteria | 7171 |
| 509 | nmdc:mga06z11_84407_c1 | 3300050494 | Bacteria | 1359 |
| 510 | nmdc:mga07m45_72978_c1 | 3300050496 | Bacteria | 1954 |
| 511 | nmdc:mga09592_52676_c1 | 3300050508 | Bacteria | 3434 |
| 512 | nmdc:mga06r32_239430_c1 | 3300050510 | Bacteria | 1802 |
| 513 | nmdc:mga08x19_189461_c1 | 3300050514 | Bacteria | 1407 |
| 514 | nmdc:mga0sz30_120_c1 | 3300050516 | Bacteria | 29116 |
| 515 | Ga0495619_0514202 | 3300053085 | Bacteria | 823 |
| 516 | Ga0500641_0001723 | 3300053096 | Bacteria | 7779 |
| 517 | Ga0500560_000918 | 3300053107 | Bacteria | 4646 |
| 518 | Ga0500560_001758 | 3300053107 | Bacteria | 3897 |
| 519 | Ga0500569_097138 | 3300053109 | Bacteria | 961 |
| 520 | Ga0500572_001488 | 3300053111 | Bacteria | 6329 |
| 521 | Ga0500658_0001898 | 3300053134 | Bacteria | 8201 |
| 522 | Ga0500616_0001601 | 3300053153 | Bacteria | 21092 |
| 523 | Ga0500616_0015981 | 3300053153 | Bacteria | 4282 |
| 524 | Ga0500616_0030452 | 3300053153 | Bacteria | 2963 |
| 525 | Ga0500616_0064991 | 3300053153 | Bacteria | 1877 |
| 526 | Ga0500624_001170 | 3300053157 | Bacteria | 4784 |
| 527 | Ga0500636_0000032 | 3300053177 | Bacteria | 74084 |
| 528 | Ga0500636_0009619 | 3300053177 | Bacteria | 5626 |
| 529 | Ga0500552_001444 | 3300053733 | Bacteria | 2267 |
| 530 | Ga0501084_0005468 | 3300054114 | Bacteria | 10422 |
| 531 | Ga0501084_0011377 | 3300054114 | Bacteria | 7369 |
| 532 | Ga0501084_0169982 | 3300054114 | Bacteria | 1840 |
| 533 | Ga0501084_0213048 | 3300054114 | Bacteria | 1630 |
| 534 | Ga0501084_0242261 | 3300054114 | Bacteria | 1522 |
| 535 | Ga0501082_0002802 | 3300060353 | Bacteria | 15217 |
| 536 | Ga0501082_0035644 | 3300060353 | Bacteria | 4288 |
| 537 | Ga0501082_0115722 | 3300060353 | Bacteria | 2322 |
| 538 | Ga0501082_0120199 | 3300060353 | Bacteria | 2277 |
| 539 | Ga0501082_0424413 | 3300060353 | Bacteria | 1161 |
| 540 | Ga0530510_0002668 | 3300061734 | Bacteria | 12261 |
| 541 | Ga0530510_0004584 | 3300061734 | Bacteria | 9564 |
| 542 | Ga0530510_0190855 | 3300061734 | Bacteria | 1521 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0400796 | Ga0496124_0400796_307_936 | 192 |
| 2 | 3300048925 | Ga0496122_0006028 | Ga0496122_0006028_9944_10573 | 198 |
| 3 | 3300046492 | Ga0495585_0061253 | Ga0495585_0061253_452_1153 | 205 |
| 4 | 3300049742 | Ga0501080_0184262 | Ga0501080_0184262_439_1107 | 207 |
| 5 | 3300005329 | Ga0070683_100389399 | Ga0070683_1003893992 | 208 |
| 6 | 3300006048 | Ga0075363_100191730 | Ga0075363_1001917302 | 208 |
| 7 | 3300009148 | Ga0105243_10582493 | Ga0105243_105824932 | 208 |
| 8 | 3300039450 | Ga0436363_1411444 | Ga0436363_1411444_27_656 | 208 |
| 9 | 3300049571 | Ga0501034_0009746 | Ga0501034_0009746_251_949 | 208 |
| 10 | 3300050492 | nmdc:mga0yw44_586967_c1 | nmdc:mga0yw44_586967_c1_100_729 | 208 |
| 11 | 3300053153 | Ga0500616_0001601 | Ga0500616_0001601_6461_7147 | 208 |
| 12 | 3300053153 | Ga0500616_0015981 | Ga0500616_0015981_2644_3333 | 208 |
| 13 | 3300031903 | Ga0307407_10049079 | Ga0307407_100490792 | 209 |
| 14 | 3300031911 | Ga0307412_10258124 | Ga0307412_102581242 | 209 |
| 15 | 3300032005 | Ga0307411_10165385 | Ga0307411_101653852 | 209 |
| 16 | 3300005347 | Ga0070668_100183187 | Ga0070668_1001831872 | 210 |
| 17 | 3300005536 | Ga0070697_100673267 | Ga0070697_1006732671 | 210 |
| 18 | 3300009148 | Ga0105243_10066931 | Ga0105243_100669313 | 210 |
| 19 | 3300009553 | Ga0105249_10327125 | Ga0105249_103271252 | 210 |
| 20 | 3300011119 | Ga0105246_10032088 | Ga0105246_100320884 | 210 |
| 21 | 3300014326 | Ga0157380_10171113 | Ga0157380_101711132 | 210 |
| 22 | 3300025935 | Ga0207709_10079825 | Ga0207709_100798253 | 210 |
| 23 | 3300025972 | Ga0207668_10238515 | Ga0207668_102385152 | 210 |
| 24 | 3300032005 | Ga0307411_10634348 | Ga0307411_106343481 | 210 |
| 25 | 3300046491 | Ga0495584_0080050 | Ga0495584_0080050_237_938 | 211 |
| 26 | 3300048921 | Ga0496118_0080464 | Ga0496118_0080464_926_1696 | 211 |
| 27 | 3300006177 | Ga0075362_10007641 | Ga0075362_100076412 | 212 |
| 28 | 3300006186 | Ga0075369_10008013 | Ga0075369_100080133 | 212 |
| 29 | 3300025935 | Ga0207709_10195065 | Ga0207709_101950652 | 212 |
| 30 | 3300046558 | Ga0495633_0036115 | Ga0495633_0036115_1123_1830 | 212 |
| 31 | 3300046674 | Ga0495588_0004768 | Ga0495588_0004768_4945_5652 | 212 |
| 32 | 3300048927 | Ga0496124_0009086 | Ga0496124_0009086_8736_9443 | 212 |
| 33 | 3300048929 | Ga0496126_0433554 | Ga0496126_0433554_36_743 | 212 |
| 34 | 3300050489 | nmdc:mga03683_24495_c1 | nmdc:mga03683_24495_c1_877_1584 | 212 |
| 35 | 3300050491 | nmdc:mga00v17_263_c1 | nmdc:mga00v17_263_c1_15836_16543 | 212 |
| 36 | 3300050493 | nmdc:mga0k408_30823_c1 | nmdc:mga0k408_30823_c1_1930_2637 | 212 |
| 37 | 3300050516 | nmdc:mga0sz30_120_c1 | nmdc:mga0sz30_120_c1_19144_19851 | 212 |
| 38 | 3300053107 | Ga0500560_000918 | Ga0500560_000918_3411_4118 | 212 |
| 39 | 3300053107 | Ga0500560_001758 | Ga0500560_001758_2197_2904 | 212 |
| 40 | 3300053111 | Ga0500572_001488 | Ga0500572_001488_3307_4008 | 212 |
| 41 | 3300053153 | Ga0500616_0064991 | Ga0500616_0064991_289_984 | 212 |
| 42 | 3300053157 | Ga0500624_001170 | Ga0500624_001170_3239_3946 | 212 |
| 43 | 3300053177 | Ga0500636_0000032 | Ga0500636_0000032_58280_58981 | 212 |
| 44 | 3300053177 | Ga0500636_0009619 | Ga0500636_0009619_296_997 | 212 |
| 45 | 3300021321 | Ga0214542_1017465 | Ga0214542_10174655 | 213 |
| 46 | 3300021327 | Ga0214543_1000008 | Ga0214543_1000008304 | 213 |
| 47 | 3300002773 | JGI25152J39213_1001788 | JGI25152J39213_10017886 | 214 |
| 48 | 3300003187 | JGI25151J46595_10051225 | JGI25151J46595_100512252 | 214 |
| 49 | 3300003771 | Ga0055526_1053295 | Ga0055526_10532951 | 214 |
| 50 | 3300003775 | Ga0055524_1004841 | Ga0055524_10048413 | 214 |
| 51 | 3300003790 | Ga0055528_1012605 | Ga0055528_10126052 | 214 |
| 52 | 3300005262 | Ga0065165_1020586 | Ga0065165_10205862 | 214 |
| 53 | 3300005331 | Ga0070670_100000061 | Ga0070670_10000006129 | 214 |
| 54 | 3300005347 | Ga0070668_100449168 | Ga0070668_1004491682 | 214 |
| 55 | 3300006178 | Ga0075367_10000418 | Ga0075367_100004187 | 214 |
| 56 | 3300006353 | Ga0075370_10017794 | Ga0075370_100177945 | 214 |
| 57 | 3300007788 | Ga0099795_10021327 | Ga0099795_100213272 | 214 |
| 58 | 3300010159 | Ga0099796_10007236 | Ga0099796_100072364 | 214 |
| 59 | 3300013104 | Ga0157370_10213804 | Ga0157370_102138042 | 214 |
| 60 | 3300025258 | Ga0209129_1000050 | Ga0209129_1000050118 | 214 |
| 61 | 3300025258 | Ga0209129_1016021 | Ga0209129_10160212 | 214 |
| 62 | 3300025273 | Ga0209673_1000033 | Ga0209673_1000033117 | 214 |
| 63 | 3300025292 | Ga0209676_1048734 | Ga0209676_10487342 | 214 |
| 64 | 3300025294 | Ga0209025_1002759 | Ga0209025_100275910 | 214 |
| 65 | 3300025295 | Ga0209564_1005816 | Ga0209564_10058167 | 214 |
| 66 | 3300025295 | Ga0209564_1016479 | Ga0209564_10164794 | 214 |
| 67 | 3300025297 | Ga0209758_1011142 | Ga0209758_10111426 | 214 |
| 68 | 3300025297 | Ga0209758_1023249 | Ga0209758_10232493 | 214 |
| 69 | 3300025299 | Ga0209256_1001149 | Ga0209256_10011494 | 214 |
| 70 | 3300025299 | Ga0209256_1010664 | Ga0209256_10106644 | 214 |
| 71 | 3300025303 | Ga0209051_1038243 | Ga0209051_10382432 | 214 |
| 72 | 3300025925 | Ga0207650_10000207 | Ga0207650_1000020737 | 214 |
| 73 | 3300025941 | Ga0207711_10370743 | Ga0207711_103707432 | 214 |
| 74 | 3300028794 | Ga0307515_10119504 | Ga0307515_101195043 | 214 |
| 75 | 3300035725 | Ga0373947_0225207 | Ga0373947_0225207_236_940 | 214 |
| 76 | 3300042007 | Ga0439449_0018491 | Ga0439449_0018491_43_738 | 214 |
| 77 | 3300046460 | Ga0495638_0078069 | Ga0495638_0078069_374_1069 | 214 |
| 78 | 3300046492 | Ga0495585_0013352 | Ga0495585_0013352_2105_2806 | 214 |
| 79 | 3300046507 | Ga0495606_0015810 | Ga0495606_0015810_4681_5376 | 214 |
| 80 | 3300046512 | Ga0495610_0027974 | Ga0495610_0027974_1290_1985 | 214 |
| 81 | 3300046515 | Ga0495620_0023623 | Ga0495620_0023623_220_915 | 214 |
| 82 | 3300046519 | Ga0495632_0031399 | Ga0495632_0031399_229_924 | 214 |
| 83 | 3300046522 | Ga0495643_0025671 | Ga0495643_0025671_1269_1964 | 214 |
| 84 | 3300046524 | Ga0495648_0238978 | Ga0495648_0238978_130_831 | 214 |
| 85 | 3300046542 | Ga0495597_0030319 | Ga0495597_0030319_772_1467 | 214 |
| 86 | 3300046616 | Ga0495668_0051536 | Ga0495668_0051536_94_795 | 214 |
| 87 | 3300046660 | Ga0495625_0033453 | Ga0495625_0033453_1786_2487 | 214 |
| 88 | 3300046660 | Ga0495625_0130006 | Ga0495625_0130006_886_1581 | 214 |
| 89 | 3300046665 | Ga0495661_0067647 | Ga0495661_0067647_1285_1980 | 214 |
| 90 | 3300046665 | Ga0495661_0133315 | Ga0495661_0133315_454_1155 | 214 |
| 91 | 3300046692 | Ga0495671_0077299 | Ga0495671_0077299_334_1029 | 214 |
| 92 | 3300046810 | Ga0495660_0126246 | Ga0495660_0126246_459_1154 | 214 |
| 93 | 3300047318 | Ga0495636_0103467 | Ga0495636_0103467_175_870 | 214 |
| 94 | 3300047443 | Ga0495687_022670 | Ga0495687_022670_633_1328 | 214 |
| 95 | 3300047472 | Ga0495686_0063819 | Ga0495686_0063819_1240_1935 | 214 |
| 96 | 3300048922 | Ga0496119_0165924 | Ga0496119_0165924_358_1059 | 214 |
| 97 | 3300048924 | Ga0496121_0240004 | Ga0496121_0240004_530_1231 | 214 |
| 98 | 3300048927 | Ga0496124_0000130 | Ga0496124_0000130_140446_141147 | 214 |
| 99 | 3300049459 | Ga0495678_133751 | Ga0495678_133751_52_747 | 214 |
| 100 | 3300050496 | nmdc:mga07m45_72978_c1 | nmdc:mga07m45_72978_c1_942_1643 | 214 |
| 101 | 3300053109 | Ga0500569_097138 | Ga0500569_097138_208_903 | 214 |
| 102 | 3300053134 | Ga0500658_0001898 | Ga0500658_0001898_1518_2213 | 214 |
| 103 | 3300053153 | Ga0500616_0030452 | Ga0500616_0030452_1004_1699 | 214 |
| 104 | 3300005468 | Ga0070707_100006734 | Ga0070707_10000673414 | 215 |
| 105 | 3300005471 | Ga0070698_100127533 | Ga0070698_1001275332 | 215 |
| 106 | 3300005536 | Ga0070697_100318225 | Ga0070697_1003182252 | 215 |
| 107 | 3300006028 | Ga0070717_10003786 | Ga0070717_1000378611 | 215 |
| 108 | 3300025922 | Ga0207646_10007660 | Ga0207646_100076603 | 215 |
| 109 | 3300046506 | Ga0495583_0050601 | Ga0495583_0050601_27_728 | 215 |
| 110 | 3300049744 | Ga0501083_0209612 | Ga0501083_0209612_35_730 | 215 |
| 111 | 3300060353 | Ga0501082_0035644 | Ga0501082_0035644_17_712 | 215 |
| 112 | 3300003790 | Ga0055528_1012493 | Ga0055528_10124932 | 216 |
| 113 | 3300003791 | Ga0055530_10059805 | Ga0055530_100598051 | 216 |
| 114 | 3300003792 | Ga0055540_1002133 | Ga0055540_10021336 | 216 |
| 115 | 3300025273 | Ga0209673_1003944 | Ga0209673_10039443 | 216 |
| 116 | 3300025297 | Ga0209758_1089424 | Ga0209758_10894242 | 216 |
| 117 | 3300025298 | Ga0209050_1004258 | Ga0209050_10042585 | 216 |
| 118 | 3300025303 | Ga0209051_1000118 | Ga0209051_100011869 | 216 |
| 119 | 3300025304 | Ga0209257_1003745 | Ga0209257_100374512 | 216 |
| 120 | 3300031456 | Ga0307513_10127962 | Ga0307513_101279622 | 216 |
| 121 | 3300035119 | Ga0373956_0096927 | Ga0373956_0096927_218_922 | 216 |
| 122 | 3300035724 | Ga0373933_0313548 | Ga0373933_0313548_293_997 | 216 |
| 123 | 3300036401 | Ga0373937_0051618 | Ga0373937_0051618_199_903 | 216 |
| 124 | 3300049571 | Ga0501034_0818802 | Ga0501034_0818802_42_734 | 216 |
| 125 | 3300049582 | Ga0501048_0400699 | Ga0501048_0400699_160_864 | 216 |
| 126 | 3300049823 | Ga0501044_0059875 | Ga0501044_0059875_375_1067 | 216 |
| 127 | 3300050492 | nmdc:mga0yw44_196858_c1 | nmdc:mga0yw44_196858_c1_211_897 | 216 |
| 128 | 3300009765 | Ga0123341_1000260 | Ga0123341_100026021 | 217 |
| 129 | 3300009766 | Ga0123342_1011038 | Ga0123342_101103812 | 217 |
| 130 | 3300049571 | Ga0501034_0496002 | Ga0501034_0496002_142_831 | 217 |
| 131 | 3300021358 | Ga0213873_10018333 | Ga0213873_100183332 | 218 |
| 132 | 3300039437 | Ga0436365_0497119 | Ga0436365_0497119_1443_2147 | 218 |
| 133 | 3300039453 | Ga0436362_0281296 | Ga0436362_0281296_1068_1772 | 218 |
| 134 | 3300041404 | Ga0439436_0094370 | Ga0439436_0094370_12_671 | 218 |
| 135 | 3300046810 | Ga0495660_0168149 | Ga0495660_0168149_303_1004 | 218 |
| 136 | 3300005937 | Ga0081455_10017899 | Ga0081455_100178992 | 220 |
| 137 | 3300005937 | Ga0081455_10034079 | Ga0081455_100340794 | 220 |
| 138 | 3300009147 | Ga0114129_10485677 | Ga0114129_104856772 | 220 |
| 139 | 3300050492 | nmdc:mga0yw44_3398_c1 | nmdc:mga0yw44_3398_c1_2272_2976 | 220 |
| 140 | 3300050508 | nmdc:mga09592_52676_c1 | nmdc:mga09592_52676_c1_1249_1953 | 220 |
| 141 | 3300050510 | nmdc:mga06r32_239430_c1 | nmdc:mga06r32_239430_c1_708_1412 | 220 |
| 142 | 3300005434 | Ga0070709_10134202 | Ga0070709_101342022 | 221 |
| 143 | 3300005435 | Ga0070714_100119609 | Ga0070714_1001196092 | 221 |
| 144 | 3300005436 | Ga0070713_100027047 | Ga0070713_1000270473 | 221 |
| 145 | 3300006028 | Ga0070717_10117471 | Ga0070717_101174712 | 221 |
| 146 | 3300014497 | Ga0182008_10054802 | Ga0182008_100548023 | 221 |
| 147 | 3300021388 | Ga0213875_10001328 | Ga0213875_1000132814 | 221 |
| 148 | 3300025912 | Ga0207707_10077556 | Ga0207707_100775563 | 221 |
| 149 | 3300025928 | Ga0207700_10003949 | Ga0207700_100039495 | 221 |
| 150 | 3300025929 | Ga0207664_10100066 | Ga0207664_101000663 | 221 |
| 151 | 3300035083 | Ga0373926_0028768 | Ga0373926_0028768_337_1041 | 221 |
| 152 | 3300035089 | Ga0373944_0029620 | Ga0373944_0029620_51_764 | 221 |
| 153 | 3300035170 | Ga0373943_0085119 | Ga0373943_0085119_326_1030 | 221 |
| 154 | 3300035171 | Ga0373946_0014455 | Ga0373946_0014455_1262_1966 | 221 |
| 155 | 3300035691 | Ga0373931_0087537 | Ga0373931_0087537_207_911 | 221 |
| 156 | 3300035692 | Ga0373935_0035432 | Ga0373935_0035432_1516_2220 | 221 |
| 157 | 3300037068 | Ga0373925_0015042 | Ga0373925_0015042_4444_5148 | 221 |
| 158 | 3300037853 | Ga0436364_0065786 | Ga0436364_0065786_30038_30742 | 221 |
| 159 | 3300037853 | Ga0436364_0518800 | Ga0436364_0518800_1105_1833 | 221 |
| 160 | 3300039437 | Ga0436365_0797875 | Ga0436365_0797875_2026_2754 | 221 |
| 161 | 3300046472 | Ga0495580_0048238 | Ga0495580_0048238_2154_2858 | 221 |
| 162 | 3300048915 | Ga0496112_0134296 | Ga0496112_0134296_1288_1992 | 221 |
| 163 | 3300050514 | nmdc:mga08x19_189461_c1 | nmdc:mga08x19_189461_c1_529_1233 | 221 |
| 164 | 3300049671 | Ga0501238_001394 | Ga0501238_001394_1763_2458 | 223 |
| 165 | iso_pu_bacteria | 2519899620 | 2520376472 | 223 |
| 166 | iso_pu_bacteria | 2838686498 | 2838693296 | 223 |
| 167 | iso_pu_bacteria | 2838729681 | 2838735290 | 223 |
| 168 | iso_pu_bacteria | 2838742623 | 2838748161 | 223 |
| 169 | iso_pu_bacteria | 2841851746 | 2841857362 | 223 |
| 170 | iso_pu_bacteria | 2842163707 | 2842166836 | 223 |
| 171 | iso_pu_bacteria | 2842229732 | 2842235562 | 223 |
| 172 | iso_pu_bacteria | 2842243621 | 2842249155 | 223 |
| 173 | iso_pu_bacteria | 2842257432 | 2842263110 | 223 |
| 174 | iso_pu_bacteria | 2842271015 | 2842277764 | 223 |
| 175 | iso_pu_bacteria | 2842304105 | 2842305693 | 223 |
| 176 | iso_pu_bacteria | 2842357229 | 2842358917 | 223 |
| 177 | iso_pu_bacteria | 2842509118 | 2842514737 | 223 |
| 178 | iso_pu_bacteria | 2844454524 | 2844456855 | 223 |
| 179 | 3300013105 | Ga0157369_10554286 | Ga0157369_105542862 | 224 |
| 180 | iso_pu_bacteria | 2529292951 | 2530647230 | 225 |
| 181 | iso_pu_bacteria | 2896384573 | 2896387632 | 225 |
| 182 | 3300006048 | Ga0075363_100163233 | Ga0075363_1001632332 | 226 |
| 183 | 3300006177 | Ga0075362_10141082 | Ga0075362_101410822 | 226 |
| 184 | iso_pu_bacteria | 2773857925 | 2774872902 | 226 |
| 185 | iso_pu_bacteria | 2842156927 | 2842162463 | 226 |
| 186 | iso_pu_bacteria | 2842180545 | 2842186103 | 226 |
| 187 | iso_pu_bacteria | 2842780639 | 2842783264 | 226 |
| 188 | iso_pu_bacteria | 2894232714 | 2894232886 | 226 |
| 189 | 3300005327 | Ga0070658_10006529 | Ga0070658_100065298 | 227 |
| 190 | 3300005328 | Ga0070676_10240874 | Ga0070676_102408742 | 227 |
| 191 | 3300005336 | Ga0070680_100002489 | Ga0070680_1000024895 | 227 |
| 192 | 3300005355 | Ga0070671_100291482 | Ga0070671_1002914822 | 227 |
| 193 | 3300005364 | Ga0070673_100580569 | Ga0070673_1005805692 | 227 |
| 194 | 3300005364 | Ga0070673_100835218 | Ga0070673_1008352181 | 227 |
| 195 | 3300005435 | Ga0070714_100405123 | Ga0070714_1004051232 | 227 |
| 196 | 3300005456 | Ga0070678_100008820 | Ga0070678_1000088205 | 227 |
| 197 | 3300005458 | Ga0070681_10135921 | Ga0070681_101359212 | 227 |
| 198 | 3300005467 | Ga0070706_100456092 | Ga0070706_1004560922 | 227 |
| 199 | 3300005471 | Ga0070698_100001306 | Ga0070698_10000130614 | 227 |
| 200 | 3300005530 | Ga0070679_100052506 | Ga0070679_1000525066 | 227 |
| 201 | 3300005539 | Ga0068853_100580446 | Ga0068853_1005804462 | 227 |
| 202 | 3300005548 | Ga0070665_100022854 | Ga0070665_1000228546 | 227 |
| 203 | 3300005548 | Ga0070665_100098257 | Ga0070665_1000982572 | 227 |
| 204 | 3300005563 | Ga0068855_100040062 | Ga0068855_1000400626 | 227 |
| 205 | 3300005577 | Ga0068857_100205706 | Ga0068857_1002057063 | 227 |
| 206 | 3300005577 | Ga0068857_100893409 | Ga0068857_1008934092 | 227 |
| 207 | 3300005614 | Ga0068856_100446610 | Ga0068856_1004466102 | 227 |
| 208 | 3300005614 | Ga0068856_100997078 | Ga0068856_1009970781 | 227 |
| 209 | 3300005844 | Ga0068862_100230038 | Ga0068862_1002300382 | 227 |
| 210 | 3300005937 | Ga0081455_10068714 | Ga0081455_100687143 | 227 |
| 211 | 3300005985 | Ga0081539_10076970 | Ga0081539_100769702 | 227 |
| 212 | 3300006177 | Ga0075362_10001791 | Ga0075362_100017915 | 227 |
| 213 | 3300006177 | Ga0075362_10011418 | Ga0075362_100114182 | 227 |
| 214 | 3300007265 | Ga0099794_10034126 | Ga0099794_100341263 | 227 |
| 215 | 3300009093 | Ga0105240_10003758 | Ga0105240_1000375824 | 227 |
| 216 | 3300014969 | Ga0157376_10844118 | Ga0157376_108441182 | 227 |
| 217 | 3300021441 | Ga0213871_10023054 | Ga0213871_100230542 | 227 |
| 218 | 3300025907 | Ga0207645_10182112 | Ga0207645_101821122 | 227 |
| 219 | 3300025908 | Ga0207643_10093367 | Ga0207643_100933673 | 227 |
| 220 | 3300025909 | Ga0207705_10299946 | Ga0207705_102999462 | 227 |
| 221 | 3300025912 | Ga0207707_10016488 | Ga0207707_100164884 | 227 |
| 222 | 3300025917 | Ga0207660_10011346 | Ga0207660_100113466 | 227 |
| 223 | 3300025919 | Ga0207657_10145786 | Ga0207657_101457862 | 227 |
| 224 | 3300025921 | Ga0207652_10062296 | Ga0207652_100622962 | 227 |
| 225 | 3300025929 | Ga0207664_10384159 | Ga0207664_103841592 | 227 |
| 226 | 3300025931 | Ga0207644_10167472 | Ga0207644_101674722 | 227 |
| 227 | 3300025933 | Ga0207706_10412583 | Ga0207706_104125832 | 227 |
| 228 | 3300025949 | Ga0207667_10077119 | Ga0207667_100771193 | 227 |
| 229 | 3300025960 | Ga0207651_10702028 | Ga0207651_107020282 | 227 |
| 230 | 3300025961 | Ga0207712_10399435 | Ga0207712_103994352 | 227 |
| 231 | 3300026041 | Ga0207639_10858767 | Ga0207639_108587671 | 227 |
| 232 | 3300026078 | Ga0207702_10377298 | Ga0207702_103772982 | 227 |
| 233 | 3300026116 | Ga0207674_10017712 | Ga0207674_100177128 | 227 |
| 234 | 3300026121 | Ga0207683_10019070 | Ga0207683_100190706 | 227 |
| 235 | 3300027671 | Ga0209588_1016899 | Ga0209588_10168993 | 227 |
| 236 | 3300028380 | Ga0268265_10103069 | Ga0268265_101030691 | 227 |
| 237 | 3300032126 | Ga0307415_100312759 | Ga0307415_1003127592 | 227 |
| 238 | 3300037068 | Ga0373925_0693544 | Ga0373925_0693544_38_724 | 227 |
| 239 | 3300037418 | Ga0395900_0046437 | Ga0395900_0046437_2545_3231 | 227 |
| 240 | 3300037466 | Ga0395898_0480138 | Ga0395898_0480138_237_923 | 227 |
| 241 | 3300038443 | Ga0395901_0003123 | Ga0395901_0003123_10582_11268 | 227 |
| 242 | 3300038443 | Ga0395901_0052236 | Ga0395901_0052236_2923_3609 | 227 |
| 243 | 3300039438 | Ga0436360_1148383 | Ga0436360_1148383_3840_4526 | 227 |
| 244 | 3300039447 | Ga0436361_0830550 | Ga0436361_0830550_682_1368 | 227 |
| 245 | 3300041413 | Ga0439465_0119221 | Ga0439465_0119221_130_816 | 227 |
| 246 | 3300048929 | Ga0496126_0037873 | Ga0496126_0037873_129_815 | 227 |
| 247 | 3300049571 | Ga0501034_0008960 | Ga0501034_0008960_9213_9899 | 227 |
| 248 | 3300049571 | Ga0501034_0510767 | Ga0501034_0510767_78_764 | 227 |
| 249 | 3300050491 | nmdc:mga00v17_238233_c1 | nmdc:mga00v17_238233_c1_376_1062 | 227 |
| 250 | 3300050492 | nmdc:mga0yw44_110948_c1 | nmdc:mga0yw44_110948_c1_412_1098 | 227 |
| 251 | 3300050492 | nmdc:mga0yw44_161274_c1 | nmdc:mga0yw44_161274_c1_37_723 | 227 |
| 252 | 3300050494 | nmdc:mga06z11_84407_c1 | nmdc:mga06z11_84407_c1_612_1298 | 227 |
| 253 | 3300053096 | Ga0500641_0001723 | Ga0500641_0001723_5829_6515 | 227 |
| 254 | 3300053733 | Ga0500552_001444 | Ga0500552_001444_1207_1896 | 227 |
| 255 | iso_pu_bacteria | 2508501114 | 2509077857 | 227 |
| 256 | iso_pu_bacteria | 2513237144 | 2513912843 | 227 |
| 257 | iso_pu_bacteria | 2513237146 | 2513928631 | 227 |
| 258 | iso_pu_bacteria | 2599185170 | 2599420017 | 227 |
| 259 | iso_pu_bacteria | 2643221736 | 2644746906 | 227 |
| 260 | iso_pu_bacteria | 2835312727 | 2835316274 | 227 |
| 261 | iso_pu_bacteria | 2838035591 | 2838040224 | 227 |
| 262 | iso_pu_bacteria | 2838661181 | 2838667040 | 227 |
| 263 | iso_pu_bacteria | 2841760612 | 2841762355 | 227 |
| 264 | iso_pu_bacteria | 2844104063 | 2844109893 | 227 |
| 265 | iso_pu_bacteria | 2851182111 | 2851186922 | 227 |
| 266 | iso_pu_bacteria | 2851246043 | 2851248368 | 227 |
| 267 | iso_pu_bacteria | 2882456835 | 2882457942 | 227 |
| 268 | iso_pu_bacteria | 2884298095 | 2884300863 | 227 |
| 269 | iso_pu_bacteria | 2933016740 | 2933018610 | 227 |
| 270 | iso_pu_bacteria | 8057529695 | 8057535492 | 227 |
| 271 | iso_pu_bacteria | 2509276021 | 2509389285 | 228 |
| 272 | iso_pu_bacteria | 2509276033 | 2509446323 | 228 |
| 273 | iso_pu_bacteria | 2510461076 | 2510896828 | 228 |
| 274 | iso_pu_bacteria | 2510917028 | 2511182946 | 228 |
| 275 | iso_pu_bacteria | 2513237088 | 2513596943 | 228 |
| 276 | iso_pu_bacteria | 2513237093 | 2513634966 | 228 |
| 277 | iso_pu_bacteria | 2513237103 | 2513711474 | 228 |
| 278 | iso_pu_bacteria | 2513237138 | 2513865202 | 228 |
| 279 | iso_pu_bacteria | 2513237162 | 2514019538 | 228 |
| 280 | iso_pu_bacteria | 2515075009 | 2515114545 | 228 |
| 281 | iso_pu_bacteria | 2515154114 | 2515644399 | 228 |
| 282 | iso_pu_bacteria | 2515154116 | 2515657521 | 228 |
| 283 | iso_pu_bacteria | 2515154134 | 2515741726 | 228 |
| 284 | iso_pu_bacteria | 2516653085 | 2517078464 | 228 |
| 285 | iso_pu_bacteria | 2517093000 | 2517097203 | 228 |
| 286 | iso_pu_bacteria | 2524023209 | 2524461138 | 228 |
| 287 | iso_pu_bacteria | 2582581294 | 2585201613 | 228 |
| 288 | iso_pu_bacteria | 2582581299 | 2585233470 | 228 |
| 289 | iso_pu_bacteria | 2582581306 | 2585269653 | 228 |
| 290 | iso_pu_bacteria | 2582581865 | 2585388683 | 228 |
| 291 | iso_pu_bacteria | 2582581866 | 2585392531 | 228 |
| 292 | iso_pu_bacteria | 2585427526 | 2585529238 | 228 |
| 293 | iso_pu_bacteria | 2585427528 | 2585543054 | 228 |
| 294 | iso_pu_bacteria | 2585427593 | 2585839177 | 228 |
| 295 | iso_pu_bacteria | 2585427594 | 2585845011 | 228 |
| 296 | iso_pu_bacteria | 2615840624 | 2616297445 | 228 |
| 297 | iso_pu_bacteria | 2643221558 | 2643813872 | 228 |
| 298 | iso_pu_bacteria | 2643221643 | 2644240388 | 228 |
| 299 | iso_pu_bacteria | 2718217927 | 2719387801 | 228 |
| 300 | iso_pu_bacteria | 2718218423 | 2721401434 | 228 |
| 301 | iso_pu_bacteria | 2721755809 | 2724040248 | 228 |
| 302 | iso_pu_bacteria | 2724679232 | 2725945732 | 228 |
| 303 | iso_pu_bacteria | 2738541333 | 2739037750 | 228 |
| 304 | iso_pu_bacteria | 2791355256 | 2793295512 | 228 |
| 305 | iso_pu_bacteria | 2791355259 | 2793317617 | 228 |
| 306 | iso_pu_bacteria | 2791355262 | 2793332354 | 228 |
| 307 | iso_pu_bacteria | 2791355263 | 2793338948 | 228 |
| 308 | iso_pu_bacteria | 2791355265 | 2793356110 | 228 |
| 309 | iso_pu_bacteria | 2791355266 | 2793359255 | 228 |
| 310 | iso_pu_bacteria | 2791355267 | 2793366022 | 228 |
| 311 | iso_pu_bacteria | 2802429606 | 2805934056 | 228 |
| 312 | iso_pu_bacteria | 2802429633 | 2806047706 | 228 |
| 313 | iso_pu_bacteria | 2802429634 | 2806055282 | 228 |
| 314 | iso_pu_bacteria | 2802429635 | 2806062163 | 228 |
| 315 | iso_pu_bacteria | 2802429636 | 2806070078 | 228 |
| 316 | iso_pu_bacteria | 2802429637 | 2806076622 | 228 |
| 317 | iso_pu_bacteria | 2838042994 | 2838046702 | 228 |
| 318 | iso_pu_bacteria | 2838048938 | 2838050935 | 228 |
| 319 | iso_pu_bacteria | 2838680041 | 2838683758 | 228 |
| 320 | iso_pu_bacteria | 2838694306 | 2838698286 | 228 |
| 321 | iso_pu_bacteria | 2838707686 | 2838711401 | 228 |
| 322 | iso_pu_bacteria | 2841864319 | 2841867633 | 228 |
| 323 | iso_pu_bacteria | 2842077413 | 2842081202 | 228 |
| 324 | iso_pu_bacteria | 2842118031 | 2842122021 | 228 |
| 325 | iso_pu_bacteria | 2842205361 | 2842207537 | 228 |
| 326 | iso_pu_bacteria | 2842217011 | 2842221908 | 228 |
| 327 | iso_pu_bacteria | 2842237096 | 2842241035 | 228 |
| 328 | iso_pu_bacteria | 2842278818 | 2842280752 | 228 |
| 329 | iso_pu_bacteria | 2842285085 | 2842288637 | 228 |
| 330 | iso_pu_bacteria | 2842291075 | 2842294859 | 228 |
| 331 | iso_pu_bacteria | 2842298080 | 2842302581 | 228 |
| 332 | iso_pu_bacteria | 2842341865 | 2842346819 | 228 |
| 333 | iso_pu_bacteria | 2842363717 | 2842366148 | 228 |
| 334 | iso_pu_bacteria | 2842370503 | 2842375123 | 228 |
| 335 | iso_pu_bacteria | 2842377471 | 2842381258 | 228 |
| 336 | iso_pu_bacteria | 2842384541 | 2842388328 | 228 |
| 337 | iso_pu_bacteria | 2842395702 | 2842395817 | 228 |
| 338 | iso_pu_bacteria | 2842402390 | 2842406017 | 228 |
| 339 | iso_pu_bacteria | 2842409023 | 2842412601 | 228 |
| 340 | iso_pu_bacteria | 2842415677 | 2842419520 | 228 |
| 341 | iso_pu_bacteria | 2852387548 | 2852392055 | 228 |
| 342 | iso_pu_bacteria | 2933570622 | 2933572199 | 228 |
| 343 | iso_pu_bacteria | 2935894831 | 2935898062 | 228 |
| 344 | iso_pu_bacteria | 2936381700 | 2936381818 | 228 |
| 345 | iso_pu_bacteria | 2996893221 | 2996896127 | 228 |
| 346 | iso_pu_bacteria | 3005409236 | 3005415916 | 228 |
| 347 | iso_pu_bacteria | 639633055 | 639650563 | 228 |
| 348 | iso_pu_bacteria | 8005275841 | 8005282559 | 228 |
| 349 | iso_pu_bacteria | 8005307578 | 8005309650 | 228 |
| 350 | iso_pu_bacteria | 8005460587 | 8005465238 | 228 |
| 351 | iso_pu_bacteria | 8005570704 | 8005571973 | 228 |
| 352 | iso_pu_bacteria | 8005695170 | 8005695873 | 228 |
| 353 | iso_pu_bacteria | 8018127388 | 8018128714 | 228 |
| 354 | iso_pu_bacteria | 8018176218 | 8018177599 | 228 |
| 355 | iso_pu_bacteria | 8023680758 | 8023686681 | 228 |
| 356 | iso_pu_bacteria | 8046767195 | 8046768417 | 228 |
| 357 | iso_pu_bacteria | 8056375014 | 8056380534 | 228 |
| 358 | iso_pu_bacteria | 8056382006 | 8056383407 | 228 |
| 359 | iso_pu_bacteria | 8057575449 | 8057581914 | 228 |
| 360 | iso_pu_bacteria | 8057874678 | 8057879418 | 228 |
| 361 | 3300009098 | Ga0105245_10892742 | Ga0105245_108927422 | 229 |
| 362 | 3300009148 | Ga0105243_10329322 | Ga0105243_103293222 | 229 |
| 363 | 3300010375 | Ga0105239_10475738 | Ga0105239_104757382 | 229 |
| 364 | 3300032002 | Ga0307416_100209196 | Ga0307416_1002091963 | 229 |
| 365 | 3300032005 | Ga0307411_10335583 | Ga0307411_103355832 | 229 |
| 366 | 3300032126 | Ga0307415_100035445 | Ga0307415_1000354453 | 229 |
| 367 | 3300041413 | Ga0439465_0000941 | Ga0439465_0000941_8285_9037 | 229 |
| 368 | 3300042004 | Ga0439445_0049949 | Ga0439445_0049949_195_947 | 229 |
| 369 | 3300042006 | Ga0439432_037626 | Ga0439432_037626_33_785 | 229 |
| 370 | 3300042007 | Ga0439449_0039879 | Ga0439449_0039879_654_1406 | 229 |
| 371 | 3300049575 | Ga0501039_0223604 | Ga0501039_0223604_641_1333 | 229 |
| 372 | 3300049587 | Ga0501071_0451795 | Ga0501071_0451795_270_962 | 229 |
| 373 | 3300050493 | nmdc:mga0k408_3957_c1 | nmdc:mga0k408_3957_c1_193_885 | 229 |
| 374 | iso_pu_bacteria | 2510065019 | 2510135375 | 229 |
| 375 | iso_pu_bacteria | 2513237084 | 2513572930 | 229 |
| 376 | iso_pu_bacteria | 2516653077 | 2517038186 | 229 |
| 377 | iso_pu_bacteria | 2765235942 | 2766064133 | 229 |
| 378 | iso_pu_bacteria | 2842110456 | 2842116546 | 229 |
| 379 | iso_pu_bacteria | 2857516855 | 2857519711 | 229 |
| 380 | iso_pu_bacteria | 2933586486 | 2933592847 | 229 |
| 381 | iso_pu_bacteria | 2936367885 | 2936370030 | 229 |
| 382 | iso_pu_bacteria | 2936375103 | 2936379206 | 229 |
| 383 | iso_pu_bacteria | 8005376324 | 8005381440 | 229 |
| 384 | iso_pu_bacteria | 8005556819 | 8005561302 | 229 |
| 385 | iso_pu_bacteria | 8005563573 | 8005565925 | 229 |
| 386 | iso_pu_bacteria | 8024479707 | 8024484500 | 229 |
| 387 | 3300002077 | JGI24744J21845_10013276 | JGI24744J21845_100132761 | 230 |
| 388 | 3300003771 | Ga0055526_1000202 | Ga0055526_100020221 | 230 |
| 389 | 3300003775 | Ga0055524_1000144 | Ga0055524_100014439 | 230 |
| 390 | 3300005262 | Ga0065165_1000393 | Ga0065165_100039338 | 230 |
| 391 | 3300005327 | Ga0070658_10022683 | Ga0070658_100226832 | 230 |
| 392 | 3300005328 | Ga0070676_10005980 | Ga0070676_100059806 | 230 |
| 393 | 3300005329 | Ga0070683_100151465 | Ga0070683_1001514652 | 230 |
| 394 | 3300005330 | Ga0070690_100048793 | Ga0070690_1000487935 | 230 |
| 395 | 3300005331 | Ga0070670_100016489 | Ga0070670_1000164894 | 230 |
| 396 | 3300005335 | Ga0070666_10029451 | Ga0070666_100294515 | 230 |
| 397 | 3300005336 | Ga0070680_100042741 | Ga0070680_1000427412 | 230 |
| 398 | 3300005337 | Ga0070682_100002624 | Ga0070682_1000026243 | 230 |
| 399 | 3300005339 | Ga0070660_100002918 | Ga0070660_1000029188 | 230 |
| 400 | 3300005340 | Ga0070689_100008205 | Ga0070689_1000082054 | 230 |
| 401 | 3300005341 | Ga0070691_10002663 | Ga0070691_100026633 | 230 |
| 402 | 3300005343 | Ga0070687_100002871 | Ga0070687_1000028718 | 230 |
| 403 | 3300005344 | Ga0070661_100001269 | Ga0070661_10000126911 | 230 |
| 404 | 3300005345 | Ga0070692_10001461 | Ga0070692_1000146110 | 230 |
| 405 | 3300005345 | Ga0070692_10032335 | Ga0070692_100323354 | 230 |
| 406 | 3300005347 | Ga0070668_100057296 | Ga0070668_1000572963 | 230 |
| 407 | 3300005353 | Ga0070669_100008503 | Ga0070669_1000085033 | 230 |
| 408 | 3300005354 | Ga0070675_100105008 | Ga0070675_1001050082 | 230 |
| 409 | 3300005355 | Ga0070671_100021552 | Ga0070671_1000215524 | 230 |
| 410 | 3300005356 | Ga0070674_100010365 | Ga0070674_1000103653 | 230 |
| 411 | 3300005364 | Ga0070673_100015800 | Ga0070673_1000158007 | 230 |
| 412 | 3300005365 | Ga0070688_100006488 | Ga0070688_1000064889 | 230 |
| 413 | 3300005366 | Ga0070659_100287181 | Ga0070659_1002871811 | 230 |
| 414 | 3300005367 | Ga0070667_100005375 | Ga0070667_1000053758 | 230 |
| 415 | 3300005367 | Ga0070667_100509062 | Ga0070667_1005090622 | 230 |
| 416 | 3300005434 | Ga0070709_10005506 | Ga0070709_100055064 | 230 |
| 417 | 3300005435 | Ga0070714_100018241 | Ga0070714_1000182414 | 230 |
| 418 | 3300005435 | Ga0070714_100169176 | Ga0070714_1001691762 | 230 |
| 419 | 3300005435 | Ga0070714_100275499 | Ga0070714_1002754992 | 230 |
| 420 | 3300005436 | Ga0070713_100011376 | Ga0070713_1000113763 | 230 |
| 421 | 3300005436 | Ga0070713_100033540 | Ga0070713_1000335403 | 230 |
| 422 | 3300005436 | Ga0070713_100263955 | Ga0070713_1002639552 | 230 |
| 423 | 3300005436 | Ga0070713_100644162 | Ga0070713_1006441622 | 230 |
| 424 | 3300005437 | Ga0070710_10008479 | Ga0070710_100084793 | 230 |
| 425 | 3300005438 | Ga0070701_10004911 | Ga0070701_100049117 | 230 |
| 426 | 3300005439 | Ga0070711_100002373 | Ga0070711_1000023738 | 230 |
| 427 | 3300005439 | Ga0070711_100004371 | Ga0070711_1000043715 | 230 |
| 428 | 3300005439 | Ga0070711_100177537 | Ga0070711_1001775372 | 230 |
| 429 | 3300005440 | Ga0070705_100003239 | Ga0070705_1000032397 | 230 |
| 430 | 3300005441 | Ga0070700_100013579 | Ga0070700_1000135793 | 230 |
| 431 | 3300005444 | Ga0070694_100024108 | Ga0070694_1000241084 | 230 |
| 432 | 3300005455 | Ga0070663_100030921 | Ga0070663_1000309214 | 230 |
| 433 | 3300005456 | Ga0070678_100043538 | Ga0070678_1000435382 | 230 |
| 434 | 3300005457 | Ga0070662_100005948 | Ga0070662_1000059489 | 230 |
| 435 | 3300005457 | Ga0070662_100421427 | Ga0070662_1004214272 | 230 |
| 436 | 3300005458 | Ga0070681_10161616 | Ga0070681_101616162 | 230 |
| 437 | 3300005459 | Ga0068867_100092852 | Ga0068867_1000928522 | 230 |
| 438 | 3300005466 | Ga0070685_10013900 | Ga0070685_100139003 | 230 |
| 439 | 3300005467 | Ga0070706_100023669 | Ga0070706_1000236695 | 230 |
| 440 | 3300005468 | Ga0070707_100055362 | Ga0070707_1000553623 | 230 |
| 441 | 3300005530 | Ga0070679_100019879 | Ga0070679_1000198794 | 230 |
| 442 | 3300005535 | Ga0070684_100010433 | Ga0070684_1000104334 | 230 |
| 443 | 3300005536 | Ga0070697_100007900 | Ga0070697_1000079005 | 230 |
| 444 | 3300005539 | Ga0068853_100001909 | Ga0068853_1000019096 | 230 |
| 445 | 3300005543 | Ga0070672_100008242 | Ga0070672_1000082426 | 230 |
| 446 | 3300005544 | Ga0070686_100045315 | Ga0070686_1000453151 | 230 |
| 447 | 3300005545 | Ga0070695_100010224 | Ga0070695_1000102249 | 230 |
| 448 | 3300005546 | Ga0070696_100004768 | Ga0070696_1000047689 | 230 |
| 449 | 3300005546 | Ga0070696_100086386 | Ga0070696_1000863862 | 230 |
| 450 | 3300005547 | Ga0070693_100001532 | Ga0070693_1000015329 | 230 |
| 451 | 3300005548 | Ga0070665_100044241 | Ga0070665_1000442412 | 230 |
| 452 | 3300005549 | Ga0070704_100007835 | Ga0070704_1000078356 | 230 |
| 453 | 3300005563 | Ga0068855_100062494 | Ga0068855_1000624944 | 230 |
| 454 | 3300005564 | Ga0070664_100005241 | Ga0070664_1000052419 | 230 |
| 455 | 3300005577 | Ga0068857_100011135 | Ga0068857_1000111359 | 230 |
| 456 | 3300005578 | Ga0068854_100016106 | Ga0068854_1000161064 | 230 |
| 457 | 3300005614 | Ga0068856_100022882 | Ga0068856_1000228825 | 230 |
| 458 | 3300005614 | Ga0068856_100045829 | Ga0068856_1000458292 | 230 |
| 459 | 3300005615 | Ga0070702_100000110 | Ga0070702_10000011021 | 230 |
| 460 | 3300005615 | Ga0070702_100408255 | Ga0070702_1004082552 | 230 |
| 461 | 3300005616 | Ga0068852_100016633 | Ga0068852_1000166333 | 230 |
| 462 | 3300005617 | Ga0068859_100047063 | Ga0068859_1000470634 | 230 |
| 463 | 3300005618 | Ga0068864_100006128 | Ga0068864_1000061285 | 230 |
| 464 | 3300005718 | Ga0068866_10019633 | Ga0068866_100196332 | 230 |
| 465 | 3300005719 | Ga0068861_100004689 | Ga0068861_1000046897 | 230 |
| 466 | 3300005841 | Ga0068863_100003256 | Ga0068863_10000325616 | 230 |
| 467 | 3300005842 | Ga0068858_100012407 | Ga0068858_1000124073 | 230 |
| 468 | 3300005843 | Ga0068860_100038778 | Ga0068860_1000387783 | 230 |
| 469 | 3300005844 | Ga0068862_100001176 | Ga0068862_10000117621 | 230 |
| 470 | 3300006028 | Ga0070717_10035079 | Ga0070717_100350794 | 230 |
| 471 | 3300006038 | Ga0075365_10226495 | Ga0075365_102264952 | 230 |
| 472 | 3300006038 | Ga0075365_10486578 | Ga0075365_104865782 | 230 |
| 473 | 3300006163 | Ga0070715_10042047 | Ga0070715_100420472 | 230 |
| 474 | 3300006173 | Ga0070716_100000813 | Ga0070716_1000008139 | 230 |
| 475 | 3300006175 | Ga0070712_100003324 | Ga0070712_1000033249 | 230 |
| 476 | 3300006237 | Ga0097621_100077120 | Ga0097621_1000771202 | 230 |
| 477 | 3300006881 | Ga0068865_100016645 | Ga0068865_1000166454 | 230 |
| 478 | 3300006914 | Ga0075436_100094225 | Ga0075436_1000942252 | 230 |
| 479 | 3300006931 | Ga0097620_100047065 | Ga0097620_1000470654 | 230 |
| 480 | 3300009098 | Ga0105245_10013417 | Ga0105245_100134176 | 230 |
| 481 | 3300009101 | Ga0105247_10131427 | Ga0105247_101314272 | 230 |
| 482 | 3300009148 | Ga0105243_10008677 | Ga0105243_100086776 | 230 |
| 483 | 3300009174 | Ga0105241_10010650 | Ga0105241_100106505 | 230 |
| 484 | 3300009176 | Ga0105242_10017182 | Ga0105242_100171824 | 230 |
| 485 | 3300009177 | Ga0105248_10004856 | Ga0105248_1000485613 | 230 |
| 486 | 3300009545 | Ga0105237_10004828 | Ga0105237_1000482811 | 230 |
| 487 | 3300009553 | Ga0105249_10000914 | Ga0105249_1000091422 | 230 |
| 488 | 3300010375 | Ga0105239_10042206 | Ga0105239_100422064 | 230 |
| 489 | 3300011119 | Ga0105246_10099578 | Ga0105246_100995782 | 230 |
| 490 | 3300012487 | Ga0157321_1000150 | Ga0157321_10001503 | 230 |
| 491 | 3300013102 | Ga0157371_10002409 | Ga0157371_1000240915 | 230 |
| 492 | 3300013105 | Ga0157369_10010257 | Ga0157369_100102573 | 230 |
| 493 | 3300013296 | Ga0157374_10019924 | Ga0157374_100199245 | 230 |
| 494 | 3300013297 | Ga0157378_10017362 | Ga0157378_100173626 | 230 |
| 495 | 3300013306 | Ga0163162_10063947 | Ga0163162_100639473 | 230 |
| 496 | 3300013306 | Ga0163162_11189620 | Ga0163162_111896202 | 230 |
| 497 | 3300013307 | Ga0157372_10019029 | Ga0157372_100190299 | 230 |
| 498 | 3300013308 | Ga0157375_10005142 | Ga0157375_100051426 | 230 |
| 499 | 3300014326 | Ga0157380_10013155 | Ga0157380_100131555 | 230 |
| 500 | 3300014745 | Ga0157377_10020367 | Ga0157377_100203672 | 230 |
| 501 | 3300014968 | Ga0157379_10003396 | Ga0157379_1000339611 | 230 |
| 502 | 3300017792 | Ga0163161_10002750 | Ga0163161_1000275012 | 230 |
| 503 | 3300021388 | Ga0213875_10000382 | Ga0213875_1000038215 | 230 |
| 504 | 3300025273 | Ga0209673_1013749 | Ga0209673_10137492 | 230 |
| 505 | 3300025284 | Ga0209130_1000061 | Ga0209130_100006140 | 230 |
| 506 | 3300025291 | Ga0209675_1003298 | Ga0209675_10032985 | 230 |
| 507 | 3300025294 | Ga0209025_1000014 | Ga0209025_1000014544 | 230 |
| 508 | 3300025294 | Ga0209025_1014200 | Ga0209025_10142004 | 230 |
| 509 | 3300025294 | Ga0209025_1040858 | Ga0209025_10408582 | 230 |
| 510 | 3300025295 | Ga0209564_1000187 | Ga0209564_100018749 | 230 |
| 511 | 3300025299 | Ga0209256_1000055 | Ga0209256_1000055242 | 230 |
| 512 | 3300025302 | Ga0207426_1020488 | Ga0207426_10204883 | 230 |
| 513 | 3300025315 | Ga0207697_10046742 | Ga0207697_100467422 | 230 |
| 514 | 3300025900 | Ga0207710_10016320 | Ga0207710_100163202 | 230 |
| 515 | 3300025904 | Ga0207647_10019501 | Ga0207647_100195012 | 230 |
| 516 | 3300025905 | Ga0207685_10002027 | Ga0207685_100020274 | 230 |
| 517 | 3300025906 | Ga0207699_10005612 | Ga0207699_100056125 | 230 |
| 518 | 3300025906 | Ga0207699_10044035 | Ga0207699_100440352 | 230 |
| 519 | 3300025907 | Ga0207645_10003136 | Ga0207645_1000313611 | 230 |
| 520 | 3300025909 | Ga0207705_10050469 | Ga0207705_100504691 | 230 |
| 521 | 3300025911 | Ga0207654_10058148 | Ga0207654_100581482 | 230 |
| 522 | 3300025914 | Ga0207671_10014576 | Ga0207671_100145766 | 230 |
| 523 | 3300025915 | Ga0207693_10000133 | Ga0207693_1000013369 | 230 |
| 524 | 3300025915 | Ga0207693_10012635 | Ga0207693_100126352 | 230 |
| 525 | 3300025915 | Ga0207693_10154484 | Ga0207693_101544842 | 230 |
| 526 | 3300025915 | Ga0207693_10261235 | Ga0207693_102612352 | 230 |
| 527 | 3300025916 | Ga0207663_10066927 | Ga0207663_100669271 | 230 |
| 528 | 3300025916 | Ga0207663_10069610 | Ga0207663_100696102 | 230 |
| 529 | 3300025916 | Ga0207663_10131305 | Ga0207663_101313052 | 230 |
| 530 | 3300025916 | Ga0207663_10152667 | Ga0207663_101526671 | 230 |
| 531 | 3300025917 | Ga0207660_10031253 | Ga0207660_100312533 | 230 |
| 532 | 3300025917 | Ga0207660_10447087 | Ga0207660_104470872 | 230 |
| 533 | 3300025918 | Ga0207662_10001646 | Ga0207662_100016463 | 230 |
| 534 | 3300025919 | Ga0207657_10001128 | Ga0207657_1000112817 | 230 |
| 535 | 3300025920 | Ga0207649_10004890 | Ga0207649_100048907 | 230 |
| 536 | 3300025922 | Ga0207646_10021237 | Ga0207646_100212375 | 230 |
| 537 | 3300025923 | Ga0207681_10048910 | Ga0207681_100489104 | 230 |
| 538 | 3300025925 | Ga0207650_10048517 | Ga0207650_100485172 | 230 |
| 539 | 3300025926 | Ga0207659_10021784 | Ga0207659_100217842 | 230 |
| 540 | 3300025927 | Ga0207687_10007754 | Ga0207687_100077544 | 230 |
| 541 | 3300025928 | Ga0207700_10038709 | Ga0207700_100387092 | 230 |
| 542 | 3300025928 | Ga0207700_10047814 | Ga0207700_100478143 | 230 |
| 543 | 3300025928 | Ga0207700_10083677 | Ga0207700_100836772 | 230 |
| 544 | 3300025928 | Ga0207700_10120552 | Ga0207700_101205522 | 230 |
| 545 | 3300025928 | Ga0207700_10219804 | Ga0207700_102198041 | 230 |
| 546 | 3300025928 | Ga0207700_10253128 | Ga0207700_102531282 | 230 |
| 547 | 3300025929 | Ga0207664_10053300 | Ga0207664_100533002 | 230 |
| 548 | 3300025929 | Ga0207664_10072720 | Ga0207664_100727202 | 230 |
| 549 | 3300025931 | Ga0207644_10057756 | Ga0207644_100577562 | 230 |
| 550 | 3300025932 | Ga0207690_10014673 | Ga0207690_100146734 | 230 |
| 551 | 3300025933 | Ga0207706_10000195 | Ga0207706_1000019572 | 230 |
| 552 | 3300025934 | Ga0207686_10010765 | Ga0207686_100107654 | 230 |
| 553 | 3300025936 | Ga0207670_10101280 | Ga0207670_101012803 | 230 |
| 554 | 3300025936 | Ga0207670_10206563 | Ga0207670_102065632 | 230 |
| 555 | 3300025937 | Ga0207669_10005710 | Ga0207669_100057104 | 230 |
| 556 | 3300025938 | Ga0207704_10038802 | Ga0207704_100388023 | 230 |
| 557 | 3300025939 | Ga0207665_10000068 | Ga0207665_100000687 | 230 |
| 558 | 3300025940 | Ga0207691_10022804 | Ga0207691_100228043 | 230 |
| 559 | 3300025941 | Ga0207711_10051281 | Ga0207711_100512814 | 230 |
| 560 | 3300025944 | Ga0207661_10136930 | Ga0207661_101369302 | 230 |
| 561 | 3300025945 | Ga0207679_10129779 | Ga0207679_101297792 | 230 |
| 562 | 3300025949 | Ga0207667_10030011 | Ga0207667_100300116 | 230 |
| 563 | 3300025960 | Ga0207651_10011247 | Ga0207651_100112474 | 230 |
| 564 | 3300025961 | Ga0207712_10050265 | Ga0207712_100502654 | 230 |
| 565 | 3300025972 | Ga0207668_10009155 | Ga0207668_100091554 | 230 |
| 566 | 3300025981 | Ga0207640_10011399 | Ga0207640_100113993 | 230 |
| 567 | 3300025986 | Ga0207658_10040692 | Ga0207658_100406922 | 230 |
| 568 | 3300026035 | Ga0207703_10032061 | Ga0207703_100320615 | 230 |
| 569 | 3300026041 | Ga0207639_10022144 | Ga0207639_100221443 | 230 |
| 570 | 3300026067 | Ga0207678_10000128 | Ga0207678_1000012831 | 230 |
| 571 | 3300026075 | Ga0207708_10009009 | Ga0207708_100090093 | 230 |
| 572 | 3300026075 | Ga0207708_10078163 | Ga0207708_100781632 | 230 |
| 573 | 3300026078 | Ga0207702_10016712 | Ga0207702_1001671210 | 230 |
| 574 | 3300026078 | Ga0207702_10040366 | Ga0207702_100403663 | 230 |
| 575 | 3300026095 | Ga0207676_10029203 | Ga0207676_100292032 | 230 |
| 576 | 3300026116 | Ga0207674_10000779 | Ga0207674_1000077917 | 230 |
| 577 | 3300026118 | Ga0207675_100111144 | Ga0207675_1001111444 | 230 |
| 578 | 3300026121 | Ga0207683_10017091 | Ga0207683_100170915 | 230 |
| 579 | 3300026142 | Ga0207698_10883393 | Ga0207698_108833931 | 230 |
| 580 | 3300027671 | Ga0209588_1088279 | Ga0209588_10882792 | 230 |
| 581 | 3300027907 | Ga0207428_10130558 | Ga0207428_101305582 | 230 |
| 582 | 3300028379 | Ga0268266_10009593 | Ga0268266_100095934 | 230 |
| 583 | 3300028379 | Ga0268266_10122557 | Ga0268266_101225572 | 230 |
| 584 | 3300028380 | Ga0268265_10017111 | Ga0268265_100171111 | 230 |
| 585 | 3300028381 | Ga0268264_10018642 | Ga0268264_1001864210 | 230 |
| 586 | 3300028381 | Ga0268264_10504698 | Ga0268264_105046982 | 230 |
| 587 | 3300028577 | Ga0265318_10010199 | Ga0265318_100101992 | 230 |
| 588 | 3300031240 | Ga0265320_10214421 | Ga0265320_102144212 | 230 |
| 589 | 3300035112 | Ga0373932_0004774 | Ga0373932_0004774_908_1600 | 230 |
| 590 | 3300035170 | Ga0373943_0394458 | Ga0373943_0394458_20_724 | 230 |
| 591 | 3300035691 | Ga0373931_0013189 | Ga0373931_0013189_794_1486 | 230 |
| 592 | 3300037068 | Ga0373925_0283188 | Ga0373925_0283188_268_972 | 230 |
| 593 | 3300037853 | Ga0436364_0042928 | Ga0436364_0042928_41574_42278 | 230 |
| 594 | 3300039437 | Ga0436365_1830300 | Ga0436365_1830300_183_878 | 230 |
| 595 | 3300039438 | Ga0436360_0007794 | Ga0436360_0007794_116_814 | 230 |
| 596 | 3300039438 | Ga0436360_1369805 | Ga0436360_1369805_65_763 | 230 |
| 597 | 3300039447 | Ga0436361_0943746 | Ga0436361_0943746_56_754 | 230 |
| 598 | 3300046506 | Ga0495583_0178265 | Ga0495583_0178265_120_815 | 230 |
| 599 | 3300046511 | Ga0495608_0269315 | Ga0495608_0269315_284_985 | 230 |
| 600 | 3300046536 | Ga0495587_0315285 | Ga0495587_0315285_40_741 | 230 |
| 601 | 3300046683 | Ga0495658_0001152 | Ga0495658_0001152_10133_10834 | 230 |
| 602 | 3300048903 | Ga0496100_0097862 | Ga0496100_0097862_130_822 | 230 |
| 603 | 3300048904 | Ga0496101_0078631 | Ga0496101_0078631_1391_2083 | 230 |
| 604 | 3300048905 | Ga0496102_0175855 | Ga0496102_0175855_130_822 | 230 |
| 605 | 3300048905 | Ga0496102_0271045 | Ga0496102_0271045_101_796 | 230 |
| 606 | 3300048906 | Ga0496103_0030105 | Ga0496103_0030105_1546_2238 | 230 |
| 607 | 3300048907 | Ga0496104_0018902 | Ga0496104_0018902_2546_3238 | 230 |
| 608 | 3300048908 | Ga0496105_0074129 | Ga0496105_0074129_891_1583 | 230 |
| 609 | 3300048909 | Ga0496106_0037145 | Ga0496106_0037145_2546_3238 | 230 |
| 610 | 3300048909 | Ga0496106_0086941 | Ga0496106_0086941_1329_2024 | 230 |
| 611 | 3300048910 | Ga0496107_0028475 | Ga0496107_0028475_3021_3713 | 230 |
| 612 | 3300048910 | Ga0496107_0556115 | Ga0496107_0556115_122_817 | 230 |
| 613 | 3300048911 | Ga0496108_0039012 | Ga0496108_0039012_1418_2110 | 230 |
| 614 | 3300048911 | Ga0496108_0719674 | Ga0496108_0719674_48_743 | 230 |
| 615 | 3300048912 | Ga0496109_0055034 | Ga0496109_0055034_1919_2611 | 230 |
| 616 | 3300048912 | Ga0496109_0101585 | Ga0496109_0101585_1189_1884 | 230 |
| 617 | 3300048913 | Ga0496110_0038422 | Ga0496110_0038422_3216_3908 | 230 |
| 618 | 3300048913 | Ga0496110_0390330 | Ga0496110_0390330_551_1246 | 230 |
| 619 | 3300048913 | Ga0496110_0440538 | Ga0496110_0440538_429_1133 | 230 |
| 620 | 3300048914 | Ga0496111_0062526 | Ga0496111_0062526_258_950 | 230 |
| 621 | 3300048914 | Ga0496111_0076732 | Ga0496111_0076732_1133_1828 | 230 |
| 622 | 3300048915 | Ga0496112_0126917 | Ga0496112_0126917_412_1104 | 230 |
| 623 | 3300048916 | Ga0496113_0052700 | Ga0496113_0052700_2055_2759 | 230 |
| 624 | 3300048916 | Ga0496113_0055250 | Ga0496113_0055250_2026_2718 | 230 |
| 625 | 3300048916 | Ga0496113_0166157 | Ga0496113_0166157_197_892 | 230 |
| 626 | 3300048917 | Ga0496114_0208714 | Ga0496114_0208714_891_1583 | 230 |
| 627 | 3300048918 | Ga0496115_0102150 | Ga0496115_0102150_258_950 | 230 |
| 628 | 3300048920 | Ga0496117_0075984 | Ga0496117_0075984_667_1365 | 230 |
| 629 | 3300049571 | Ga0501034_0024480 | Ga0501034_0024480_5165_5866 | 230 |
| 630 | 3300049571 | Ga0501034_0098476 | Ga0501034_0098476_1839_2537 | 230 |
| 631 | 3300049572 | Ga0501036_0009582 | Ga0501036_0009582_4244_4945 | 230 |
| 632 | 3300049572 | Ga0501036_0012973 | Ga0501036_0012973_5796_6497 | 230 |
| 633 | 3300049573 | Ga0501037_0170671 | Ga0501037_0170671_359_1057 | 230 |
| 634 | 3300049574 | Ga0501038_0001082 | Ga0501038_0001082_2744_3445 | 230 |
| 635 | 3300049575 | Ga0501039_0000168 | Ga0501039_0000168_4542_5243 | 230 |
| 636 | 3300049576 | Ga0501040_0001149 | Ga0501040_0001149_11459_12160 | 230 |
| 637 | 3300049576 | Ga0501040_0016387 | Ga0501040_0016387_70_771 | 230 |
| 638 | 3300049577 | Ga0501041_0000623 | Ga0501041_0000623_6197_6898 | 230 |
| 639 | 3300049578 | Ga0501042_0007758 | Ga0501042_0007758_1826_2527 | 230 |
| 640 | 3300049579 | Ga0501043_0155073 | Ga0501043_0155073_636_1337 | 230 |
| 641 | 3300049580 | Ga0501046_0000480 | Ga0501046_0000480_16318_17019 | 230 |
| 642 | 3300049582 | Ga0501048_0000896 | Ga0501048_0000896_8502_9203 | 230 |
| 643 | 3300049582 | Ga0501048_0063986 | Ga0501048_0063986_1746_2447 | 230 |
| 644 | 3300049583 | Ga0501067_0040015 | Ga0501067_0040015_1078_1776 | 230 |
| 645 | 3300049586 | Ga0501070_0337576 | Ga0501070_0337576_150_851 | 230 |
| 646 | 3300049587 | Ga0501071_0006119 | Ga0501071_0006119_3911_4612 | 230 |
| 647 | 3300049587 | Ga0501071_0238458 | Ga0501071_0238458_457_1158 | 230 |
| 648 | 3300049588 | Ga0501072_0002754 | Ga0501072_0002754_8456_9157 | 230 |
| 649 | 3300049588 | Ga0501072_0021236 | Ga0501072_0021236_1069_1770 | 230 |
| 650 | 3300049588 | Ga0501072_0052612 | Ga0501072_0052612_2315_3016 | 230 |
| 651 | 3300049590 | Ga0501074_0017319 | Ga0501074_0017319_583_1284 | 230 |
| 652 | 3300049590 | Ga0501074_0205519 | Ga0501074_0205519_613_1317 | 230 |
| 653 | 3300049591 | Ga0501075_0000046 | Ga0501075_0000046_6102_6803 | 230 |
| 654 | 3300049591 | Ga0501075_0206837 | Ga0501075_0206837_269_970 | 230 |
| 655 | 3300049592 | Ga0501076_0000566 | Ga0501076_0000566_14550_15251 | 230 |
| 656 | 3300049592 | Ga0501076_0148292 | Ga0501076_0148292_169_867 | 230 |
| 657 | 3300049593 | Ga0501077_0004492 | Ga0501077_0004492_4239_4940 | 230 |
| 658 | 3300049593 | Ga0501077_0058409 | Ga0501077_0058409_1057_1755 | 230 |
| 659 | 3300049741 | Ga0501079_0000808 | Ga0501079_0000808_4813_5514 | 230 |
| 660 | 3300049742 | Ga0501080_0031560 | Ga0501080_0031560_4057_4758 | 230 |
| 661 | 3300049742 | Ga0501080_0087780 | Ga0501080_0087780_2104_2805 | 230 |
| 662 | 3300049742 | Ga0501080_0654637 | Ga0501080_0654637_66_764 | 230 |
| 663 | 3300049743 | Ga0501081_0005566 | Ga0501081_0005566_3211_3912 | 230 |
| 664 | 3300049743 | Ga0501081_0011120 | Ga0501081_0011120_2361_3062 | 230 |
| 665 | 3300049822 | Ga0501035_0156603 | Ga0501035_0156603_1191_1892 | 230 |
| 666 | 3300049823 | Ga0501044_0020009 | Ga0501044_0020009_1735_2436 | 230 |
| 667 | 3300049824 | Ga0501045_0004353 | Ga0501045_0004353_8515_9216 | 230 |
| 668 | 3300049824 | Ga0501045_0043187 | Ga0501045_0043187_753_1454 | 230 |
| 669 | 3300049824 | Ga0501045_0063202 | Ga0501045_0063202_461_1162 | 230 |
| 670 | 3300053085 | Ga0495619_0514202 | Ga0495619_0514202_103_807 | 230 |
| 671 | 3300054114 | Ga0501084_0005468 | Ga0501084_0005468_4726_5427 | 230 |
| 672 | 3300054114 | Ga0501084_0011377 | Ga0501084_0011377_1109_1807 | 230 |
| 673 | 3300054114 | Ga0501084_0169982 | Ga0501084_0169982_599_1297 | 230 |
| 674 | 3300054114 | Ga0501084_0213048 | Ga0501084_0213048_303_1004 | 230 |
| 675 | 3300054114 | Ga0501084_0242261 | Ga0501084_0242261_464_1165 | 230 |
| 676 | 3300060353 | Ga0501082_0002802 | Ga0501082_0002802_2935_3636 | 230 |
| 677 | 3300060353 | Ga0501082_0115722 | Ga0501082_0115722_1148_1846 | 230 |
| 678 | 3300060353 | Ga0501082_0120199 | Ga0501082_0120199_351_1052 | 230 |
| 679 | 3300060353 | Ga0501082_0424413 | Ga0501082_0424413_128_826 | 230 |
| 680 | 3300061734 | Ga0530510_0002668 | Ga0530510_0002668_7589_8290 | 230 |
| 681 | 3300061734 | Ga0530510_0004584 | Ga0530510_0004584_213_914 | 230 |
| 682 | 3300061734 | Ga0530510_0190855 | Ga0530510_0190855_498_1199 | 230 |
| 683 | iso_pu_bacteria | 2643221688 | 2644496460 | 230 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
29
214
0.79
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.9592 | 7 | 216 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.9125 | 5 | 217 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.8459 | 7 | 216 |
| 2r6g-assembly1.cif.gz_G | the crystal structure of the e. coli maltose transporter | 0.8367 | 9 | 219 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8316 | 6 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AF01_2_224_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9831 | 3 | 224 | 1.10.3720.10 |
| af_P0AF01_2_224_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9744 | 3 | 224 | 1.10.3720.10 |
| af_P9WG13_10_255_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9648 | 5 | 218 | 1.10.3720.10 |
| af_P16701_14_273_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9632 | 6 | 226 | 1.10.3720.10 |
| 3d31C00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9592 | 7 | 216 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528EAM7-F1-model_v4 | Molybdate ABC transporter permease subunit | 0.9942 | 4 | 171 |
GO:0005886
GO:0055085 |
| AF-A0A0Q7NJ65-F1-model_v4 | Molybdenum transport system permease | 0.993 | 2 | 229 |
GO:0005886
GO:0015098 |
| AF-A0A255XIF6-F1-model_v4 | Molybdenum transport system permease | 0.9928 | 2 | 227 |
GO:0005886
GO:0015098 |
| AF-A0A4Q3HP68-F1-model_v4 | Molybdenum transport system permease | 0.9919 | 3 | 208 |
GO:0005886
GO:0015098 |
| AF-A0A1Q9APR5-F1-model_v4 | Molybdenum transport system permease | 0.9918 | 2 | 229 |
GO:0005886
GO:0015098 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar