F475015
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 359 | 659 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_183752_c1|nmdc:mga0k408_183752_c1_409_1155 |
| Length | 248 |
| Sequence | MAEKVLSSESGSLPEGAGRRRAFGPAGGAGAMLGAMMKLYNYFRSSASFRVRIALNLKGLDYDYLPVHIARGEHKTGSFSAISPDMLVPLLEDDGERFTQSMAIIEYLDEIHPEPALLPHDPVGRAHVRALAQSVACEIHPLNNLRVLKYLVRELKLSDDAKNTWYRHWVREGMLAFERQLALRPASLYCWGDAPTLADCCLVPQVFNGQRFDCDFSGLPRTMAAFEACMQLDAFQRAQPSRCPDAEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 5 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 6 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 7 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 8 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 9 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 10 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 11 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 12 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 13 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 14 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 15 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 16 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 17 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 18 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 19 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 20 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 21 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 22 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 98 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 99 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 192 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 193 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 194 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 195 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 218 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 219 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 220 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 221 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 222 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 229 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 230 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 233 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 234 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 235 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 236 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 237 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 238 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 239 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 240 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 243 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 244 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 245 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 246 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 247 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 308 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 309 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 310 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 311 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 312 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 313 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 314 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 315 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 348 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 354 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 355 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 358 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 359 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.49 |
| Metatranscriptomes | 0 |
| Isolates | 3.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.86 |
| Nodule | 1.32 |
| Rhizoplane | 3.81 |
| Rhizosphere | 74.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10001315 | 3300003187 | Bacteria | 17394 |
| 2 | JGI25151J46595_10012244 | 3300003187 | Bacteria | 3907 |
| 3 | JGI25151J46595_10033570 | 3300003187 | Bacteria | 1975 |
| 4 | JGI25151J46595_10050360 | 3300003187 | Bacteria | 1419 |
| 5 | rootH1_10133818 | 3300003316 | Bacteria | 3397 |
| 6 | Ga0055526_1006460 | 3300003771 | Bacteria | 6356 |
| 7 | Ga0055526_1011270 | 3300003771 | Bacteria | 4050 |
| 8 | Ga0055526_1011588 | 3300003771 | Bacteria | 3952 |
| 9 | Ga0055537_1000195 | 3300003773 | Bacteria | 45368 |
| 10 | Ga0055537_1002374 | 3300003773 | Bacteria | 6371 |
| 11 | Ga0055524_1002073 | 3300003775 | Bacteria | 10626 |
| 12 | Ga0055524_1002149 | 3300003775 | Bacteria | 10369 |
| 13 | Ga0055524_1005230 | 3300003775 | Bacteria | 5834 |
| 14 | Ga0055536_1000134 | 3300003781 | Bacteria | 63257 |
| 15 | Ga0055536_1010988 | 3300003781 | Bacteria | 3525 |
| 16 | Ga0055534_1000262 | 3300003784 | Bacteria | 36545 |
| 17 | Ga0055534_1000285 | 3300003784 | Bacteria | 34241 |
| 18 | Ga0055528_1000371 | 3300003790 | Bacteria | 36548 |
| 19 | Ga0055530_10021246 | 3300003791 | Bacteria | 1918 |
| 20 | Ga0055540_1000978 | 3300003792 | Bacteria | 18452 |
| 21 | Ga0055540_1009078 | 3300003792 | Bacteria | 3489 |
| 22 | Ga0055531_10014414 | 3300003794 | Bacteria | 3558 |
| 23 | JGI25405J52794_10026279 | 3300003911 | Bacteria | 1195 |
| 24 | Ga0065714_10005960 | 3300005288 | Bacteria | 3764 |
| 25 | Ga0065704_10129945 | 3300005289 | Bacteria | 1642 |
| 26 | Ga0070676_10104250 | 3300005328 | Bacteria | 1757 |
| 27 | Ga0070670_100077817 | 3300005331 | Bacteria | 2849 |
| 28 | Ga0070677_10002180 | 3300005333 | Bacteria | 6262 |
| 29 | Ga0070677_10009441 | 3300005333 | Bacteria | 3306 |
| 30 | Ga0070677_10058777 | 3300005333 | Bacteria | 1580 |
| 31 | Ga0070677_10079016 | 3300005333 | Bacteria | 1403 |
| 32 | Ga0068869_100144889 | 3300005334 | Bacteria | 1837 |
| 33 | Ga0068869_100151206 | 3300005334 | Bacteria | 1801 |
| 34 | Ga0070666_10006152 | 3300005335 | Bacteria | 7379 |
| 35 | Ga0070666_10078043 | 3300005335 | Bacteria | 2260 |
| 36 | Ga0070666_10224387 | 3300005335 | Bacteria | 1326 |
| 37 | Ga0070666_10409168 | 3300005335 | Bacteria | 976 |
| 38 | Ga0070682_100050330 | 3300005337 | Bacteria | 2601 |
| 39 | Ga0070682_100087118 | 3300005337 | Bacteria | 2035 |
| 40 | Ga0070689_100009734 | 3300005340 | Bacteria | 6824 |
| 41 | Ga0070689_100237675 | 3300005340 | Bacteria | 1499 |
| 42 | Ga0070687_100227937 | 3300005343 | Bacteria | 1145 |
| 43 | Ga0070661_100526644 | 3300005344 | Bacteria | 948 |
| 44 | Ga0070668_100004659 | 3300005347 | Bacteria | 10158 |
| 45 | Ga0070668_100125872 | 3300005347 | Bacteria | 2052 |
| 46 | Ga0070669_100009237 | 3300005353 | Bacteria | 7024 |
| 47 | Ga0070669_100036006 | 3300005353 | Bacteria | 3586 |
| 48 | Ga0070669_100155024 | 3300005353 | Bacteria | 1775 |
| 49 | Ga0070675_100036826 | 3300005354 | Bacteria | 3983 |
| 50 | Ga0070675_100173756 | 3300005354 | Bacteria | 1859 |
| 51 | Ga0070671_100017879 | 3300005355 | Bacteria | 5748 |
| 52 | Ga0070671_100160249 | 3300005355 | Bacteria | 1902 |
| 53 | Ga0070674_100062415 | 3300005356 | Bacteria | 2604 |
| 54 | Ga0070674_100091192 | 3300005356 | Bacteria | 2200 |
| 55 | Ga0070674_100601823 | 3300005356 | Bacteria | 929 |
| 56 | Ga0070673_100037901 | 3300005364 | Bacteria | 3677 |
| 57 | Ga0070673_100076732 | 3300005364 | Bacteria | 2699 |
| 58 | Ga0070673_100192846 | 3300005364 | Bacteria | 1751 |
| 59 | Ga0070673_100258377 | 3300005364 | Bacteria | 1521 |
| 60 | Ga0070673_100622395 | 3300005364 | Bacteria | 986 |
| 61 | Ga0070688_100013923 | 3300005365 | Bacteria | 4549 |
| 62 | Ga0070688_100169592 | 3300005365 | Bacteria | 1505 |
| 63 | Ga0070659_100510818 | 3300005366 | Bacteria | 1025 |
| 64 | Ga0070667_100003282 | 3300005367 | Bacteria | 13817 |
| 65 | Ga0070667_100017213 | 3300005367 | Bacteria | 5987 |
| 66 | Ga0070667_100049979 | 3300005367 | Bacteria | 3523 |
| 67 | Ga0070667_100106012 | 3300005367 | Bacteria | 2433 |
| 68 | Ga0070667_100437812 | 3300005367 | Bacteria | 1193 |
| 69 | Ga0070667_100562324 | 3300005367 | Bacteria | 1049 |
| 70 | Ga0070710_10077947 | 3300005437 | Bacteria | 1927 |
| 71 | Ga0070701_10008786 | 3300005438 | Bacteria | 4389 |
| 72 | Ga0070701_10327546 | 3300005438 | Bacteria | 950 |
| 73 | Ga0070705_100005227 | 3300005440 | Bacteria | 6304 |
| 74 | Ga0070700_100125901 | 3300005441 | Bacteria | 1723 |
| 75 | Ga0070694_100223654 | 3300005444 | Bacteria | 1413 |
| 76 | Ga0070663_100490115 | 3300005455 | Bacteria | 1019 |
| 77 | Ga0070678_100003377 | 3300005456 | Bacteria | 8899 |
| 78 | Ga0070678_100016367 | 3300005456 | Bacteria | 4743 |
| 79 | Ga0070678_100083737 | 3300005456 | Bacteria | 2425 |
| 80 | Ga0070662_100216883 | 3300005457 | Bacteria | 1525 |
| 81 | Ga0068867_100023257 | 3300005459 | Bacteria | 4437 |
| 82 | Ga0068867_100129759 | 3300005459 | Bacteria | 1958 |
| 83 | Ga0068867_100256625 | 3300005459 | Bacteria | 1423 |
| 84 | Ga0070685_10093852 | 3300005466 | Bacteria | 1821 |
| 85 | Ga0070685_10245336 | 3300005466 | Bacteria | 1184 |
| 86 | Ga0070679_100154181 | 3300005530 | Bacteria | 2273 |
| 87 | Ga0070672_100011769 | 3300005543 | Bacteria | 6113 |
| 88 | Ga0070672_100507585 | 3300005543 | Bacteria | 1044 |
| 89 | Ga0070672_100584024 | 3300005543 | Bacteria | 972 |
| 90 | Ga0070686_100116084 | 3300005544 | Bacteria | 1831 |
| 91 | Ga0070686_100229536 | 3300005544 | Bacteria | 1346 |
| 92 | Ga0070686_100317857 | 3300005544 | Bacteria | 1160 |
| 93 | Ga0070686_100570790 | 3300005544 | Bacteria | 887 |
| 94 | Ga0070665_100000424 | 3300005548 | Bacteria | 61687 |
| 95 | Ga0070665_100003568 | 3300005548 | Bacteria | 16494 |
| 96 | Ga0070665_100009448 | 3300005548 | Bacteria | 9867 |
| 97 | Ga0070665_100047472 | 3300005548 | Bacteria | 4310 |
| 98 | Ga0070665_100078675 | 3300005548 | Bacteria | 3304 |
| 99 | Ga0070665_100194799 | 3300005548 | Bacteria | 2027 |
| 100 | Ga0070665_100483920 | 3300005548 | Bacteria | 1248 |
| 101 | Ga0068855_100084349 | 3300005563 | Bacteria | 3679 |
| 102 | Ga0070664_100048248 | 3300005564 | Bacteria | 3599 |
| 103 | Ga0070664_100493733 | 3300005564 | Bacteria | 1128 |
| 104 | Ga0068857_100310600 | 3300005577 | Bacteria | 1454 |
| 105 | Ga0068857_100402912 | 3300005577 | Bacteria | 1273 |
| 106 | Ga0068857_100545827 | 3300005577 | Bacteria | 1091 |
| 107 | Ga0070702_100003060 | 3300005615 | Bacteria | 7398 |
| 108 | Ga0070702_100197898 | 3300005615 | Bacteria | 1328 |
| 109 | Ga0068852_100523227 | 3300005616 | Bacteria | 1184 |
| 110 | Ga0068859_100023183 | 3300005617 | Bacteria | 6228 |
| 111 | Ga0068859_100033938 | 3300005617 | Bacteria | 5123 |
| 112 | Ga0068859_100078513 | 3300005617 | Bacteria | 3341 |
| 113 | Ga0068864_100130659 | 3300005618 | Bacteria | 2255 |
| 114 | Ga0068864_100223102 | 3300005618 | Bacteria | 1740 |
| 115 | Ga0068866_10121036 | 3300005718 | Bacteria | 1475 |
| 116 | Ga0068861_100002771 | 3300005719 | Bacteria | 11498 |
| 117 | Ga0068861_100012331 | 3300005719 | Bacteria | 5960 |
| 118 | Ga0068861_100065622 | 3300005719 | Bacteria | 2796 |
| 119 | Ga0068861_100154388 | 3300005719 | Bacteria | 1887 |
| 120 | Ga0068861_100348483 | 3300005719 | Bacteria | 1298 |
| 121 | Ga0068851_10153906 | 3300005834 | Bacteria | 1259 |
| 122 | Ga0068870_10014301 | 3300005840 | Bacteria | 3747 |
| 123 | Ga0068863_100001655 | 3300005841 | Bacteria | 22045 |
| 124 | Ga0068863_100026854 | 3300005841 | Bacteria | 5491 |
| 125 | Ga0068863_100027758 | 3300005841 | Bacteria | 5402 |
| 126 | Ga0068863_100148415 | 3300005841 | Bacteria | 2243 |
| 127 | Ga0068863_100172003 | 3300005841 | Bacteria | 2078 |
| 128 | Ga0068858_100059603 | 3300005842 | Bacteria | 3528 |
| 129 | Ga0068858_100358334 | 3300005842 | Bacteria | 1398 |
| 130 | Ga0068860_100000352 | 3300005843 | Bacteria | 61812 |
| 131 | Ga0068860_100082498 | 3300005843 | Bacteria | 3057 |
| 132 | Ga0068860_100176046 | 3300005843 | Bacteria | 2068 |
| 133 | Ga0068862_100017956 | 3300005844 | Bacteria | 5892 |
| 134 | Ga0068862_100037840 | 3300005844 | Bacteria | 4091 |
| 135 | Ga0081455_10003238 | 3300005937 | Bacteria | 18862 |
| 136 | Ga0075365_10221394 | 3300006038 | Bacteria | 1328 |
| 137 | Ga0075363_100006796 | 3300006048 | Bacteria | 5226 |
| 138 | Ga0075363_100023822 | 3300006048 | Bacteria | 3107 |
| 139 | Ga0075363_100058517 | 3300006048 | Bacteria | 2070 |
| 140 | Ga0075364_10010551 | 3300006051 | Bacteria | 5585 |
| 141 | Ga0075364_10321472 | 3300006051 | Bacteria | 1054 |
| 142 | Ga0075432_10044328 | 3300006058 | Bacteria | 1560 |
| 143 | Ga0070715_10018837 | 3300006163 | Bacteria | 2638 |
| 144 | Ga0075367_10292080 | 3300006178 | Bacteria | 1026 |
| 145 | Ga0075366_10087248 | 3300006195 | Bacteria | 1867 |
| 146 | Ga0097621_100044687 | 3300006237 | Bacteria | 3574 |
| 147 | Ga0097621_100092510 | 3300006237 | Bacteria | 2533 |
| 148 | Ga0097621_100111737 | 3300006237 | Bacteria | 2309 |
| 149 | Ga0097621_100211831 | 3300006237 | Bacteria | 1686 |
| 150 | Ga0097621_100266208 | 3300006237 | Bacteria | 1505 |
| 151 | Ga0097621_100303561 | 3300006237 | Bacteria | 1411 |
| 152 | Ga0097621_100588641 | 3300006237 | Bacteria | 1016 |
| 153 | Ga0075370_10003659 | 3300006353 | Bacteria | 7359 |
| 154 | Ga0075370_10009760 | 3300006353 | Bacteria | 4998 |
| 155 | Ga0075370_10011926 | 3300006353 | Bacteria | 4579 |
| 156 | Ga0075370_10045441 | 3300006353 | Bacteria | 2484 |
| 157 | Ga0075370_10081888 | 3300006353 | Bacteria | 1855 |
| 158 | Ga0068871_100139323 | 3300006358 | Bacteria | 2062 |
| 159 | Ga0068871_100182191 | 3300006358 | Bacteria | 1805 |
| 160 | Ga0068871_100375580 | 3300006358 | Bacteria | 1262 |
| 161 | Ga0068871_100496360 | 3300006358 | Bacteria | 1100 |
| 162 | Ga0068865_100118688 | 3300006881 | Bacteria | 1963 |
| 163 | Ga0068865_100509152 | 3300006881 | Bacteria | 1005 |
| 164 | Ga0097620_100023183 | 3300006931 | Bacteria | 6228 |
| 165 | Ga0097620_100078513 | 3300006931 | Bacteria | 3341 |
| 166 | Ga0079104_1024276 | 3300006946 | Bacteria | 1599 |
| 167 | Ga0099826_10000007 | 3300006948 | Bacteria | 393518 |
| 168 | Ga0099826_10011566 | 3300006948 | Bacteria | 6640 |
| 169 | Ga0099826_10148051 | 3300006948 | Bacteria | 1347 |
| 170 | Ga0105251_10001536 | 3300009011 | Bacteria | 19805 |
| 171 | Ga0105251_10010075 | 3300009011 | Bacteria | 5517 |
| 172 | Ga0105244_10001232 | 3300009036 | Bacteria | 21006 |
| 173 | Ga0105250_10165335 | 3300009092 | Bacteria | 925 |
| 174 | Ga0105240_10010103 | 3300009093 | Bacteria | 13283 |
| 175 | Ga0105240_10096110 | 3300009093 | Bacteria | 3611 |
| 176 | Ga0105240_10334637 | 3300009093 | Bacteria | 1722 |
| 177 | Ga0111539_10090632 | 3300009094 | Bacteria | 3593 |
| 178 | Ga0105243_10002672 | 3300009148 | Bacteria | 14814 |
| 179 | Ga0105243_10045322 | 3300009148 | Bacteria | 3455 |
| 180 | Ga0105243_10075987 | 3300009148 | Bacteria | 2728 |
| 181 | Ga0105241_10002121 | 3300009174 | Bacteria | 14994 |
| 182 | Ga0105242_10110763 | 3300009176 | Bacteria | 2340 |
| 183 | Ga0105242_10488428 | 3300009176 | Bacteria | 1169 |
| 184 | Ga0105248_10067276 | 3300009177 | Bacteria | 4022 |
| 185 | Ga0105248_10125024 | 3300009177 | Bacteria | 2901 |
| 186 | Ga0105248_10143254 | 3300009177 | Bacteria | 2697 |
| 187 | Ga0105237_10082802 | 3300009545 | Bacteria | 3200 |
| 188 | Ga0105237_10255457 | 3300009545 | Bacteria | 1755 |
| 189 | Ga0105237_10571375 | 3300009545 | Bacteria | 1137 |
| 190 | Ga0105237_10693194 | 3300009545 | Bacteria | 1025 |
| 191 | Ga0105249_10040032 | 3300009553 | Bacteria | 4257 |
| 192 | Ga0105249_10081128 | 3300009553 | Bacteria | 3015 |
| 193 | Ga0105249_10150774 | 3300009553 | Bacteria | 2238 |
| 194 | Ga0105249_10169344 | 3300009553 | Bacteria | 2117 |
| 195 | Ga0105249_10697664 | 3300009553 | Bacteria | 1075 |
| 196 | Ga0105239_10243310 | 3300010375 | Bacteria | 2019 |
| 197 | Ga0105246_10049393 | 3300011119 | Bacteria | 2881 |
| 198 | Ga0105246_10410322 | 3300011119 | Bacteria | 1127 |
| 199 | Ga0157373_10001598 | 3300013100 | Bacteria | 17300 |
| 200 | Ga0157370_10389316 | 3300013104 | Bacteria | 1283 |
| 201 | Ga0157369_10380620 | 3300013105 | Bacteria | 1465 |
| 202 | Ga0157374_10156336 | 3300013296 | Bacteria | 2219 |
| 203 | Ga0157374_10354885 | 3300013296 | Bacteria | 1457 |
| 204 | Ga0163162_10036725 | 3300013306 | Bacteria | 4885 |
| 205 | Ga0157375_10002431 | 3300013308 | Bacteria | 16131 |
| 206 | Ga0157375_10135565 | 3300013308 | Bacteria | 2585 |
| 207 | Ga0163163_10111580 | 3300014325 | Bacteria | 2763 |
| 208 | Ga0163163_10509312 | 3300014325 | Bacteria | 1266 |
| 209 | Ga0157380_10014739 | 3300014326 | Bacteria | 5723 |
| 210 | Ga0157380_10118101 | 3300014326 | Bacteria | 2241 |
| 211 | Ga0157380_10390186 | 3300014326 | Bacteria | 1317 |
| 212 | Ga0157380_10444257 | 3300014326 | Bacteria | 1243 |
| 213 | Ga0182008_10000041 | 3300014497 | Bacteria | 118254 |
| 214 | Ga0182008_10000979 | 3300014497 | Bacteria | 19823 |
| 215 | Ga0182008_10008454 | 3300014497 | Bacteria | 5619 |
| 216 | Ga0182008_10107226 | 3300014497 | Bacteria | 1383 |
| 217 | Ga0157377_10184960 | 3300014745 | Bacteria | 1313 |
| 218 | Ga0157379_10056147 | 3300014968 | Bacteria | 3519 |
| 219 | Ga0157379_10215828 | 3300014968 | Bacteria | 1738 |
| 220 | Ga0157376_10036462 | 3300014969 | Bacteria | 3984 |
| 221 | Ga0157376_10284656 | 3300014969 | Bacteria | 1558 |
| 222 | Ga0157376_11127410 | 3300014969 | Bacteria | 811 |
| 223 | Ga0182006_1002496 | 3300015261 | Bacteria | 10020 |
| 224 | Ga0182006_1030272 | 3300015261 | Bacteria | 2188 |
| 225 | Ga0182006_1116324 | 3300015261 | Bacteria | 934 |
| 226 | Ga0182007_10000705 | 3300015262 | Bacteria | 19033 |
| 227 | Ga0182007_10001863 | 3300015262 | Bacteria | 10999 |
| 228 | Ga0182005_1008500 | 3300015265 | Bacteria | 3023 |
| 229 | Ga0182005_1041237 | 3300015265 | Bacteria | 1255 |
| 230 | Ga0163161_10066534 | 3300017792 | Bacteria | 2632 |
| 231 | Ga0163161_10279416 | 3300017792 | Bacteria | 1309 |
| 232 | Ga0163161_10326606 | 3300017792 | Bacteria | 1214 |
| 233 | Ga0209565_1000087 | 3300025263 | Bacteria | 152027 |
| 234 | Ga0209565_1000104 | 3300025263 | Bacteria | 124432 |
| 235 | Ga0209565_1012602 | 3300025263 | Bacteria | 2012 |
| 236 | Ga0209673_1000145 | 3300025273 | Bacteria | 152027 |
| 237 | Ga0209673_1015703 | 3300025273 | Bacteria | 2863 |
| 238 | Ga0209673_1050262 | 3300025273 | Bacteria | 1108 |
| 239 | Ga0209675_1000085 | 3300025291 | Bacteria | 152027 |
| 240 | Ga0209675_1000191 | 3300025291 | Bacteria | 67500 |
| 241 | Ga0209675_1002151 | 3300025291 | Bacteria | 10391 |
| 242 | Ga0209676_1000036 | 3300025292 | Bacteria | 457623 |
| 243 | Ga0209676_1000172 | 3300025292 | Bacteria | 153664 |
| 244 | Ga0209025_1000618 | 3300025294 | Bacteria | 63845 |
| 245 | Ga0209025_1000905 | 3300025294 | Bacteria | 45998 |
| 246 | Ga0209025_1001806 | 3300025294 | Bacteria | 25356 |
| 247 | Ga0209025_1002048 | 3300025294 | Bacteria | 22965 |
| 248 | Ga0209025_1005552 | 3300025294 | Bacteria | 10223 |
| 249 | Ga0209025_1032618 | 3300025294 | Bacteria | 2429 |
| 250 | Ga0209025_1056740 | 3300025294 | Bacteria | 1503 |
| 251 | Ga0209564_1000688 | 3300025295 | Bacteria | 49680 |
| 252 | Ga0209564_1002275 | 3300025295 | Bacteria | 15701 |
| 253 | Ga0209564_1004020 | 3300025295 | Bacteria | 9304 |
| 254 | Ga0209050_1000509 | 3300025298 | Bacteria | 65792 |
| 255 | Ga0209256_1001092 | 3300025299 | Bacteria | 31208 |
| 256 | Ga0209256_1001334 | 3300025299 | Bacteria | 26338 |
| 257 | Ga0209051_1000278 | 3300025303 | Bacteria | 83769 |
| 258 | Ga0209051_1000397 | 3300025303 | Bacteria | 60597 |
| 259 | Ga0209051_1034250 | 3300025303 | Bacteria | 1907 |
| 260 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 261 | Ga0207697_10044152 | 3300025315 | Bacteria | 1833 |
| 262 | Ga0207655_1012902 | 3300025728 | Bacteria | 4837 |
| 263 | Ga0207713_1001292 | 3300025735 | Bacteria | 20629 |
| 264 | Ga0207713_1018323 | 3300025735 | Bacteria | 3470 |
| 265 | Ga0207682_10016438 | 3300025893 | Bacteria | 2886 |
| 266 | Ga0207692_10034308 | 3300025898 | Bacteria | 2456 |
| 267 | Ga0207642_10010527 | 3300025899 | Bacteria | 3266 |
| 268 | Ga0207710_10065772 | 3300025900 | Bacteria | 1653 |
| 269 | Ga0207680_10089377 | 3300025903 | Bacteria | 1955 |
| 270 | Ga0207680_10193135 | 3300025903 | Bacteria | 1383 |
| 271 | Ga0207685_10034844 | 3300025905 | Bacteria | 1832 |
| 272 | Ga0207645_10075149 | 3300025907 | Bacteria | 2163 |
| 273 | Ga0207645_10196479 | 3300025907 | Bacteria | 1326 |
| 274 | Ga0207643_10006811 | 3300025908 | Bacteria | 6134 |
| 275 | Ga0207643_10224950 | 3300025908 | Bacteria | 1150 |
| 276 | Ga0207705_10395394 | 3300025909 | Bacteria | 1069 |
| 277 | Ga0207654_10000574 | 3300025911 | Bacteria | 20794 |
| 278 | Ga0207671_10375621 | 3300025914 | Bacteria | 1129 |
| 279 | Ga0207663_10170254 | 3300025916 | Bacteria | 1546 |
| 280 | Ga0207649_10117143 | 3300025920 | Bacteria | 1790 |
| 281 | Ga0207681_10026903 | 3300025923 | Bacteria | 3714 |
| 282 | Ga0207681_10038443 | 3300025923 | Bacteria | 3171 |
| 283 | Ga0207681_10178362 | 3300025923 | Bacteria | 1616 |
| 284 | Ga0207650_10092759 | 3300025925 | Bacteria | 2310 |
| 285 | Ga0207650_10110545 | 3300025925 | Bacteria | 2127 |
| 286 | Ga0207659_10142081 | 3300025926 | Bacteria | 1864 |
| 287 | Ga0207644_10025817 | 3300025931 | Bacteria | 4042 |
| 288 | Ga0207690_10422637 | 3300025932 | Bacteria | 1066 |
| 289 | Ga0207706_10159377 | 3300025933 | Bacteria | 1984 |
| 290 | Ga0207706_10278766 | 3300025933 | Bacteria | 1458 |
| 291 | Ga0207706_10440163 | 3300025933 | Bacteria | 1128 |
| 292 | Ga0207686_10144954 | 3300025934 | Bacteria | 1646 |
| 293 | Ga0207709_10003493 | 3300025935 | Bacteria | 9312 |
| 294 | Ga0207709_10718032 | 3300025935 | Bacteria | 801 |
| 295 | Ga0207670_10007762 | 3300025936 | Bacteria | 6018 |
| 296 | Ga0207670_10127680 | 3300025936 | Bacteria | 1858 |
| 297 | Ga0207669_10036486 | 3300025937 | Bacteria | 2810 |
| 298 | Ga0207669_10262548 | 3300025937 | Bacteria | 1292 |
| 299 | Ga0207669_10474145 | 3300025937 | Bacteria | 996 |
| 300 | Ga0207704_10087298 | 3300025938 | Bacteria | 2037 |
| 301 | Ga0207704_10168775 | 3300025938 | Bacteria | 1567 |
| 302 | Ga0207691_10054210 | 3300025940 | Bacteria | 3658 |
| 303 | Ga0207691_10075284 | 3300025940 | Bacteria | 3044 |
| 304 | Ga0207691_10076499 | 3300025940 | Bacteria | 3016 |
| 305 | Ga0207711_10070534 | 3300025941 | Bacteria | 3031 |
| 306 | Ga0207711_10259202 | 3300025941 | Bacteria | 1598 |
| 307 | Ga0207711_10547107 | 3300025941 | Bacteria | 1080 |
| 308 | Ga0207689_10016545 | 3300025942 | Bacteria | 6243 |
| 309 | Ga0207689_10057396 | 3300025942 | Bacteria | 3203 |
| 310 | Ga0207689_10097032 | 3300025942 | Bacteria | 2421 |
| 311 | Ga0207679_10171546 | 3300025945 | Bacteria | 1786 |
| 312 | Ga0207679_10263410 | 3300025945 | Bacteria | 1471 |
| 313 | Ga0207679_10354027 | 3300025945 | Bacteria | 1281 |
| 314 | Ga0207679_10461742 | 3300025945 | Bacteria | 1128 |
| 315 | Ga0207667_10392229 | 3300025949 | Bacteria | 1414 |
| 316 | Ga0207651_10048287 | 3300025960 | Bacteria | 2876 |
| 317 | Ga0207651_10055295 | 3300025960 | Bacteria | 2725 |
| 318 | Ga0207651_10086283 | 3300025960 | Bacteria | 2281 |
| 319 | Ga0207651_10416899 | 3300025960 | Bacteria | 1145 |
| 320 | Ga0207712_10046111 | 3300025961 | Bacteria | 3020 |
| 321 | Ga0207712_10125354 | 3300025961 | Bacteria | 1949 |
| 322 | Ga0207712_10160789 | 3300025961 | Bacteria | 1745 |
| 323 | Ga0207712_10346706 | 3300025961 | Bacteria | 1233 |
| 324 | Ga0207712_10358595 | 3300025961 | Bacteria | 1214 |
| 325 | Ga0207712_10836371 | 3300025961 | Bacteria | 811 |
| 326 | Ga0207668_10370625 | 3300025972 | Bacteria | 1202 |
| 327 | Ga0207640_10252927 | 3300025981 | Bacteria | 1369 |
| 328 | Ga0207658_10003371 | 3300025986 | Bacteria | 11309 |
| 329 | Ga0207658_10020449 | 3300025986 | Bacteria | 4583 |
| 330 | Ga0207658_10040291 | 3300025986 | Bacteria | 3376 |
| 331 | Ga0207658_10155842 | 3300025986 | Bacteria | 1866 |
| 332 | Ga0207658_10441742 | 3300025986 | Bacteria | 1150 |
| 333 | Ga0207703_10050354 | 3300026035 | Bacteria | 3371 |
| 334 | Ga0207639_10028438 | 3300026041 | Bacteria | 4082 |
| 335 | Ga0207678_10040725 | 3300026067 | Bacteria | 4027 |
| 336 | Ga0207678_10693110 | 3300026067 | Bacteria | 896 |
| 337 | Ga0207708_10124925 | 3300026075 | Bacteria | 2007 |
| 338 | Ga0207708_10550955 | 3300026075 | Bacteria | 972 |
| 339 | Ga0207708_10868864 | 3300026075 | Bacteria | 779 |
| 340 | Ga0207641_10000220 | 3300026088 | Bacteria | 74415 |
| 341 | Ga0207641_10011553 | 3300026088 | Bacteria | 7247 |
| 342 | Ga0207641_10023632 | 3300026088 | Bacteria | 5064 |
| 343 | Ga0207641_10177959 | 3300026088 | Bacteria | 1946 |
| 344 | Ga0207641_10246056 | 3300026088 | Bacteria | 1668 |
| 345 | Ga0207648_10018789 | 3300026089 | Bacteria | 6248 |
| 346 | Ga0207648_10166894 | 3300026089 | Bacteria | 1946 |
| 347 | Ga0207648_10241358 | 3300026089 | Bacteria | 1609 |
| 348 | Ga0207676_10080152 | 3300026095 | Bacteria | 2650 |
| 349 | Ga0207676_10382768 | 3300026095 | Bacteria | 1310 |
| 350 | Ga0207674_10070466 | 3300026116 | Bacteria | 3515 |
| 351 | Ga0207674_10252648 | 3300026116 | Bacteria | 1710 |
| 352 | Ga0207675_100006319 | 3300026118 | Bacteria | 11240 |
| 353 | Ga0207675_100017126 | 3300026118 | Bacteria | 6767 |
| 354 | Ga0207675_100056849 | 3300026118 | Bacteria | 3649 |
| 355 | Ga0207675_100131421 | 3300026118 | Bacteria | 2374 |
| 356 | Ga0207675_100149764 | 3300026118 | Bacteria | 2220 |
| 357 | Ga0207675_100666500 | 3300026118 | Bacteria | 1047 |
| 358 | Ga0207675_100778927 | 3300026118 | Bacteria | 969 |
| 359 | Ga0207683_10008216 | 3300026121 | Bacteria | 8930 |
| 360 | Ga0207683_10013773 | 3300026121 | Bacteria | 6896 |
| 361 | Ga0207683_10028026 | 3300026121 | Bacteria | 4869 |
| 362 | Ga0207683_10130754 | 3300026121 | Bacteria | 2258 |
| 363 | Ga0207683_10201019 | 3300026121 | Bacteria | 1811 |
| 364 | Ga0209282_1000021 | 3300027666 | Bacteria | 177705 |
| 365 | Ga0209282_1003254 | 3300027666 | Bacteria | 9616 |
| 366 | Ga0268266_10000409 | 3300028379 | Bacteria | 65290 |
| 367 | Ga0268266_10006147 | 3300028379 | Bacteria | 11050 |
| 368 | Ga0268266_10009480 | 3300028379 | Bacteria | 8567 |
| 369 | Ga0268266_10012248 | 3300028379 | Bacteria | 7420 |
| 370 | Ga0268266_10030458 | 3300028379 | Bacteria | 4584 |
| 371 | Ga0268266_10039459 | 3300028379 | Bacteria | 4022 |
| 372 | Ga0268266_10113364 | 3300028379 | Bacteria | 2404 |
| 373 | Ga0268266_10390497 | 3300028379 | Bacteria | 1314 |
| 374 | Ga0268265_10031142 | 3300028380 | Bacteria | 3851 |
| 375 | Ga0268265_10046320 | 3300028380 | Bacteria | 3250 |
| 376 | Ga0268265_10233499 | 3300028380 | Bacteria | 1618 |
| 377 | Ga0268265_10289589 | 3300028380 | Bacteria | 1469 |
| 378 | Ga0268264_10000085 | 3300028381 | Bacteria | 240739 |
| 379 | Ga0268264_10143108 | 3300028381 | Bacteria | 2135 |
| 380 | Ga0268264_10225339 | 3300028381 | Bacteria | 1728 |
| 381 | Ga0307515_10000195 | 3300028794 | Bacteria | 148138 |
| 382 | Ga0307515_10053551 | 3300028794 | Bacteria | 5950 |
| 383 | Ga0307515_10237944 | 3300028794 | Bacteria | 1598 |
| 384 | Ga0307511_10000204 | 3300030521 | Bacteria | 59925 |
| 385 | Ga0307511_10044022 | 3300030521 | Viruses | 3717 |
| 386 | Ga0316177_1083748 | 3300030731 | Bacteria | 7341 |
| 387 | Ga0316176_1114549 | 3300030732 | Bacteria | 3018 |
| 388 | Ga0314311_1068161 | 3300030733 | Bacteria | 3580 |
| 389 | Ga0316181_1033992 | 3300030744 | Bacteria | 5651 |
| 390 | Ga0316182_1107731 | 3300030745 | Bacteria | 1207 |
| 391 | Ga0265327_10000640 | 3300031251 | Bacteria | 56812 |
| 392 | Ga0265327_10019675 | 3300031251 | Bacteria | 4140 |
| 393 | Ga0307513_10007003 | 3300031456 | Bacteria | 14668 |
| 394 | Ga0307513_10016636 | 3300031456 | Bacteria | 8858 |
| 395 | Ga0307513_10023455 | 3300031456 | Bacteria | 7207 |
| 396 | Ga0307513_10030889 | 3300031456 | Bacteria | 6077 |
| 397 | Ga0307513_10036720 | 3300031456 | Bacteria | 5461 |
| 398 | Ga0307513_10073099 | 3300031456 | Bacteria | 3571 |
| 399 | Ga0307513_10096801 | 3300031456 | Bacteria | 2988 |
| 400 | Ga0307408_100033508 | 3300031548 | Bacteria | 3589 |
| 401 | Ga0307408_100155137 | 3300031548 | Bacteria | 1812 |
| 402 | Ga0307408_100272214 | 3300031548 | Bacteria | 1406 |
| 403 | Ga0307405_10078596 | 3300031731 | Bacteria | 2148 |
| 404 | Ga0307405_10128973 | 3300031731 | Bacteria | 1744 |
| 405 | Ga0307405_10200097 | 3300031731 | Bacteria | 1450 |
| 406 | Ga0307405_10201872 | 3300031731 | Bacteria | 1444 |
| 407 | Ga0307405_10520081 | 3300031731 | Bacteria | 957 |
| 408 | Ga0307413_10014725 | 3300031824 | Bacteria | 3983 |
| 409 | Ga0307410_10003532 | 3300031852 | Bacteria | 7862 |
| 410 | Ga0307410_10013410 | 3300031852 | Bacteria | 4781 |
| 411 | Ga0307406_10004223 | 3300031901 | Bacteria | 7816 |
| 412 | Ga0307406_10082392 | 3300031901 | Bacteria | 2142 |
| 413 | Ga0307407_10099371 | 3300031903 | Bacteria | 1802 |
| 414 | Ga0307407_10132987 | 3300031903 | Bacteria | 1594 |
| 415 | Ga0307412_10081389 | 3300031911 | Bacteria | 2239 |
| 416 | Ga0307412_10370919 | 3300031911 | Bacteria | 1156 |
| 417 | Ga0307412_10398067 | 3300031911 | Bacteria | 1120 |
| 418 | Ga0307409_100008635 | 3300031995 | Bacteria | 6197 |
| 419 | Ga0307409_100009145 | 3300031995 | Bacteria | 6071 |
| 420 | Ga0307416_100099966 | 3300032002 | Bacteria | 2521 |
| 421 | Ga0307416_100190129 | 3300032002 | Bacteria | 1935 |
| 422 | Ga0307416_100354000 | 3300032002 | Bacteria | 1487 |
| 423 | Ga0307416_100396996 | 3300032002 | Bacteria | 1415 |
| 424 | Ga0307414_10337040 | 3300032004 | Bacteria | 1289 |
| 425 | Ga0307411_10186537 | 3300032005 | Bacteria | 1579 |
| 426 | Ga0307411_10203522 | 3300032005 | Bacteria | 1522 |
| 427 | Ga0307415_100020507 | 3300032126 | Bacteria | 4038 |
| 428 | Ga0307415_100090152 | 3300032126 | Bacteria | 2217 |
| 429 | Ga0307510_10000004 | 3300033180 | Bacteria | 654130 |
| 430 | Ga0307510_10158236 | 3300033180 | Bacteria | 1868 |
| 431 | Ga0373936_0017773 | 3300035113 | Bacteria | 2740 |
| 432 | Ga0373936_0021254 | 3300035113 | Bacteria | 2523 |
| 433 | Ga0373935_0110233 | 3300035692 | Bacteria | 1826 |
| 434 | Ga0373933_0078327 | 3300035724 | Bacteria | 2022 |
| 435 | Ga0373933_0299556 | 3300035724 | Bacteria | 1041 |
| 436 | Ga0373933_0427957 | 3300035724 | Bacteria | 865 |
| 437 | Ga0373937_0017834 | 3300036401 | Bacteria | 6334 |
| 438 | Ga0373937_0624721 | 3300036401 | Bacteria | 1022 |
| 439 | Ga0373925_0332540 | 3300037068 | Bacteria | 1231 |
| 440 | Ga0373925_0377024 | 3300037068 | Bacteria | 1155 |
| 441 | Ga0395905_0441951 | 3300037471 | Bacteria | 1198 |
| 442 | Ga0439436_0000260 | 3300041404 | Bacteria | 12706 |
| 443 | Ga0439436_0012416 | 3300041404 | Bacteria | 2586 |
| 444 | Ga0439447_030299 | 3300041407 | Bacteria | 1364 |
| 445 | Ga0439461_0033173 | 3300041410 | Bacteria | 1085 |
| 446 | Ga0439466_0005864 | 3300041411 | Bacteria | 4679 |
| 447 | Ga0439466_0010965 | 3300041411 | Bacteria | 3360 |
| 448 | Ga0439466_0023327 | 3300041411 | Bacteria | 2177 |
| 449 | Ga0439466_0086653 | 3300041411 | Bacteria | 984 |
| 450 | Ga0439465_0006112 | 3300041413 | Bacteria | 3828 |
| 451 | Ga0439465_0042948 | 3300041413 | Bacteria | 1466 |
| 452 | Ga0451789_1317359 | 3300041443 | Bacteria | 1292 |
| 453 | Ga0451793_0765724 | 3300041452 | Bacteria | 1430 |
| 454 | Ga0451800_0302824 | 3300041459 | Bacteria | 2247 |
| 455 | Ga0451802_0356051 | 3300041460 | Bacteria | 812 |
| 456 | Ga0451804_0147506 | 3300041463 | Bacteria | 1560 |
| 457 | Ga0451807_0481750 | 3300041486 | Bacteria | 2083 |
| 458 | Ga0451807_1209868 | 3300041486 | Bacteria | 1877 |
| 459 | Ga0451807_2367067 | 3300041486 | Bacteria | 1430 |
| 460 | Ga0451837_0927674 | 3300041494 | Bacteria | 1352 |
| 461 | Ga0451843_0219946 | 3300041509 | Bacteria | 1568 |
| 462 | Ga0451855_1329526 | 3300041511 | Bacteria | 870 |
| 463 | Ga0451853_0197513 | 3300041512 | Bacteria | 829 |
| 464 | Ga0451853_2486265 | 3300041512 | Bacteria | 984 |
| 465 | Ga0439431_0003269 | 3300041997 | Bacteria | 3564 |
| 466 | Ga0439431_0073240 | 3300041997 | Bacteria | 915 |
| 467 | Ga0439433_0001399 | 3300041999 | Bacteria | 4957 |
| 468 | Ga0439433_0038866 | 3300041999 | Bacteria | 1104 |
| 469 | Ga0439433_0060410 | 3300041999 | Bacteria | 903 |
| 470 | Ga0439442_003529 | 3300042002 | Bacteria | 3092 |
| 471 | Ga0439442_004209 | 3300042002 | Bacteria | 2853 |
| 472 | Ga0439445_0003443 | 3300042004 | Bacteria | 3552 |
| 473 | Ga0439445_0030248 | 3300042004 | Bacteria | 1403 |
| 474 | Ga0439445_0121535 | 3300042004 | Bacteria | 750 |
| 475 | Ga0439432_002182 | 3300042006 | Bacteria | 7390 |
| 476 | Ga0439432_008573 | 3300042006 | Bacteria | 3588 |
| 477 | Ga0439432_028280 | 3300042006 | Bacteria | 1826 |
| 478 | Ga0439449_0000810 | 3300042007 | Bacteria | 12045 |
| 479 | Ga0439449_0007367 | 3300042007 | Bacteria | 4181 |
| 480 | Ga0439449_0009810 | 3300042007 | Bacteria | 3624 |
| 481 | Ga0439452_004990 | 3300042010 | Bacteria | 4342 |
| 482 | Ga0439455_0077550 | 3300042012 | Bacteria | 900 |
| 483 | Ga0439457_005960 | 3300042014 | Bacteria | 3014 |
| 484 | Ga0439462_0026761 | 3300042015 | Bacteria | 1520 |
| 485 | Ga0450923_040091 | 3300042125 | Bacteria | 982 |
| 486 | Ga0450897_000645 | 3300042128 | Bacteria | 2040 |
| 487 | Ga0450896_036698 | 3300042133 | Bacteria | 755 |
| 488 | Ga0450906_001705 | 3300042145 | Bacteria | 4805 |
| 489 | Ga0439446_0051485 | 3300042156 | Bacteria | 1230 |
| 490 | Ga0439446_0149516 | 3300042156 | Bacteria | 767 |
| 491 | Ga0450908_006253 | 3300042184 | Bacteria | 2266 |
| 492 | Ga0450908_033829 | 3300042184 | Bacteria | 886 |
| 493 | Ga0439434_0001306 | 3300042435 | Bacteria | 7179 |
| 494 | Ga0439434_0103329 | 3300042435 | Bacteria | 919 |
| 495 | Ga0450916_002925 | 3300042530 | Bacteria | 1850 |
| 496 | Ga0466965_0070652 | 3300044683 | Bacteria | 1755 |
| 497 | Ga0466960_0205682 | 3300044901 | Bacteria | 1077 |
| 498 | Ga0495592_0465296 | 3300046454 | Bacteria | 790 |
| 499 | Ga0495590_0001681 | 3300046457 | Bacteria | 9407 |
| 500 | Ga0495590_0048960 | 3300046457 | Bacteria | 1474 |
| 501 | Ga0495591_053044 | 3300046458 | Bacteria | 1101 |
| 502 | Ga0495638_0004727 | 3300046460 | Bacteria | 10290 |
| 503 | Ga0495650_0061299 | 3300046471 | Bacteria | 1507 |
| 504 | Ga0495580_0000702 | 3300046472 | Bacteria | 28637 |
| 505 | Ga0495605_0009070 | 3300046474 | Bacteria | 5600 |
| 506 | Ga0495639_0004033 | 3300046475 | Bacteria | 6292 |
| 507 | Ga0495584_0197273 | 3300046491 | Bacteria | 1023 |
| 508 | Ga0495596_0000299 | 3300046500 | Bacteria | 32765 |
| 509 | Ga0495607_0021268 | 3300046501 | Bacteria | 4084 |
| 510 | Ga0495606_0066692 | 3300046507 | Bacteria | 2282 |
| 511 | Ga0495606_0090125 | 3300046507 | Bacteria | 1888 |
| 512 | Ga0495606_0199609 | 3300046507 | Bacteria | 1141 |
| 513 | Ga0495606_0372094 | 3300046507 | Bacteria | 752 |
| 514 | Ga0495610_0014957 | 3300046512 | Bacteria | 4532 |
| 515 | Ga0495616_0003303 | 3300046513 | Bacteria | 10370 |
| 516 | Ga0495618_0158283 | 3300046514 | Bacteria | 1445 |
| 517 | Ga0495631_0137044 | 3300046518 | Bacteria | 1051 |
| 518 | Ga0495632_0067881 | 3300046519 | Bacteria | 1719 |
| 519 | Ga0495643_0039363 | 3300046522 | Bacteria | 2586 |
| 520 | Ga0495643_0112580 | 3300046522 | Bacteria | 1382 |
| 521 | Ga0495648_0027242 | 3300046524 | Bacteria | 3830 |
| 522 | Ga0495648_0099474 | 3300046524 | Bacteria | 1609 |
| 523 | Ga0495640_0313795 | 3300046533 | Bacteria | 972 |
| 524 | Ga0495586_0199321 | 3300046535 | Bacteria | 1135 |
| 525 | Ga0495609_0002941 | 3300046538 | Bacteria | 10071 |
| 526 | Ga0495621_0003186 | 3300046539 | Bacteria | 4500 |
| 527 | Ga0495621_0081075 | 3300046539 | Bacteria | 1210 |
| 528 | Ga0495622_0379944 | 3300046557 | Bacteria | 610 |
| 529 | Ga0495656_0000447 | 3300046615 | Bacteria | 13485 |
| 530 | Ga0495656_0160986 | 3300046615 | Bacteria | 1091 |
| 531 | Ga0495668_0147327 | 3300046616 | Bacteria | 1289 |
| 532 | Ga0495611_0210095 | 3300046648 | Bacteria | 906 |
| 533 | Ga0495625_0000012 | 3300046660 | Bacteria | 363006 |
| 534 | Ga0495625_0022933 | 3300046660 | Bacteria | 4776 |
| 535 | Ga0495625_0033218 | 3300046660 | Bacteria | 3818 |
| 536 | Ga0495625_0051195 | 3300046660 | Bacteria | 2961 |
| 537 | Ga0495661_0023398 | 3300046665 | Bacteria | 4011 |
| 538 | Ga0495588_0353182 | 3300046674 | Bacteria | 772 |
| 539 | Ga0495657_0099305 | 3300046675 | Bacteria | 1857 |
| 540 | Ga0495669_0075902 | 3300046684 | Bacteria | 1538 |
| 541 | Ga0495670_0179196 | 3300046691 | Bacteria | 1118 |
| 542 | Ga0495671_0005389 | 3300046692 | Bacteria | 7497 |
| 543 | Ga0495649_0010233 | 3300046694 | Bacteria | 5540 |
| 544 | Ga0495649_0447313 | 3300046694 | Bacteria | 645 |
| 545 | Ga0495600_0082730 | 3300046809 | Bacteria | 2095 |
| 546 | Ga0495636_0005139 | 3300047318 | Bacteria | 5138 |
| 547 | Ga0495672_0019047 | 3300047320 | Bacteria | 4538 |
| 548 | Ga0495672_0178348 | 3300047320 | Bacteria | 1078 |
| 549 | Ga0495685_070960 | 3300047447 | Bacteria | 1166 |
| 550 | Ga0495673_0017124 | 3300047469 | Bacteria | 3688 |
| 551 | Ga0495593_0073206 | 3300047673 | Bacteria | 1778 |
| 552 | Ga0495615_0003743 | 3300048090 | Bacteria | 2580 |
| 553 | Ga0495626_0097306 | 3300048091 | Bacteria | 1287 |
| 554 | Ga0496101_0000615 | 3300048904 | Bacteria | 21702 |
| 555 | Ga0496102_0001349 | 3300048905 | Bacteria | 21981 |
| 556 | Ga0496102_1175836 | 3300048905 | Bacteria | 686 |
| 557 | Ga0496103_0021865 | 3300048906 | Bacteria | 3849 |
| 558 | Ga0496104_0020542 | 3300048907 | Bacteria | 6054 |
| 559 | Ga0496104_0169197 | 3300048907 | Bacteria | 2096 |
| 560 | Ga0496105_0009353 | 3300048908 | Bacteria | 7660 |
| 561 | Ga0496105_0645599 | 3300048908 | Bacteria | 817 |
| 562 | Ga0496106_0350198 | 3300048909 | Bacteria | 1186 |
| 563 | Ga0496108_0334017 | 3300048911 | Bacteria | 1322 |
| 564 | Ga0496109_0419856 | 3300048912 | Bacteria | 1263 |
| 565 | Ga0496111_0030992 | 3300048914 | Bacteria | 3806 |
| 566 | Ga0496112_0027994 | 3300048915 | Bacteria | 5437 |
| 567 | Ga0496112_0593440 | 3300048915 | Bacteria | 1040 |
| 568 | Ga0496113_0319567 | 3300048916 | Bacteria | 1244 |
| 569 | Ga0496114_0025835 | 3300048917 | Bacteria | 4803 |
| 570 | Ga0496114_0107136 | 3300048917 | Bacteria | 2391 |
| 571 | Ga0496114_0259914 | 3300048917 | Bacteria | 1529 |
| 572 | Ga0496116_0008921 | 3300048919 | Bacteria | 8624 |
| 573 | Ga0496116_0064717 | 3300048919 | Bacteria | 2349 |
| 574 | Ga0496116_0067789 | 3300048919 | Bacteria | 2277 |
| 575 | Ga0496117_0000627 | 3300048920 | Bacteria | 57244 |
| 576 | Ga0496118_0000026 | 3300048921 | Bacteria | 375725 |
| 577 | Ga0496119_0003877 | 3300048922 | Bacteria | 15240 |
| 578 | Ga0496119_0007208 | 3300048922 | Bacteria | 10070 |
| 579 | Ga0496119_0117481 | 3300048922 | Bacteria | 1466 |
| 580 | Ga0496120_0001237 | 3300048923 | Bacteria | 32272 |
| 581 | Ga0496120_0004425 | 3300048923 | Bacteria | 11793 |
| 582 | Ga0496121_0027863 | 3300048924 | Bacteria | 5276 |
| 583 | Ga0496121_0041031 | 3300048924 | Bacteria | 4051 |
| 584 | Ga0496121_0092120 | 3300048924 | Bacteria | 2363 |
| 585 | Ga0496122_0000528 | 3300048925 | Bacteria | 79201 |
| 586 | Ga0496122_0006383 | 3300048925 | Bacteria | 13553 |
| 587 | Ga0496123_0000308 | 3300048926 | Bacteria | 94712 |
| 588 | Ga0496123_0005960 | 3300048926 | Bacteria | 12002 |
| 589 | Ga0496123_0235673 | 3300048926 | Bacteria | 912 |
| 590 | Ga0496124_0059412 | 3300048927 | Bacteria | 3212 |
| 591 | Ga0496125_0005695 | 3300048928 | Bacteria | 13740 |
| 592 | Ga0496125_0023864 | 3300048928 | Bacteria | 5636 |
| 593 | Ga0496125_0358947 | 3300048928 | Bacteria | 867 |
| 594 | Ga0496126_0347312 | 3300048929 | Bacteria | 1214 |
| 595 | Ga0501031_0122545 | 3300049568 | Bacteria | 1698 |
| 596 | Ga0501031_0214172 | 3300049568 | Bacteria | 1255 |
| 597 | Ga0501034_0000092 | 3300049571 | Bacteria | 164224 |
| 598 | Ga0501036_0278548 | 3300049572 | Bacteria | 1400 |
| 599 | Ga0501036_0334203 | 3300049572 | Bacteria | 1265 |
| 600 | Ga0501036_0363289 | 3300049572 | Bacteria | 1209 |
| 601 | Ga0501038_0008445 | 3300049574 | Bacteria | 9473 |
| 602 | Ga0501040_0009943 | 3300049576 | Bacteria | 6211 |
| 603 | Ga0501040_0509334 | 3300049576 | Bacteria | 868 |
| 604 | Ga0501041_0000704 | 3300049577 | Bacteria | 17791 |
| 605 | Ga0501042_0120419 | 3300049578 | Bacteria | 1889 |
| 606 | Ga0501042_0790455 | 3300049578 | Bacteria | 690 |
| 607 | Ga0501043_0100361 | 3300049579 | Bacteria | 2275 |
| 608 | Ga0501046_0517164 | 3300049580 | Bacteria | 854 |
| 609 | Ga0501048_0002870 | 3300049582 | Bacteria | 13149 |
| 610 | Ga0501071_0000259 | 3300049587 | Bacteria | 24780 |
| 611 | Ga0501071_0036445 | 3300049587 | Bacteria | 3508 |
| 612 | Ga0501072_0009981 | 3300049588 | Bacteria | 7220 |
| 613 | Ga0501072_0695727 | 3300049588 | Bacteria | 799 |
| 614 | Ga0501073_0009721 | 3300049589 | Bacteria | 7083 |
| 615 | Ga0501073_0202314 | 3300049589 | Bacteria | 1373 |
| 616 | Ga0501074_0025247 | 3300049590 | Bacteria | 4317 |
| 617 | Ga0501075_0000327 | 3300049591 | Bacteria | 26752 |
| 618 | Ga0501076_0000933 | 3300049592 | Bacteria | 19052 |
| 619 | Ga0501076_0366840 | 3300049592 | Bacteria | 1183 |
| 620 | Ga0501077_0000838 | 3300049593 | Bacteria | 18607 |
| 621 | Ga0501077_0004615 | 3300049593 | Bacteria | 8365 |
| 622 | Ga0501077_0299461 | 3300049593 | Bacteria | 1024 |
| 623 | Ga0501249_011811 | 3300049679 | Bacteria | 1839 |
| 624 | Ga0501225_0006957 | 3300049705 | Bacteria | 3295 |
| 625 | Ga0501080_0056134 | 3300049742 | Bacteria | 3668 |
| 626 | Ga0501080_0061373 | 3300049742 | Bacteria | 3500 |
| 627 | Ga0501081_0000101 | 3300049743 | Bacteria | 35737 |
| 628 | Ga0501083_0013202 | 3300049744 | Bacteria | 5773 |
| 629 | Ga0501083_0087503 | 3300049744 | Bacteria | 2060 |
| 630 | Ga0501262_001122 | 3300049759 | Bacteria | 3040 |
| 631 | Ga0501035_0097677 | 3300049822 | Bacteria | 2579 |
| 632 | Ga0501044_0029079 | 3300049823 | Bacteria | 5829 |
| 633 | Ga0501045_0000042 | 3300049824 | Bacteria | 55067 |
| 634 | nmdc:mga03683_12784_c1 | 3300050489 | Bacteria | 3074 |
| 635 | nmdc:mga03683_95848_c1 | 3300050489 | Bacteria | 1299 |
| 636 | nmdc:mga03n38_30725_c1 | 3300050490 | Bacteria | 2261 |
| 637 | nmdc:mga03n38_8821_c1 | 3300050490 | Bacteria | 3637 |
| 638 | nmdc:mga00v17_2820_c1 | 3300050491 | Bacteria | 7991 |
| 639 | nmdc:mga0k408_10181_c1 | 3300050493 | Bacteria | 5082 |
| 640 | nmdc:mga0k408_183752_c1 | 3300050493 | Bacteria | 1247 |
| 641 | nmdc:mga0k408_23438_c1 | 3300050493 | Bacteria | 3482 |
| 642 | nmdc:mga07m45_2056_c1 | 3300050496 | Bacteria | 9337 |
| 643 | nmdc:mga07m45_49159_c1 | 3300050496 | Bacteria | 2373 |
| 644 | nmdc:mga07m45_4961_c1 | 3300050496 | Bacteria | 6565 |
| 645 | nmdc:mga07m45_56174_c1 | 3300050496 | Bacteria | 2225 |
| 646 | nmdc:mga07m45_683_c1 | 3300050496 | Bacteria | 14405 |
| 647 | nmdc:mga08y16_1123770_c1 | 3300050511 | Bacteria | 760 |
| 648 | nmdc:mga08y16_114907_c1 | 3300050511 | Bacteria | 2802 |
| 649 | Ga0500643_001716 | 3300053087 | Bacteria | 12170 |
| 650 | Ga0500594_0068327 | 3300053118 | Bacteria | 1039 |
| 651 | Ga0500559_0004582 | 3300053136 | Bacteria | 6537 |
| 652 | Ga0500559_0026998 | 3300053136 | Bacteria | 2449 |
| 653 | Ga0500573_0084104 | 3300053140 | Bacteria | 1806 |
| 654 | Ga0500637_0008735 | 3300053178 | Bacteria | 5125 |
| 655 | Ga0501084_0009092 | 3300054114 | Bacteria | 8221 |
| 656 | Ga0501082_0002064 | 3300060353 | Bacteria | 17661 |
| 657 | Ga0530510_0005036 | 3300061734 | Bacteria | 9125 |
| 658 | Ga0530510_0073613 | 3300061734 | Bacteria | 2480 |
| 659 | Ga0530510_0455245 | 3300061734 | Bacteria | 968 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046557 | Ga0495622_0379944 | Ga0495622_0379944_41_586 | 181 |
| 2 | 3300050511 | nmdc:mga08y16_1123770_c1 | nmdc:mga08y16_1123770_c1_184_729 | 181 |
| 3 | 3300041512 | Ga0451853_2486265 | Ga0451853_2486265_26_589 | 187 |
| 4 | 3300046522 | Ga0495643_0039363 | Ga0495643_0039363_1829_2470 | 188 |
| 5 | 3300006948 | Ga0099826_10000007 | Ga0099826_10000007323 | 189 |
| 6 | 3300027666 | Ga0209282_1000021 | Ga0209282_100002152 | 189 |
| 7 | 3300009011 | Ga0105251_10010075 | Ga0105251_100100754 | 190 |
| 8 | 3300025735 | Ga0207713_1018323 | Ga0207713_10183232 | 190 |
| 9 | 3300046458 | Ga0495591_053044 | Ga0495591_053044_387_1034 | 190 |
| 10 | 3300046474 | Ga0495605_0009070 | Ga0495605_0009070_3075_3722 | 190 |
| 11 | 3300046491 | Ga0495584_0197273 | Ga0495584_0197273_281_928 | 190 |
| 12 | 3300046500 | Ga0495596_0000299 | Ga0495596_0000299_29930_30577 | 190 |
| 13 | 3300046501 | Ga0495607_0021268 | Ga0495607_0021268_3123_3770 | 190 |
| 14 | 3300046507 | Ga0495606_0372094 | Ga0495606_0372094_55_702 | 190 |
| 15 | 3300046512 | Ga0495610_0014957 | Ga0495610_0014957_2080_2727 | 190 |
| 16 | 3300046513 | Ga0495616_0003303 | Ga0495616_0003303_1855_2502 | 190 |
| 17 | 3300046518 | Ga0495631_0137044 | Ga0495631_0137044_230_877 | 190 |
| 18 | 3300046524 | Ga0495648_0027242 | Ga0495648_0027242_65_712 | 190 |
| 19 | 3300046538 | Ga0495609_0002941 | Ga0495609_0002941_1712_2359 | 190 |
| 20 | 3300046648 | Ga0495611_0210095 | Ga0495611_0210095_232_879 | 190 |
| 21 | 3300046665 | Ga0495661_0023398 | Ga0495661_0023398_323_970 | 190 |
| 22 | 3300046684 | Ga0495669_0075902 | Ga0495669_0075902_264_911 | 190 |
| 23 | 3300046691 | Ga0495670_0179196 | Ga0495670_0179196_129_776 | 190 |
| 24 | 3300046692 | Ga0495671_0005389 | Ga0495671_0005389_4709_5356 | 190 |
| 25 | 3300046694 | Ga0495649_0010233 | Ga0495649_0010233_201_848 | 190 |
| 26 | 3300047320 | Ga0495672_0019047 | Ga0495672_0019047_2186_2833 | 190 |
| 27 | 3300047447 | Ga0495685_070960 | Ga0495685_070960_158_805 | 190 |
| 28 | 3300047469 | Ga0495673_0017124 | Ga0495673_0017124_2945_3592 | 190 |
| 29 | 3300048919 | Ga0496116_0064717 | Ga0496116_0064717_316_963 | 190 |
| 30 | 3300048924 | Ga0496121_0041031 | Ga0496121_0041031_112_759 | 190 |
| 31 | 3300048925 | Ga0496122_0006383 | Ga0496122_0006383_1820_2467 | 190 |
| 32 | 3300048926 | Ga0496123_0005960 | Ga0496123_0005960_271_918 | 190 |
| 33 | 3300048928 | Ga0496125_0358947 | Ga0496125_0358947_45_692 | 190 |
| 34 | 3300048929 | Ga0496126_0347312 | Ga0496126_0347312_431_1078 | 190 |
| 35 | 3300005834 | Ga0068851_10153906 | Ga0068851_101539062 | 200 |
| 36 | 3300013308 | Ga0157375_10002431 | Ga0157375_1000243112 | 200 |
| 37 | 3300035724 | Ga0373933_0299556 | Ga0373933_0299556_21_623 | 200 |
| 38 | 3300041460 | Ga0451802_0356051 | Ga0451802_0356051_32_634 | 200 |
| 39 | 3300041512 | Ga0451853_0197513 | Ga0451853_0197513_199_801 | 200 |
| 40 | 3300042530 | Ga0450916_002925 | Ga0450916_002925_448_1050 | 200 |
| 41 | 3300046660 | Ga0495625_0033218 | Ga0495625_0033218_1455_2057 | 200 |
| 42 | 3300046694 | Ga0495649_0447313 | Ga0495649_0447313_32_634 | 200 |
| 43 | 3300048908 | Ga0496105_0645599 | Ga0496105_0645599_13_615 | 200 |
| 44 | 3300049568 | Ga0501031_0214172 | Ga0501031_0214172_170_772 | 200 |
| 45 | 3300049578 | Ga0501042_0790455 | Ga0501042_0790455_34_636 | 200 |
| 46 | 3300061734 | Ga0530510_0455245 | Ga0530510_0455245_321_923 | 200 |
| 47 | iso_pu_bacteria | 2643221637 | 2644210028 | 201 |
| 48 | iso_pu_bacteria | 2643221718 | 2644653579 | 201 |
| 49 | 3300048915 | Ga0496112_0593440 | Ga0496112_0593440_170_787 | 204 |
| 50 | iso_pu_bacteria | 2513020051 | 2513229087 | 207 |
| 51 | iso_pu_bacteria | 2643221672 | 2644401735 | 207 |
| 52 | iso_pu_bacteria | 2885198086 | 2885203543 | 207 |
| 53 | iso_pu_bacteria | 2885211737 | 2885217107 | 207 |
| 54 | iso_pu_bacteria | 2842677519 | 2842678404 | 208 |
| 55 | iso_pu_bacteria | 2842733646 | 2842735380 | 208 |
| 56 | iso_pu_bacteria | 2842747753 | 2842748157 | 208 |
| 57 | iso_pu_bacteria | 2885192300 | 2885197364 | 208 |
| 58 | iso_pu_bacteria | 2904449895 | 2904455041 | 208 |
| 59 | iso_pu_bacteria | 2904456579 | 2904457401 | 208 |
| 60 | iso_pu_bacteria | 2919462493 | 2919465180 | 208 |
| 61 | iso_pu_bacteria | 2928115317 | 2928115401 | 208 |
| 62 | iso_pu_bacteria | 2929520902 | 2929525161 | 208 |
| 63 | iso_pu_bacteria | 2945972063 | 2945977798 | 208 |
| 64 | 3300033180 | Ga0307510_10000004 | Ga0307510_10000004132 | 209 |
| 65 | 3300048905 | Ga0496102_1175836 | Ga0496102_1175836_15_644 | 209 |
| 66 | 3300048909 | Ga0496106_0350198 | Ga0496106_0350198_389_1018 | 209 |
| 67 | 3300048919 | Ga0496116_0008921 | Ga0496116_0008921_4120_4749 | 209 |
| 68 | 3300048920 | Ga0496117_0000627 | Ga0496117_0000627_15839_16468 | 209 |
| 69 | 3300048921 | Ga0496118_0000026 | Ga0496118_0000026_316289_316918 | 209 |
| 70 | 3300048922 | Ga0496119_0003877 | Ga0496119_0003877_12271_12900 | 209 |
| 71 | 3300048922 | Ga0496119_0117481 | Ga0496119_0117481_29_658 | 209 |
| 72 | 3300048923 | Ga0496120_0004425 | Ga0496120_0004425_7552_8181 | 209 |
| 73 | 3300048924 | Ga0496121_0092120 | Ga0496121_0092120_823_1452 | 209 |
| 74 | 3300048928 | Ga0496125_0023864 | Ga0496125_0023864_4297_4926 | 209 |
| 75 | 3300025294 | Ga0209025_1056740 | Ga0209025_10567402 | 210 |
| 76 | 3300049592 | Ga0501076_0366840 | Ga0501076_0366840_101_736 | 210 |
| 77 | 3300049593 | Ga0501077_0299461 | Ga0501077_0299461_45_680 | 210 |
| 78 | 3300061734 | Ga0530510_0073613 | Ga0530510_0073613_1701_2336 | 210 |
| 79 | iso_pu_bacteria | 2887375801 | 2887377967 | 210 |
| 80 | 3300003773 | Ga0055537_1000195 | Ga0055537_100019536 | 211 |
| 81 | 3300003784 | Ga0055534_1000262 | Ga0055534_100026236 | 211 |
| 82 | 3300003784 | Ga0055534_1000285 | Ga0055534_100028527 | 211 |
| 83 | 3300003790 | Ga0055528_1000371 | Ga0055528_10003715 | 211 |
| 84 | 3300005288 | Ga0065714_10005960 | Ga0065714_100059602 | 211 |
| 85 | 3300005328 | Ga0070676_10104250 | Ga0070676_101042503 | 211 |
| 86 | 3300005347 | Ga0070668_100004659 | Ga0070668_1000046593 | 211 |
| 87 | 3300005367 | Ga0070667_100017213 | Ga0070667_1000172134 | 211 |
| 88 | 3300005548 | Ga0070665_100000424 | Ga0070665_10000042431 | 211 |
| 89 | 3300005548 | Ga0070665_100047472 | Ga0070665_1000474726 | 211 |
| 90 | 3300005564 | Ga0070664_100048248 | Ga0070664_1000482483 | 211 |
| 91 | 3300005577 | Ga0068857_100310600 | Ga0068857_1003106002 | 211 |
| 92 | 3300005616 | Ga0068852_100523227 | Ga0068852_1005232271 | 211 |
| 93 | 3300005719 | Ga0068861_100348483 | Ga0068861_1003484832 | 211 |
| 94 | 3300006048 | Ga0075363_100023822 | Ga0075363_1000238223 | 211 |
| 95 | 3300006237 | Ga0097621_100266208 | Ga0097621_1002662082 | 211 |
| 96 | 3300006353 | Ga0075370_10045441 | Ga0075370_100454412 | 211 |
| 97 | 3300006358 | Ga0068871_100375580 | Ga0068871_1003755802 | 211 |
| 98 | 3300006358 | Ga0068871_100496360 | Ga0068871_1004963602 | 211 |
| 99 | 3300006948 | Ga0099826_10011566 | Ga0099826_100115665 | 211 |
| 100 | 3300009011 | Ga0105251_10001536 | Ga0105251_100015365 | 211 |
| 101 | 3300009036 | Ga0105244_10001232 | Ga0105244_100012326 | 211 |
| 102 | 3300009148 | Ga0105243_10002672 | Ga0105243_100026723 | 211 |
| 103 | 3300009174 | Ga0105241_10002121 | Ga0105241_100021215 | 211 |
| 104 | 3300009176 | Ga0105242_10488428 | Ga0105242_104884282 | 211 |
| 105 | 3300009177 | Ga0105248_10067276 | Ga0105248_100672764 | 211 |
| 106 | 3300009553 | Ga0105249_10040032 | Ga0105249_100400323 | 211 |
| 107 | 3300011119 | Ga0105246_10049393 | Ga0105246_100493933 | 211 |
| 108 | 3300013100 | Ga0157373_10001598 | Ga0157373_100015985 | 211 |
| 109 | 3300014969 | Ga0157376_10284656 | Ga0157376_102846562 | 211 |
| 110 | 3300015261 | Ga0182006_1002496 | Ga0182006_10024964 | 211 |
| 111 | 3300015262 | Ga0182007_10000705 | Ga0182007_1000070515 | 211 |
| 112 | 3300015265 | Ga0182005_1008500 | Ga0182005_10085002 | 211 |
| 113 | 3300025263 | Ga0209565_1000087 | Ga0209565_100008736 | 211 |
| 114 | 3300025273 | Ga0209673_1000145 | Ga0209673_100014536 | 211 |
| 115 | 3300025291 | Ga0209675_1000085 | Ga0209675_100008536 | 211 |
| 116 | 3300025292 | Ga0209676_1000172 | Ga0209676_100017251 | 211 |
| 117 | 3300025298 | Ga0209050_1000509 | Ga0209050_100050918 | 211 |
| 118 | 3300025303 | Ga0209051_1000278 | Ga0209051_100027871 | 211 |
| 119 | 3300025304 | Ga0209257_1000072 | Ga0209257_1000072215 | 211 |
| 120 | 3300025728 | Ga0207655_1012902 | Ga0207655_10129023 | 211 |
| 121 | 3300025735 | Ga0207713_1001292 | Ga0207713_10012926 | 211 |
| 122 | 3300025911 | Ga0207654_10000574 | Ga0207654_100005746 | 211 |
| 123 | 3300025920 | Ga0207649_10117143 | Ga0207649_101171432 | 211 |
| 124 | 3300025935 | Ga0207709_10003493 | Ga0207709_100034934 | 211 |
| 125 | 3300025941 | Ga0207711_10070534 | Ga0207711_100705343 | 211 |
| 126 | 3300025945 | Ga0207679_10263410 | Ga0207679_102634102 | 211 |
| 127 | 3300025960 | Ga0207651_10086283 | Ga0207651_100862832 | 211 |
| 128 | 3300025961 | Ga0207712_10046111 | Ga0207712_100461113 | 211 |
| 129 | 3300025986 | Ga0207658_10003371 | Ga0207658_100033714 | 211 |
| 130 | 3300026116 | Ga0207674_10070466 | Ga0207674_100704663 | 211 |
| 131 | 3300026118 | Ga0207675_100666500 | Ga0207675_1006665002 | 211 |
| 132 | 3300026121 | Ga0207683_10013773 | Ga0207683_100137736 | 211 |
| 133 | 3300027666 | Ga0209282_1003254 | Ga0209282_10032548 | 211 |
| 134 | 3300028379 | Ga0268266_10000409 | Ga0268266_1000040931 | 211 |
| 135 | 3300028379 | Ga0268266_10006147 | Ga0268266_100061472 | 211 |
| 136 | 3300028380 | Ga0268265_10046320 | Ga0268265_100463202 | 211 |
| 137 | 3300028381 | Ga0268264_10225339 | Ga0268264_102253392 | 211 |
| 138 | 3300031251 | Ga0265327_10000640 | Ga0265327_100006406 | 211 |
| 139 | 3300031251 | Ga0265327_10019675 | Ga0265327_100196755 | 211 |
| 140 | 3300031548 | Ga0307408_100033508 | Ga0307408_1000335084 | 211 |
| 141 | 3300031731 | Ga0307405_10128973 | Ga0307405_101289732 | 211 |
| 142 | 3300031901 | Ga0307406_10004223 | Ga0307406_100042237 | 211 |
| 143 | 3300032004 | Ga0307414_10337040 | Ga0307414_103370402 | 211 |
| 144 | 3300032005 | Ga0307411_10203522 | Ga0307411_102035222 | 211 |
| 145 | 3300041411 | Ga0439466_0005864 | Ga0439466_0005864_2494_3135 | 211 |
| 146 | 3300041997 | Ga0439431_0073240 | Ga0439431_0073240_255_896 | 211 |
| 147 | 3300042002 | Ga0439442_003529 | Ga0439442_003529_2291_2929 | 211 |
| 148 | 3300042006 | Ga0439432_002182 | Ga0439432_002182_1541_2182 | 211 |
| 149 | 3300042128 | Ga0450897_000645 | Ga0450897_000645_115_753 | 211 |
| 150 | 3300042133 | Ga0450896_036698 | Ga0450896_036698_82_720 | 211 |
| 151 | 3300042145 | Ga0450906_001705 | Ga0450906_001705_3622_4260 | 211 |
| 152 | 3300046472 | Ga0495580_0000702 | Ga0495580_0000702_18523_19158 | 211 |
| 153 | 3300046514 | Ga0495618_0158283 | Ga0495618_0158283_699_1337 | 211 |
| 154 | 3300046524 | Ga0495648_0099474 | Ga0495648_0099474_908_1543 | 211 |
| 155 | 3300046539 | Ga0495621_0081075 | Ga0495621_0081075_26_664 | 211 |
| 156 | 3300046660 | Ga0495625_0000012 | Ga0495625_0000012_225100_225738 | 211 |
| 157 | 3300048919 | Ga0496116_0067789 | Ga0496116_0067789_975_1613 | 211 |
| 158 | 3300048922 | Ga0496119_0007208 | Ga0496119_0007208_7021_7656 | 211 |
| 159 | 3300048923 | Ga0496120_0001237 | Ga0496120_0001237_21060_21695 | 211 |
| 160 | 3300050490 | nmdc:mga03n38_30725_c1 | nmdc:mga03n38_30725_c1_84_722 | 211 |
| 161 | 3300050491 | nmdc:mga00v17_2820_c1 | nmdc:mga00v17_2820_c1_4717_5355 | 211 |
| 162 | 3300050493 | nmdc:mga0k408_10181_c1 | nmdc:mga0k408_10181_c1_904_1542 | 211 |
| 163 | 3300050496 | nmdc:mga07m45_2056_c1 | nmdc:mga07m45_2056_c1_7592_8230 | 211 |
| 164 | 3300050496 | nmdc:mga07m45_4961_c1 | nmdc:mga07m45_4961_c1_1193_1831 | 211 |
| 165 | iso_pu_bacteria | 2513237150 | 2513953844 | 211 |
| 166 | iso_pu_bacteria | 2513237165 | 2514039980 | 211 |
| 167 | iso_pu_bacteria | 2834641062 | 2834641107 | 211 |
| 168 | iso_pu_bacteria | 2901300506 | 2901301780 | 211 |
| 169 | iso_pu_bacteria | 644736347 | 644746639 | 211 |
| 170 | iso_pu_bacteria | 8003400568 | 8003403316 | 211 |
| 171 | 3300003781 | Ga0055536_1010988 | Ga0055536_10109883 | 212 |
| 172 | 3300003791 | Ga0055530_10021246 | Ga0055530_100212462 | 212 |
| 173 | 3300003792 | Ga0055540_1000978 | Ga0055540_10009785 | 212 |
| 174 | 3300003792 | Ga0055540_1009078 | Ga0055540_10090782 | 212 |
| 175 | 3300003794 | Ga0055531_10014414 | Ga0055531_100144142 | 212 |
| 176 | 3300005289 | Ga0065704_10129945 | Ga0065704_101299452 | 212 |
| 177 | 3300005335 | Ga0070666_10006152 | Ga0070666_100061525 | 212 |
| 178 | 3300005335 | Ga0070666_10409168 | Ga0070666_104091682 | 212 |
| 179 | 3300005344 | Ga0070661_100526644 | Ga0070661_1005266442 | 212 |
| 180 | 3300005353 | Ga0070669_100009237 | Ga0070669_1000092377 | 212 |
| 181 | 3300005356 | Ga0070674_100062415 | Ga0070674_1000624152 | 212 |
| 182 | 3300005356 | Ga0070674_100091192 | Ga0070674_1000911923 | 212 |
| 183 | 3300005364 | Ga0070673_100192846 | Ga0070673_1001928462 | 212 |
| 184 | 3300005364 | Ga0070673_100622395 | Ga0070673_1006223952 | 212 |
| 185 | 3300005367 | Ga0070667_100049979 | Ga0070667_1000499792 | 212 |
| 186 | 3300005367 | Ga0070667_100106012 | Ga0070667_1001060122 | 212 |
| 187 | 3300005456 | Ga0070678_100003377 | Ga0070678_1000033778 | 212 |
| 188 | 3300005459 | Ga0068867_100023257 | Ga0068867_1000232576 | 212 |
| 189 | 3300005466 | Ga0070685_10245336 | Ga0070685_102453361 | 212 |
| 190 | 3300005543 | Ga0070672_100507585 | Ga0070672_1005075852 | 212 |
| 191 | 3300005543 | Ga0070672_100584024 | Ga0070672_1005840242 | 212 |
| 192 | 3300005548 | Ga0070665_100003568 | Ga0070665_10000356811 | 212 |
| 193 | 3300005548 | Ga0070665_100483920 | Ga0070665_1004839202 | 212 |
| 194 | 3300005842 | Ga0068858_100358334 | Ga0068858_1003583342 | 212 |
| 195 | 3300006038 | Ga0075365_10221394 | Ga0075365_102213942 | 212 |
| 196 | 3300006048 | Ga0075363_100006796 | Ga0075363_1000067963 | 212 |
| 197 | 3300006048 | Ga0075363_100058517 | Ga0075363_1000585173 | 212 |
| 198 | 3300006051 | Ga0075364_10010551 | Ga0075364_100105514 | 212 |
| 199 | 3300006051 | Ga0075364_10321472 | Ga0075364_103214721 | 212 |
| 200 | 3300006058 | Ga0075432_10044328 | Ga0075432_100443281 | 212 |
| 201 | 3300006178 | Ga0075367_10292080 | Ga0075367_102920802 | 212 |
| 202 | 3300006195 | Ga0075366_10087248 | Ga0075366_100872482 | 212 |
| 203 | 3300006237 | Ga0097621_100092510 | Ga0097621_1000925102 | 212 |
| 204 | 3300006237 | Ga0097621_100588641 | Ga0097621_1005886411 | 212 |
| 205 | 3300006353 | Ga0075370_10003659 | Ga0075370_100036595 | 212 |
| 206 | 3300006353 | Ga0075370_10009760 | Ga0075370_100097604 | 212 |
| 207 | 3300006353 | Ga0075370_10011926 | Ga0075370_100119265 | 212 |
| 208 | 3300006353 | Ga0075370_10081888 | Ga0075370_100818882 | 212 |
| 209 | 3300006881 | Ga0068865_100509152 | Ga0068865_1005091522 | 212 |
| 210 | 3300006946 | Ga0079104_1024276 | Ga0079104_10242762 | 212 |
| 211 | 3300006948 | Ga0099826_10148051 | Ga0099826_101480512 | 212 |
| 212 | 3300009148 | Ga0105243_10045322 | Ga0105243_100453224 | 212 |
| 213 | 3300013104 | Ga0157370_10389316 | Ga0157370_103893162 | 212 |
| 214 | 3300013296 | Ga0157374_10156336 | Ga0157374_101563363 | 212 |
| 215 | 3300013308 | Ga0157375_10135565 | Ga0157375_101355652 | 212 |
| 216 | 3300014497 | Ga0182008_10000041 | Ga0182008_10000041103 | 212 |
| 217 | 3300014497 | Ga0182008_10000979 | Ga0182008_100009796 | 212 |
| 218 | 3300014497 | Ga0182008_10008454 | Ga0182008_100084544 | 212 |
| 219 | 3300014497 | Ga0182008_10107226 | Ga0182008_101072262 | 212 |
| 220 | 3300015261 | Ga0182006_1030272 | Ga0182006_10302723 | 212 |
| 221 | 3300015261 | Ga0182006_1116324 | Ga0182006_11163241 | 212 |
| 222 | 3300015262 | Ga0182007_10001863 | Ga0182007_100018635 | 212 |
| 223 | 3300015265 | Ga0182005_1041237 | Ga0182005_10412371 | 212 |
| 224 | 3300017792 | Ga0163161_10279416 | Ga0163161_102794162 | 212 |
| 225 | 3300017792 | Ga0163161_10326606 | Ga0163161_103266062 | 212 |
| 226 | 3300025273 | Ga0209673_1015703 | Ga0209673_10157033 | 212 |
| 227 | 3300025294 | Ga0209025_1005552 | Ga0209025_10055524 | 212 |
| 228 | 3300025303 | Ga0209051_1000397 | Ga0209051_100039742 | 212 |
| 229 | 3300025903 | Ga0207680_10193135 | Ga0207680_101931352 | 212 |
| 230 | 3300025923 | Ga0207681_10026903 | Ga0207681_100269032 | 212 |
| 231 | 3300025923 | Ga0207681_10178362 | Ga0207681_101783622 | 212 |
| 232 | 3300025933 | Ga0207706_10440163 | Ga0207706_104401632 | 212 |
| 233 | 3300025935 | Ga0207709_10718032 | Ga0207709_107180321 | 212 |
| 234 | 3300025937 | Ga0207669_10262548 | Ga0207669_102625482 | 212 |
| 235 | 3300025940 | Ga0207691_10075284 | Ga0207691_100752842 | 212 |
| 236 | 3300025949 | Ga0207667_10392229 | Ga0207667_103922292 | 212 |
| 237 | 3300025986 | Ga0207658_10040291 | Ga0207658_100402912 | 212 |
| 238 | 3300026121 | Ga0207683_10008216 | Ga0207683_100082168 | 212 |
| 239 | 3300028379 | Ga0268266_10009480 | Ga0268266_100094809 | 212 |
| 240 | 3300028379 | Ga0268266_10113364 | Ga0268266_101133642 | 212 |
| 241 | 3300028794 | Ga0307515_10000195 | Ga0307515_1000019529 | 212 |
| 242 | 3300028794 | Ga0307515_10053551 | Ga0307515_100535514 | 212 |
| 243 | 3300030731 | Ga0316177_1083748 | Ga0316177_10837486 | 212 |
| 244 | 3300030732 | Ga0316176_1114549 | Ga0316176_11145495 | 212 |
| 245 | 3300030733 | Ga0314311_1068161 | Ga0314311_10681613 | 212 |
| 246 | 3300030744 | Ga0316181_1033992 | Ga0316181_10339922 | 212 |
| 247 | 3300030745 | Ga0316182_1107731 | Ga0316182_11077311 | 212 |
| 248 | 3300031456 | Ga0307513_10096801 | Ga0307513_100968014 | 212 |
| 249 | 3300031548 | Ga0307408_100272214 | Ga0307408_1002722142 | 212 |
| 250 | 3300031731 | Ga0307405_10201872 | Ga0307405_102018722 | 212 |
| 251 | 3300031731 | Ga0307405_10520081 | Ga0307405_105200811 | 212 |
| 252 | 3300031911 | Ga0307412_10081389 | Ga0307412_100813892 | 212 |
| 253 | 3300032002 | Ga0307416_100354000 | Ga0307416_1003540002 | 212 |
| 254 | 3300032002 | Ga0307416_100396996 | Ga0307416_1003969962 | 212 |
| 255 | 3300032005 | Ga0307411_10186537 | Ga0307411_101865372 | 212 |
| 256 | 3300035692 | Ga0373935_0110233 | Ga0373935_0110233_549_1214 | 212 |
| 257 | 3300035724 | Ga0373933_0078327 | Ga0373933_0078327_920_1558 | 212 |
| 258 | 3300036401 | Ga0373937_0017834 | Ga0373937_0017834_4197_4835 | 212 |
| 259 | 3300037068 | Ga0373925_0332540 | Ga0373925_0332540_372_1037 | 212 |
| 260 | 3300041404 | Ga0439436_0000260 | Ga0439436_0000260_3894_4547 | 212 |
| 261 | 3300041404 | Ga0439436_0012416 | Ga0439436_0012416_1407_2060 | 212 |
| 262 | 3300041407 | Ga0439447_030299 | Ga0439447_030299_354_1007 | 212 |
| 263 | 3300041410 | Ga0439461_0033173 | Ga0439461_0033173_59_700 | 212 |
| 264 | 3300041411 | Ga0439466_0010965 | Ga0439466_0010965_1984_2625 | 212 |
| 265 | 3300041411 | Ga0439466_0023327 | Ga0439466_0023327_451_1104 | 212 |
| 266 | 3300041411 | Ga0439466_0086653 | Ga0439466_0086653_178_831 | 212 |
| 267 | 3300041413 | Ga0439465_0006112 | Ga0439465_0006112_814_1467 | 212 |
| 268 | 3300041413 | Ga0439465_0042948 | Ga0439465_0042948_584_1225 | 212 |
| 269 | 3300041509 | Ga0451843_0219946 | Ga0451843_0219946_529_1182 | 212 |
| 270 | 3300041511 | Ga0451855_1329526 | Ga0451855_1329526_13_651 | 212 |
| 271 | 3300041997 | Ga0439431_0003269 | Ga0439431_0003269_2028_2681 | 212 |
| 272 | 3300041999 | Ga0439433_0001399 | Ga0439433_0001399_362_1015 | 212 |
| 273 | 3300041999 | Ga0439433_0038866 | Ga0439433_0038866_173_826 | 212 |
| 274 | 3300041999 | Ga0439433_0060410 | Ga0439433_0060410_47_700 | 212 |
| 275 | 3300042002 | Ga0439442_004209 | Ga0439442_004209_41_694 | 212 |
| 276 | 3300042004 | Ga0439445_0003443 | Ga0439445_0003443_2521_3174 | 212 |
| 277 | 3300042004 | Ga0439445_0030248 | Ga0439445_0030248_615_1268 | 212 |
| 278 | 3300042004 | Ga0439445_0121535 | Ga0439445_0121535_16_657 | 212 |
| 279 | 3300042006 | Ga0439432_008573 | Ga0439432_008573_730_1383 | 212 |
| 280 | 3300042006 | Ga0439432_028280 | Ga0439432_028280_663_1316 | 212 |
| 281 | 3300042007 | Ga0439449_0000810 | Ga0439449_0000810_9446_10099 | 212 |
| 282 | 3300042007 | Ga0439449_0007367 | Ga0439449_0007367_2917_3570 | 212 |
| 283 | 3300042007 | Ga0439449_0009810 | Ga0439449_0009810_724_1377 | 212 |
| 284 | 3300042010 | Ga0439452_004990 | Ga0439452_004990_3312_3965 | 212 |
| 285 | 3300042012 | Ga0439455_0077550 | Ga0439455_0077550_170_823 | 212 |
| 286 | 3300042014 | Ga0439457_005960 | Ga0439457_005960_400_1053 | 212 |
| 287 | 3300042015 | Ga0439462_0026761 | Ga0439462_0026761_609_1262 | 212 |
| 288 | 3300042125 | Ga0450923_040091 | Ga0450923_040091_146_799 | 212 |
| 289 | 3300042156 | Ga0439446_0051485 | Ga0439446_0051485_197_850 | 212 |
| 290 | 3300042156 | Ga0439446_0149516 | Ga0439446_0149516_35_712 | 212 |
| 291 | 3300042184 | Ga0450908_006253 | Ga0450908_006253_38_679 | 212 |
| 292 | 3300042184 | Ga0450908_033829 | Ga0450908_033829_160_813 | 212 |
| 293 | 3300042435 | Ga0439434_0001306 | Ga0439434_0001306_103_744 | 212 |
| 294 | 3300042435 | Ga0439434_0103329 | Ga0439434_0103329_246_899 | 212 |
| 295 | 3300044683 | Ga0466965_0070652 | Ga0466965_0070652_262_915 | 212 |
| 296 | 3300044901 | Ga0466960_0205682 | Ga0466960_0205682_146_799 | 212 |
| 297 | 3300046454 | Ga0495592_0465296 | Ga0495592_0465296_23_664 | 212 |
| 298 | 3300046471 | Ga0495650_0061299 | Ga0495650_0061299_364_1008 | 212 |
| 299 | 3300046475 | Ga0495639_0004033 | Ga0495639_0004033_5385_6026 | 212 |
| 300 | 3300046533 | Ga0495640_0313795 | Ga0495640_0313795_303_944 | 212 |
| 301 | 3300046535 | Ga0495586_0199321 | Ga0495586_0199321_23_664 | 212 |
| 302 | 3300046539 | Ga0495621_0003186 | Ga0495621_0003186_1140_1781 | 212 |
| 303 | 3300046615 | Ga0495656_0000447 | Ga0495656_0000447_6719_7360 | 212 |
| 304 | 3300046674 | Ga0495588_0353182 | Ga0495588_0353182_107_748 | 212 |
| 305 | 3300046675 | Ga0495657_0099305 | Ga0495657_0099305_1002_1640 | 212 |
| 306 | 3300046809 | Ga0495600_0082730 | Ga0495600_0082730_1069_1710 | 212 |
| 307 | 3300047673 | Ga0495593_0073206 | Ga0495593_0073206_426_1067 | 212 |
| 308 | 3300048090 | Ga0495615_0003743 | Ga0495615_0003743_227_868 | 212 |
| 309 | 3300048904 | Ga0496101_0000615 | Ga0496101_0000615_7662_8303 | 212 |
| 310 | 3300048905 | Ga0496102_0001349 | Ga0496102_0001349_2092_2733 | 212 |
| 311 | 3300048906 | Ga0496103_0021865 | Ga0496103_0021865_2713_3354 | 212 |
| 312 | 3300048907 | Ga0496104_0020542 | Ga0496104_0020542_2066_2707 | 212 |
| 313 | 3300048908 | Ga0496105_0009353 | Ga0496105_0009353_3678_4319 | 212 |
| 314 | 3300048912 | Ga0496109_0419856 | Ga0496109_0419856_403_1044 | 212 |
| 315 | 3300048914 | Ga0496111_0030992 | Ga0496111_0030992_809_1450 | 212 |
| 316 | 3300048916 | Ga0496113_0319567 | Ga0496113_0319567_417_1058 | 212 |
| 317 | 3300048917 | Ga0496114_0107136 | Ga0496114_0107136_94_735 | 212 |
| 318 | 3300048917 | Ga0496114_0259914 | Ga0496114_0259914_654_1295 | 212 |
| 319 | 3300048925 | Ga0496122_0000528 | Ga0496122_0000528_35359_36024 | 212 |
| 320 | 3300048926 | Ga0496123_0000308 | Ga0496123_0000308_6053_6718 | 212 |
| 321 | 3300048926 | Ga0496123_0235673 | Ga0496123_0235673_135_776 | 212 |
| 322 | 3300048927 | Ga0496124_0059412 | Ga0496124_0059412_2450_3115 | 212 |
| 323 | 3300049679 | Ga0501249_011811 | Ga0501249_011811_111_752 | 212 |
| 324 | 3300049705 | Ga0501225_0006957 | Ga0501225_0006957_146_787 | 212 |
| 325 | 3300049759 | Ga0501262_001122 | Ga0501262_001122_222_863 | 212 |
| 326 | 3300049823 | Ga0501044_0029079 | Ga0501044_0029079_3040_3681 | 212 |
| 327 | 3300050489 | nmdc:mga03683_12784_c1 | nmdc:mga03683_12784_c1_357_1010 | 212 |
| 328 | 3300050489 | nmdc:mga03683_95848_c1 | nmdc:mga03683_95848_c1_290_931 | 212 |
| 329 | 3300050490 | nmdc:mga03n38_8821_c1 | nmdc:mga03n38_8821_c1_1610_2251 | 212 |
| 330 | 3300050493 | nmdc:mga0k408_183752_c1 | nmdc:mga0k408_183752_c1_409_1155 | 212 |
| 331 | 3300050493 | nmdc:mga0k408_23438_c1 | nmdc:mga0k408_23438_c1_1102_1743 | 212 |
| 332 | 3300050496 | nmdc:mga07m45_49159_c1 | nmdc:mga07m45_49159_c1_1660_2301 | 212 |
| 333 | 3300050496 | nmdc:mga07m45_56174_c1 | nmdc:mga07m45_56174_c1_514_1167 | 212 |
| 334 | 3300050496 | nmdc:mga07m45_683_c1 | nmdc:mga07m45_683_c1_1411_2052 | 212 |
| 335 | 3300053087 | Ga0500643_001716 | Ga0500643_001716_1751_2401 | 212 |
| 336 | 3300053118 | Ga0500594_0068327 | Ga0500594_0068327_183_848 | 212 |
| 337 | 3300053136 | Ga0500559_0004582 | Ga0500559_0004582_668_1333 | 212 |
| 338 | 3300053136 | Ga0500559_0026998 | Ga0500559_0026998_185_850 | 212 |
| 339 | 3300053140 | Ga0500573_0084104 | Ga0500573_0084104_569_1234 | 212 |
| 340 | iso_pu_bacteria | 2643221628 | 2644162487 | 212 |
| 341 | 3300005548 | Ga0070665_100194799 | Ga0070665_1001947992 | 213 |
| 342 | 3300009093 | Ga0105240_10096110 | Ga0105240_100961103 | 213 |
| 343 | 3300009553 | Ga0105249_10169344 | Ga0105249_101693441 | 213 |
| 344 | 3300025961 | Ga0207712_10836371 | Ga0207712_108363711 | 213 |
| 345 | 3300028379 | Ga0268266_10030458 | Ga0268266_100304584 | 213 |
| 346 | 3300035113 | Ga0373936_0017773 | Ga0373936_0017773_85_726 | 213 |
| 347 | 3300003316 | rootH1_10133818 | rootH1_101338185 | 214 |
| 348 | 3300005335 | Ga0070666_10078043 | Ga0070666_100780432 | 214 |
| 349 | 3300005530 | Ga0070679_100154181 | Ga0070679_1001541812 | 214 |
| 350 | 3300005563 | Ga0068855_100084349 | Ga0068855_1000843492 | 214 |
| 351 | 3300005577 | Ga0068857_100402912 | Ga0068857_1004029122 | 214 |
| 352 | 3300005617 | Ga0068859_100033938 | Ga0068859_1000339387 | 214 |
| 353 | 3300005841 | Ga0068863_100001655 | Ga0068863_10000165512 | 214 |
| 354 | 3300005843 | Ga0068860_100000352 | Ga0068860_10000035211 | 214 |
| 355 | 3300009093 | Ga0105240_10010103 | Ga0105240_100101036 | 214 |
| 356 | 3300009093 | Ga0105240_10334637 | Ga0105240_103346372 | 214 |
| 357 | 3300009545 | Ga0105237_10082802 | Ga0105237_100828026 | 214 |
| 358 | 3300009545 | Ga0105237_10255457 | Ga0105237_102554571 | 214 |
| 359 | 3300009545 | Ga0105237_10571375 | Ga0105237_105713751 | 214 |
| 360 | 3300009545 | Ga0105237_10693194 | Ga0105237_106931942 | 214 |
| 361 | 3300010375 | Ga0105239_10243310 | Ga0105239_102433102 | 214 |
| 362 | 3300011119 | Ga0105246_10410322 | Ga0105246_104103222 | 214 |
| 363 | 3300013105 | Ga0157369_10380620 | Ga0157369_103806202 | 214 |
| 364 | 3300014968 | Ga0157379_10056147 | Ga0157379_100561474 | 214 |
| 365 | 3300014968 | Ga0157379_10215828 | Ga0157379_102158282 | 214 |
| 366 | 3300014969 | Ga0157376_11127410 | Ga0157376_111274101 | 214 |
| 367 | 3300025903 | Ga0207680_10089377 | Ga0207680_100893772 | 214 |
| 368 | 3300025914 | Ga0207671_10375621 | Ga0207671_103756211 | 214 |
| 369 | 3300025961 | Ga0207712_10125354 | Ga0207712_101253543 | 214 |
| 370 | 3300025986 | Ga0207658_10155842 | Ga0207658_101558421 | 214 |
| 371 | 3300026041 | Ga0207639_10028438 | Ga0207639_100284384 | 214 |
| 372 | 3300026067 | Ga0207678_10040725 | Ga0207678_100407254 | 214 |
| 373 | 3300026088 | Ga0207641_10000220 | Ga0207641_100002209 | 214 |
| 374 | 3300026116 | Ga0207674_10252648 | Ga0207674_102526482 | 214 |
| 375 | 3300028381 | Ga0268264_10000085 | Ga0268264_10000085141 | 214 |
| 376 | 3300030521 | Ga0307511_10000204 | Ga0307511_100002048 | 214 |
| 377 | 3300030521 | Ga0307511_10044022 | Ga0307511_100440221 | 214 |
| 378 | 3300033180 | Ga0307510_10158236 | Ga0307510_101582364 | 214 |
| 379 | 3300035113 | Ga0373936_0021254 | Ga0373936_0021254_956_1600 | 214 |
| 380 | 3300037068 | Ga0373925_0377024 | Ga0373925_0377024_318_962 | 214 |
| 381 | 3300046507 | Ga0495606_0090125 | Ga0495606_0090125_839_1483 | 214 |
| 382 | 3300046507 | Ga0495606_0199609 | Ga0495606_0199609_232_876 | 214 |
| 383 | 3300046522 | Ga0495643_0112580 | Ga0495643_0112580_44_694 | 214 |
| 384 | 3300048911 | Ga0496108_0334017 | Ga0496108_0334017_636_1280 | 214 |
| 385 | 3300049568 | Ga0501031_0122545 | Ga0501031_0122545_133_777 | 214 |
| 386 | 3300049572 | Ga0501036_0334203 | Ga0501036_0334203_610_1254 | 214 |
| 387 | 3300049574 | Ga0501038_0008445 | Ga0501038_0008445_3809_4453 | 214 |
| 388 | 3300049576 | Ga0501040_0009943 | Ga0501040_0009943_3608_4252 | 214 |
| 389 | 3300049577 | Ga0501041_0000704 | Ga0501041_0000704_2137_2781 | 214 |
| 390 | 3300049578 | Ga0501042_0120419 | Ga0501042_0120419_91_735 | 214 |
| 391 | 3300049579 | Ga0501043_0100361 | Ga0501043_0100361_552_1196 | 214 |
| 392 | 3300049580 | Ga0501046_0517164 | Ga0501046_0517164_135_779 | 214 |
| 393 | 3300049582 | Ga0501048_0002870 | Ga0501048_0002870_122_766 | 214 |
| 394 | 3300049587 | Ga0501071_0000259 | Ga0501071_0000259_19942_20586 | 214 |
| 395 | 3300049588 | Ga0501072_0009981 | Ga0501072_0009981_3984_4628 | 214 |
| 396 | 3300049589 | Ga0501073_0202314 | Ga0501073_0202314_18_662 | 214 |
| 397 | 3300049590 | Ga0501074_0025247 | Ga0501074_0025247_164_808 | 214 |
| 398 | 3300049591 | Ga0501075_0000327 | Ga0501075_0000327_7715_8359 | 214 |
| 399 | 3300049592 | Ga0501076_0000933 | Ga0501076_0000933_18273_18917 | 214 |
| 400 | 3300049593 | Ga0501077_0000838 | Ga0501077_0000838_6636_7280 | 214 |
| 401 | 3300049742 | Ga0501080_0056134 | Ga0501080_0056134_1085_1729 | 214 |
| 402 | 3300049743 | Ga0501081_0000101 | Ga0501081_0000101_24036_24680 | 214 |
| 403 | 3300049744 | Ga0501083_0087503 | Ga0501083_0087503_1378_2022 | 214 |
| 404 | 3300049822 | Ga0501035_0097677 | Ga0501035_0097677_968_1612 | 214 |
| 405 | 3300049824 | Ga0501045_0000042 | Ga0501045_0000042_31206_31850 | 214 |
| 406 | 3300053178 | Ga0500637_0008735 | Ga0500637_0008735_376_1020 | 214 |
| 407 | 3300060353 | Ga0501082_0002064 | Ga0501082_0002064_16871_17515 | 214 |
| 408 | 3300061734 | Ga0530510_0005036 | Ga0530510_0005036_8265_8909 | 214 |
| 409 | 3300003187 | JGI25151J46595_10001315 | JGI25151J46595_100013152 | 215 |
| 410 | 3300003187 | JGI25151J46595_10012244 | JGI25151J46595_100122442 | 215 |
| 411 | 3300003187 | JGI25151J46595_10033570 | JGI25151J46595_100335703 | 215 |
| 412 | 3300003187 | JGI25151J46595_10050360 | JGI25151J46595_100503602 | 215 |
| 413 | 3300003771 | Ga0055526_1006460 | Ga0055526_10064602 | 215 |
| 414 | 3300003771 | Ga0055526_1011270 | Ga0055526_10112704 | 215 |
| 415 | 3300003771 | Ga0055526_1011588 | Ga0055526_10115882 | 215 |
| 416 | 3300003773 | Ga0055537_1002374 | Ga0055537_10023742 | 215 |
| 417 | 3300003775 | Ga0055524_1002073 | Ga0055524_10020732 | 215 |
| 418 | 3300003775 | Ga0055524_1002149 | Ga0055524_10021499 | 215 |
| 419 | 3300003775 | Ga0055524_1005230 | Ga0055524_10052304 | 215 |
| 420 | 3300003781 | Ga0055536_1000134 | Ga0055536_100013440 | 215 |
| 421 | 3300003911 | JGI25405J52794_10026279 | JGI25405J52794_100262792 | 215 |
| 422 | 3300005331 | Ga0070670_100077817 | Ga0070670_1000778174 | 215 |
| 423 | 3300005333 | Ga0070677_10002180 | Ga0070677_100021804 | 215 |
| 424 | 3300005333 | Ga0070677_10009441 | Ga0070677_100094411 | 215 |
| 425 | 3300005333 | Ga0070677_10058777 | Ga0070677_100587772 | 215 |
| 426 | 3300005333 | Ga0070677_10079016 | Ga0070677_100790162 | 215 |
| 427 | 3300005334 | Ga0068869_100144889 | Ga0068869_1001448892 | 215 |
| 428 | 3300005334 | Ga0068869_100151206 | Ga0068869_1001512062 | 215 |
| 429 | 3300005335 | Ga0070666_10224387 | Ga0070666_102243871 | 215 |
| 430 | 3300005337 | Ga0070682_100050330 | Ga0070682_1000503302 | 215 |
| 431 | 3300005337 | Ga0070682_100087118 | Ga0070682_1000871182 | 215 |
| 432 | 3300005340 | Ga0070689_100009734 | Ga0070689_1000097344 | 215 |
| 433 | 3300005340 | Ga0070689_100237675 | Ga0070689_1002376752 | 215 |
| 434 | 3300005343 | Ga0070687_100227937 | Ga0070687_1002279372 | 215 |
| 435 | 3300005347 | Ga0070668_100125872 | Ga0070668_1001258722 | 215 |
| 436 | 3300005353 | Ga0070669_100036006 | Ga0070669_1000360062 | 215 |
| 437 | 3300005353 | Ga0070669_100155024 | Ga0070669_1001550242 | 215 |
| 438 | 3300005354 | Ga0070675_100036826 | Ga0070675_1000368265 | 215 |
| 439 | 3300005354 | Ga0070675_100173756 | Ga0070675_1001737562 | 215 |
| 440 | 3300005355 | Ga0070671_100017879 | Ga0070671_1000178792 | 215 |
| 441 | 3300005355 | Ga0070671_100160249 | Ga0070671_1001602492 | 215 |
| 442 | 3300005356 | Ga0070674_100601823 | Ga0070674_1006018231 | 215 |
| 443 | 3300005364 | Ga0070673_100037901 | Ga0070673_1000379012 | 215 |
| 444 | 3300005364 | Ga0070673_100076732 | Ga0070673_1000767323 | 215 |
| 445 | 3300005364 | Ga0070673_100258377 | Ga0070673_1002583772 | 215 |
| 446 | 3300005365 | Ga0070688_100013923 | Ga0070688_1000139234 | 215 |
| 447 | 3300005365 | Ga0070688_100169592 | Ga0070688_1001695921 | 215 |
| 448 | 3300005366 | Ga0070659_100510818 | Ga0070659_1005108182 | 215 |
| 449 | 3300005367 | Ga0070667_100003282 | Ga0070667_10000328210 | 215 |
| 450 | 3300005367 | Ga0070667_100437812 | Ga0070667_1004378121 | 215 |
| 451 | 3300005367 | Ga0070667_100562324 | Ga0070667_1005623241 | 215 |
| 452 | 3300005437 | Ga0070710_10077947 | Ga0070710_100779472 | 215 |
| 453 | 3300005438 | Ga0070701_10008786 | Ga0070701_100087863 | 215 |
| 454 | 3300005438 | Ga0070701_10327546 | Ga0070701_103275462 | 215 |
| 455 | 3300005440 | Ga0070705_100005227 | Ga0070705_1000052274 | 215 |
| 456 | 3300005441 | Ga0070700_100125901 | Ga0070700_1001259012 | 215 |
| 457 | 3300005444 | Ga0070694_100223654 | Ga0070694_1002236542 | 215 |
| 458 | 3300005455 | Ga0070663_100490115 | Ga0070663_1004901152 | 215 |
| 459 | 3300005456 | Ga0070678_100016367 | Ga0070678_1000163675 | 215 |
| 460 | 3300005456 | Ga0070678_100083737 | Ga0070678_1000837372 | 215 |
| 461 | 3300005457 | Ga0070662_100216883 | Ga0070662_1002168832 | 215 |
| 462 | 3300005459 | Ga0068867_100129759 | Ga0068867_1001297593 | 215 |
| 463 | 3300005459 | Ga0068867_100256625 | Ga0068867_1002566252 | 215 |
| 464 | 3300005466 | Ga0070685_10093852 | Ga0070685_100938521 | 215 |
| 465 | 3300005543 | Ga0070672_100011769 | Ga0070672_1000117694 | 215 |
| 466 | 3300005544 | Ga0070686_100116084 | Ga0070686_1001160842 | 215 |
| 467 | 3300005544 | Ga0070686_100229536 | Ga0070686_1002295362 | 215 |
| 468 | 3300005544 | Ga0070686_100317857 | Ga0070686_1003178572 | 215 |
| 469 | 3300005544 | Ga0070686_100570790 | Ga0070686_1005707901 | 215 |
| 470 | 3300005548 | Ga0070665_100009448 | Ga0070665_1000094483 | 215 |
| 471 | 3300005548 | Ga0070665_100078675 | Ga0070665_1000786752 | 215 |
| 472 | 3300005564 | Ga0070664_100493733 | Ga0070664_1004937332 | 215 |
| 473 | 3300005577 | Ga0068857_100545827 | Ga0068857_1005458272 | 215 |
| 474 | 3300005615 | Ga0070702_100003060 | Ga0070702_1000030603 | 215 |
| 475 | 3300005615 | Ga0070702_100197898 | Ga0070702_1001978982 | 215 |
| 476 | 3300005617 | Ga0068859_100023183 | Ga0068859_1000231834 | 215 |
| 477 | 3300005617 | Ga0068859_100078513 | Ga0068859_1000785132 | 215 |
| 478 | 3300005618 | Ga0068864_100130659 | Ga0068864_1001306592 | 215 |
| 479 | 3300005618 | Ga0068864_100223102 | Ga0068864_1002231022 | 215 |
| 480 | 3300005718 | Ga0068866_10121036 | Ga0068866_101210362 | 215 |
| 481 | 3300005719 | Ga0068861_100002771 | Ga0068861_1000027714 | 215 |
| 482 | 3300005719 | Ga0068861_100012331 | Ga0068861_1000123317 | 215 |
| 483 | 3300005719 | Ga0068861_100065622 | Ga0068861_1000656223 | 215 |
| 484 | 3300005719 | Ga0068861_100154388 | Ga0068861_1001543882 | 215 |
| 485 | 3300005840 | Ga0068870_10014301 | Ga0068870_100143012 | 215 |
| 486 | 3300005841 | Ga0068863_100026854 | Ga0068863_1000268546 | 215 |
| 487 | 3300005841 | Ga0068863_100027758 | Ga0068863_1000277584 | 215 |
| 488 | 3300005841 | Ga0068863_100148415 | Ga0068863_1001484152 | 215 |
| 489 | 3300005841 | Ga0068863_100172003 | Ga0068863_1001720032 | 215 |
| 490 | 3300005842 | Ga0068858_100059603 | Ga0068858_1000596033 | 215 |
| 491 | 3300005843 | Ga0068860_100082498 | Ga0068860_1000824983 | 215 |
| 492 | 3300005843 | Ga0068860_100176046 | Ga0068860_1001760462 | 215 |
| 493 | 3300005844 | Ga0068862_100017956 | Ga0068862_1000179564 | 215 |
| 494 | 3300005844 | Ga0068862_100037840 | Ga0068862_1000378405 | 215 |
| 495 | 3300005937 | Ga0081455_10003238 | Ga0081455_100032383 | 215 |
| 496 | 3300006163 | Ga0070715_10018837 | Ga0070715_100188373 | 215 |
| 497 | 3300006237 | Ga0097621_100044687 | Ga0097621_1000446874 | 215 |
| 498 | 3300006237 | Ga0097621_100111737 | Ga0097621_1001117372 | 215 |
| 499 | 3300006237 | Ga0097621_100211831 | Ga0097621_1002118312 | 215 |
| 500 | 3300006237 | Ga0097621_100303561 | Ga0097621_1003035612 | 215 |
| 501 | 3300006358 | Ga0068871_100139323 | Ga0068871_1001393233 | 215 |
| 502 | 3300006358 | Ga0068871_100182191 | Ga0068871_1001821912 | 215 |
| 503 | 3300006881 | Ga0068865_100118688 | Ga0068865_1001186883 | 215 |
| 504 | 3300006931 | Ga0097620_100023183 | Ga0097620_1000231834 | 215 |
| 505 | 3300006931 | Ga0097620_100078513 | Ga0097620_1000785134 | 215 |
| 506 | 3300009092 | Ga0105250_10165335 | Ga0105250_101653352 | 215 |
| 507 | 3300009094 | Ga0111539_10090632 | Ga0111539_100906322 | 215 |
| 508 | 3300009148 | Ga0105243_10075987 | Ga0105243_100759873 | 215 |
| 509 | 3300009176 | Ga0105242_10110763 | Ga0105242_101107633 | 215 |
| 510 | 3300009177 | Ga0105248_10125024 | Ga0105248_101250245 | 215 |
| 511 | 3300009177 | Ga0105248_10143254 | Ga0105248_101432542 | 215 |
| 512 | 3300009553 | Ga0105249_10081128 | Ga0105249_100811282 | 215 |
| 513 | 3300009553 | Ga0105249_10150774 | Ga0105249_101507742 | 215 |
| 514 | 3300009553 | Ga0105249_10697664 | Ga0105249_106976642 | 215 |
| 515 | 3300013296 | Ga0157374_10354885 | Ga0157374_103548852 | 215 |
| 516 | 3300013306 | Ga0163162_10036725 | Ga0163162_100367252 | 215 |
| 517 | 3300014325 | Ga0163163_10111580 | Ga0163163_101115803 | 215 |
| 518 | 3300014325 | Ga0163163_10509312 | Ga0163163_105093122 | 215 |
| 519 | 3300014326 | Ga0157380_10014739 | Ga0157380_100147394 | 215 |
| 520 | 3300014326 | Ga0157380_10118101 | Ga0157380_101181012 | 215 |
| 521 | 3300014326 | Ga0157380_10390186 | Ga0157380_103901862 | 215 |
| 522 | 3300014326 | Ga0157380_10444257 | Ga0157380_104442572 | 215 |
| 523 | 3300014745 | Ga0157377_10184960 | Ga0157377_101849602 | 215 |
| 524 | 3300014969 | Ga0157376_10036462 | Ga0157376_100364622 | 215 |
| 525 | 3300017792 | Ga0163161_10066534 | Ga0163161_100665342 | 215 |
| 526 | 3300025263 | Ga0209565_1000104 | Ga0209565_100010430 | 215 |
| 527 | 3300025263 | Ga0209565_1012602 | Ga0209565_10126022 | 215 |
| 528 | 3300025273 | Ga0209673_1050262 | Ga0209673_10502622 | 215 |
| 529 | 3300025291 | Ga0209675_1000191 | Ga0209675_10001916 | 215 |
| 530 | 3300025291 | Ga0209675_1002151 | Ga0209675_10021515 | 215 |
| 531 | 3300025292 | Ga0209676_1000036 | Ga0209676_1000036400 | 215 |
| 532 | 3300025294 | Ga0209025_1000618 | Ga0209025_100061857 | 215 |
| 533 | 3300025294 | Ga0209025_1000905 | Ga0209025_100090544 | 215 |
| 534 | 3300025294 | Ga0209025_1001806 | Ga0209025_100180613 | 215 |
| 535 | 3300025294 | Ga0209025_1002048 | Ga0209025_10020486 | 215 |
| 536 | 3300025294 | Ga0209025_1032618 | Ga0209025_10326182 | 215 |
| 537 | 3300025295 | Ga0209564_1000688 | Ga0209564_10006886 | 215 |
| 538 | 3300025295 | Ga0209564_1002275 | Ga0209564_10022759 | 215 |
| 539 | 3300025295 | Ga0209564_1004020 | Ga0209564_10040202 | 215 |
| 540 | 3300025299 | Ga0209256_1001092 | Ga0209256_10010926 | 215 |
| 541 | 3300025299 | Ga0209256_1001334 | Ga0209256_100133429 | 215 |
| 542 | 3300025303 | Ga0209051_1034250 | Ga0209051_10342502 | 215 |
| 543 | 3300025315 | Ga0207697_10044152 | Ga0207697_100441522 | 215 |
| 544 | 3300025893 | Ga0207682_10016438 | Ga0207682_100164383 | 215 |
| 545 | 3300025898 | Ga0207692_10034308 | Ga0207692_100343083 | 215 |
| 546 | 3300025899 | Ga0207642_10010527 | Ga0207642_100105274 | 215 |
| 547 | 3300025900 | Ga0207710_10065772 | Ga0207710_100657722 | 215 |
| 548 | 3300025905 | Ga0207685_10034844 | Ga0207685_100348443 | 215 |
| 549 | 3300025907 | Ga0207645_10075149 | Ga0207645_100751492 | 215 |
| 550 | 3300025907 | Ga0207645_10196479 | Ga0207645_101964792 | 215 |
| 551 | 3300025908 | Ga0207643_10006811 | Ga0207643_100068112 | 215 |
| 552 | 3300025908 | Ga0207643_10224950 | Ga0207643_102249502 | 215 |
| 553 | 3300025909 | Ga0207705_10395394 | Ga0207705_103953942 | 215 |
| 554 | 3300025916 | Ga0207663_10170254 | Ga0207663_101702542 | 215 |
| 555 | 3300025923 | Ga0207681_10038443 | Ga0207681_100384434 | 215 |
| 556 | 3300025925 | Ga0207650_10092759 | Ga0207650_100927592 | 215 |
| 557 | 3300025925 | Ga0207650_10110545 | Ga0207650_101105452 | 215 |
| 558 | 3300025926 | Ga0207659_10142081 | Ga0207659_101420812 | 215 |
| 559 | 3300025931 | Ga0207644_10025817 | Ga0207644_100258176 | 215 |
| 560 | 3300025932 | Ga0207690_10422637 | Ga0207690_104226372 | 215 |
| 561 | 3300025933 | Ga0207706_10159377 | Ga0207706_101593772 | 215 |
| 562 | 3300025933 | Ga0207706_10278766 | Ga0207706_102787662 | 215 |
| 563 | 3300025934 | Ga0207686_10144954 | Ga0207686_101449542 | 215 |
| 564 | 3300025936 | Ga0207670_10007762 | Ga0207670_100077623 | 215 |
| 565 | 3300025936 | Ga0207670_10127680 | Ga0207670_101276802 | 215 |
| 566 | 3300025937 | Ga0207669_10036486 | Ga0207669_100364862 | 215 |
| 567 | 3300025937 | Ga0207669_10474145 | Ga0207669_104741452 | 215 |
| 568 | 3300025938 | Ga0207704_10087298 | Ga0207704_100872983 | 215 |
| 569 | 3300025938 | Ga0207704_10168775 | Ga0207704_101687753 | 215 |
| 570 | 3300025940 | Ga0207691_10054210 | Ga0207691_100542102 | 215 |
| 571 | 3300025940 | Ga0207691_10076499 | Ga0207691_100764992 | 215 |
| 572 | 3300025941 | Ga0207711_10259202 | Ga0207711_102592021 | 215 |
| 573 | 3300025941 | Ga0207711_10547107 | Ga0207711_105471072 | 215 |
| 574 | 3300025942 | Ga0207689_10016545 | Ga0207689_100165454 | 215 |
| 575 | 3300025942 | Ga0207689_10057396 | Ga0207689_100573962 | 215 |
| 576 | 3300025942 | Ga0207689_10097032 | Ga0207689_100970322 | 215 |
| 577 | 3300025945 | Ga0207679_10171546 | Ga0207679_101715462 | 215 |
| 578 | 3300025945 | Ga0207679_10354027 | Ga0207679_103540272 | 215 |
| 579 | 3300025945 | Ga0207679_10461742 | Ga0207679_104617422 | 215 |
| 580 | 3300025960 | Ga0207651_10048287 | Ga0207651_100482873 | 215 |
| 581 | 3300025960 | Ga0207651_10055295 | Ga0207651_100552952 | 215 |
| 582 | 3300025960 | Ga0207651_10416899 | Ga0207651_104168991 | 215 |
| 583 | 3300025961 | Ga0207712_10160789 | Ga0207712_101607891 | 215 |
| 584 | 3300025961 | Ga0207712_10346706 | Ga0207712_103467062 | 215 |
| 585 | 3300025961 | Ga0207712_10358595 | Ga0207712_103585952 | 215 |
| 586 | 3300025972 | Ga0207668_10370625 | Ga0207668_103706252 | 215 |
| 587 | 3300025981 | Ga0207640_10252927 | Ga0207640_102529272 | 215 |
| 588 | 3300025986 | Ga0207658_10020449 | Ga0207658_100204492 | 215 |
| 589 | 3300025986 | Ga0207658_10441742 | Ga0207658_104417421 | 215 |
| 590 | 3300026035 | Ga0207703_10050354 | Ga0207703_100503543 | 215 |
| 591 | 3300026067 | Ga0207678_10693110 | Ga0207678_106931101 | 215 |
| 592 | 3300026075 | Ga0207708_10124925 | Ga0207708_101249252 | 215 |
| 593 | 3300026075 | Ga0207708_10550955 | Ga0207708_105509552 | 215 |
| 594 | 3300026075 | Ga0207708_10868864 | Ga0207708_108688641 | 215 |
| 595 | 3300026088 | Ga0207641_10011553 | Ga0207641_100115534 | 215 |
| 596 | 3300026088 | Ga0207641_10023632 | Ga0207641_100236326 | 215 |
| 597 | 3300026088 | Ga0207641_10177959 | Ga0207641_101779592 | 215 |
| 598 | 3300026088 | Ga0207641_10246056 | Ga0207641_102460562 | 215 |
| 599 | 3300026089 | Ga0207648_10018789 | Ga0207648_100187894 | 215 |
| 600 | 3300026089 | Ga0207648_10166894 | Ga0207648_101668942 | 215 |
| 601 | 3300026089 | Ga0207648_10241358 | Ga0207648_102413582 | 215 |
| 602 | 3300026095 | Ga0207676_10080152 | Ga0207676_100801524 | 215 |
| 603 | 3300026095 | Ga0207676_10382768 | Ga0207676_103827682 | 215 |
| 604 | 3300026118 | Ga0207675_100006319 | Ga0207675_1000063194 | 215 |
| 605 | 3300026118 | Ga0207675_100017126 | Ga0207675_1000171263 | 215 |
| 606 | 3300026118 | Ga0207675_100056849 | Ga0207675_1000568492 | 215 |
| 607 | 3300026118 | Ga0207675_100131421 | Ga0207675_1001314213 | 215 |
| 608 | 3300026118 | Ga0207675_100149764 | Ga0207675_1001497643 | 215 |
| 609 | 3300026118 | Ga0207675_100778927 | Ga0207675_1007789272 | 215 |
| 610 | 3300026121 | Ga0207683_10028026 | Ga0207683_100280263 | 215 |
| 611 | 3300026121 | Ga0207683_10130754 | Ga0207683_101307542 | 215 |
| 612 | 3300026121 | Ga0207683_10201019 | Ga0207683_102010192 | 215 |
| 613 | 3300028379 | Ga0268266_10012248 | Ga0268266_100122487 | 215 |
| 614 | 3300028379 | Ga0268266_10039459 | Ga0268266_100394597 | 215 |
| 615 | 3300028379 | Ga0268266_10390497 | Ga0268266_103904972 | 215 |
| 616 | 3300028380 | Ga0268265_10031142 | Ga0268265_100311423 | 215 |
| 617 | 3300028380 | Ga0268265_10233499 | Ga0268265_102334992 | 215 |
| 618 | 3300028380 | Ga0268265_10289589 | Ga0268265_102895892 | 215 |
| 619 | 3300028381 | Ga0268264_10143108 | Ga0268264_101431083 | 215 |
| 620 | 3300028794 | Ga0307515_10237944 | Ga0307515_102379442 | 215 |
| 621 | 3300031456 | Ga0307513_10007003 | Ga0307513_1000700312 | 215 |
| 622 | 3300031456 | Ga0307513_10016636 | Ga0307513_100166369 | 215 |
| 623 | 3300031456 | Ga0307513_10023455 | Ga0307513_100234553 | 215 |
| 624 | 3300031456 | Ga0307513_10030889 | Ga0307513_100308894 | 215 |
| 625 | 3300031456 | Ga0307513_10036720 | Ga0307513_100367202 | 215 |
| 626 | 3300031456 | Ga0307513_10073099 | Ga0307513_100730992 | 215 |
| 627 | 3300031548 | Ga0307408_100155137 | Ga0307408_1001551373 | 215 |
| 628 | 3300031731 | Ga0307405_10078596 | Ga0307405_100785962 | 215 |
| 629 | 3300031731 | Ga0307405_10200097 | Ga0307405_102000972 | 215 |
| 630 | 3300031824 | Ga0307413_10014725 | Ga0307413_100147254 | 215 |
| 631 | 3300031852 | Ga0307410_10003532 | Ga0307410_100035322 | 215 |
| 632 | 3300031852 | Ga0307410_10013410 | Ga0307410_100134106 | 215 |
| 633 | 3300031901 | Ga0307406_10082392 | Ga0307406_100823922 | 215 |
| 634 | 3300031903 | Ga0307407_10099371 | Ga0307407_100993712 | 215 |
| 635 | 3300031903 | Ga0307407_10132987 | Ga0307407_101329872 | 215 |
| 636 | 3300031911 | Ga0307412_10370919 | Ga0307412_103709192 | 215 |
| 637 | 3300031911 | Ga0307412_10398067 | Ga0307412_103980672 | 215 |
| 638 | 3300031995 | Ga0307409_100008635 | Ga0307409_1000086354 | 215 |
| 639 | 3300031995 | Ga0307409_100009145 | Ga0307409_1000091454 | 215 |
| 640 | 3300032002 | Ga0307416_100099966 | Ga0307416_1000999662 | 215 |
| 641 | 3300032002 | Ga0307416_100190129 | Ga0307416_1001901292 | 215 |
| 642 | 3300032126 | Ga0307415_100020507 | Ga0307415_1000205072 | 215 |
| 643 | 3300032126 | Ga0307415_100090152 | Ga0307415_1000901523 | 215 |
| 644 | 3300035724 | Ga0373933_0427957 | Ga0373933_0427957_105_755 | 215 |
| 645 | 3300036401 | Ga0373937_0624721 | Ga0373937_0624721_160_810 | 215 |
| 646 | 3300037471 | Ga0395905_0441951 | Ga0395905_0441951_311_958 | 215 |
| 647 | 3300041443 | Ga0451789_1317359 | Ga0451789_1317359_256_906 | 215 |
| 648 | 3300041452 | Ga0451793_0765724 | Ga0451793_0765724_394_1044 | 215 |
| 649 | 3300041459 | Ga0451800_0302824 | Ga0451800_0302824_1487_2137 | 215 |
| 650 | 3300041463 | Ga0451804_0147506 | Ga0451804_0147506_514_1164 | 215 |
| 651 | 3300041486 | Ga0451807_0481750 | Ga0451807_0481750_1112_1762 | 215 |
| 652 | 3300041486 | Ga0451807_1209868 | Ga0451807_1209868_504_1154 | 215 |
| 653 | 3300041486 | Ga0451807_2367067 | Ga0451807_2367067_275_925 | 215 |
| 654 | 3300041494 | Ga0451837_0927674 | Ga0451837_0927674_77_727 | 215 |
| 655 | 3300046457 | Ga0495590_0001681 | Ga0495590_0001681_1691_2344 | 215 |
| 656 | 3300046457 | Ga0495590_0048960 | Ga0495590_0048960_424_1074 | 215 |
| 657 | 3300046460 | Ga0495638_0004727 | Ga0495638_0004727_2417_3067 | 215 |
| 658 | 3300046507 | Ga0495606_0066692 | Ga0495606_0066692_1303_1956 | 215 |
| 659 | 3300046519 | Ga0495632_0067881 | Ga0495632_0067881_195_845 | 215 |
| 660 | 3300046615 | Ga0495656_0160986 | Ga0495656_0160986_121_771 | 215 |
| 661 | 3300046616 | Ga0495668_0147327 | Ga0495668_0147327_618_1268 | 215 |
| 662 | 3300046660 | Ga0495625_0022933 | Ga0495625_0022933_1387_2037 | 215 |
| 663 | 3300046660 | Ga0495625_0051195 | Ga0495625_0051195_497_1147 | 215 |
| 664 | 3300047318 | Ga0495636_0005139 | Ga0495636_0005139_2450_3097 | 215 |
| 665 | 3300047320 | Ga0495672_0178348 | Ga0495672_0178348_176_826 | 215 |
| 666 | 3300048091 | Ga0495626_0097306 | Ga0495626_0097306_30_680 | 215 |
| 667 | 3300048907 | Ga0496104_0169197 | Ga0496104_0169197_98_745 | 215 |
| 668 | 3300048915 | Ga0496112_0027994 | Ga0496112_0027994_4037_4684 | 215 |
| 669 | 3300048917 | Ga0496114_0025835 | Ga0496114_0025835_2904_3554 | 215 |
| 670 | 3300048924 | Ga0496121_0027863 | Ga0496121_0027863_839_1486 | 215 |
| 671 | 3300048928 | Ga0496125_0005695 | Ga0496125_0005695_2569_3216 | 215 |
| 672 | 3300049571 | Ga0501034_0000092 | Ga0501034_0000092_125676_126323 | 215 |
| 673 | 3300049572 | Ga0501036_0278548 | Ga0501036_0278548_149_799 | 215 |
| 674 | 3300049572 | Ga0501036_0363289 | Ga0501036_0363289_527_1177 | 215 |
| 675 | 3300049576 | Ga0501040_0509334 | Ga0501040_0509334_96_746 | 215 |
| 676 | 3300049587 | Ga0501071_0036445 | Ga0501071_0036445_2211_2861 | 215 |
| 677 | 3300049588 | Ga0501072_0695727 | Ga0501072_0695727_24_674 | 215 |
| 678 | 3300049589 | Ga0501073_0009721 | Ga0501073_0009721_1384_2034 | 215 |
| 679 | 3300049593 | Ga0501077_0004615 | Ga0501077_0004615_55_705 | 215 |
| 680 | 3300049742 | Ga0501080_0061373 | Ga0501080_0061373_2106_2756 | 215 |
| 681 | 3300049744 | Ga0501083_0013202 | Ga0501083_0013202_19_669 | 215 |
| 682 | 3300050511 | nmdc:mga08y16_114907_c1 | nmdc:mga08y16_114907_c1_1388_2038 | 215 |
| 683 | 3300054114 | Ga0501084_0009092 | Ga0501084_0009092_1621_2271 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.964 | 3 | 215 |
| 2cz3-assembly1.cif.gz_A | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) | 0.963 | 2 | 215 |
| 3niv-assembly1.cif.gz_A | the crystal structure of glutathione s-transferase from legionella pneumophila | 0.96 | 4 | 208 |
| 8e8p-assembly1.cif.gz_B | gstz1a | 0.9592 | 1 | 215 |
| 2cz2-assembly1.cif.gz_A-2 | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) | 0.9584 | 2 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kaeA02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9654 | 86 | 215 | 1.20.1050.10 |
| 2v6kB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.962 | 86 | 215 | 1.20.1050.10 |
| 6jwkA02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9619 | 86 | 215 | 1.20.1050.10 |
| af_Q6DGL3_95_220_1.20.1050.10 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9604 | 86 | 215 | 1.20.1050.10 |
| 2cz3A02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9582 | 86 | 215 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3ZLJ3-F1-model_v4 | Maleylacetoacetate isomerase | 0.9805 | 3 | 215 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A7V7KHR4-F1-model_v4 | Maleylacetoacetate isomerase (EC 5.2.1.2) | 0.9791 | 3 | 211 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A4R6F2N1-F1-model_v4 | Maleylacetoacetate isomerase | 0.9772 | 2 | 215 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A7T8B6B4-F1-model_v4 | deleted | 0.9772 | 2 | 215 |
|
| AF-A0A0P7XB45-F1-model_v4 | Maleylacetoacetate isomerase Mai | 0.9764 | 3 | 215 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar