F475015

General Info

Members Datasets Scaffolds Average Seq Length
683 359 659 214

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_183752_c1|nmdc:mga0k408_183752_c1_409_1155
Length 248
Sequence MAEKVLSSESGSLPEGAGRRRAFGPAGGAGAMLGAMMKLYNYFRSSASFRVRIALNLKGLDYDYLPVHIARGEHKTGSFSAISPDMLVPLLEDDGERFTQSMAIIEYLDEIHPEPALLPHDPVGRAHVRALAQSVACEIHPLNNLRVLKYLVRELKLSDDAKNTWYRHWVREGMLAFERQLALRPASLYCWGDAPTLADCCLVPQVFNGQRFDCDFSGLPRTMAAFEACMQLDAFQRAQPSRCPDAEP

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
5 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
6 2643221672 Variovorax sp. Root434 Isolate Unclassified
7 2643221718 Rhizobium sp. Root268 Isolate Unclassified
8 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
9 2842677519 Variovorax sp. R-72495 Isolate Unclassified
10 2842733646 Variovorax sp. R-72446 Isolate Unclassified
11 2842747753 Variovorax sp. R-72060 Isolate Unclassified
12 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
13 2885198086 Variovorax sp. 679 Isolate Unclassified
14 2885211737 Variovorax sp. 553 Isolate Unclassified
15 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
16 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
17 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
18 2904456579 Variovorax sp. 2002 Isolate Unclassified
19 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
20 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
21 2929520902 Variovorax beijingensis 502 Isolate Unclassified
22 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
192 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
193 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
194 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
195 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
218 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
223 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
224 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
229 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
230 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
234 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
235 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
236 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
240 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
243 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
244 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
245 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
246 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
247 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
291 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
314 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
336 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
354 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
358 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
359 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 0
Isolates 3.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.86
Nodule 1.32
Rhizoplane 3.81
Rhizosphere 74.82
Stem 0
Stem Tuber 0
Unclassified 8.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001315 3300003187 Bacteria 17394
2 JGI25151J46595_10012244 3300003187 Bacteria 3907
3 JGI25151J46595_10033570 3300003187 Bacteria 1975
4 JGI25151J46595_10050360 3300003187 Bacteria 1419
5 rootH1_10133818 3300003316 Bacteria 3397
6 Ga0055526_1006460 3300003771 Bacteria 6356
7 Ga0055526_1011270 3300003771 Bacteria 4050
8 Ga0055526_1011588 3300003771 Bacteria 3952
9 Ga0055537_1000195 3300003773 Bacteria 45368
10 Ga0055537_1002374 3300003773 Bacteria 6371
11 Ga0055524_1002073 3300003775 Bacteria 10626
12 Ga0055524_1002149 3300003775 Bacteria 10369
13 Ga0055524_1005230 3300003775 Bacteria 5834
14 Ga0055536_1000134 3300003781 Bacteria 63257
15 Ga0055536_1010988 3300003781 Bacteria 3525
16 Ga0055534_1000262 3300003784 Bacteria 36545
17 Ga0055534_1000285 3300003784 Bacteria 34241
18 Ga0055528_1000371 3300003790 Bacteria 36548
19 Ga0055530_10021246 3300003791 Bacteria 1918
20 Ga0055540_1000978 3300003792 Bacteria 18452
21 Ga0055540_1009078 3300003792 Bacteria 3489
22 Ga0055531_10014414 3300003794 Bacteria 3558
23 JGI25405J52794_10026279 3300003911 Bacteria 1195
24 Ga0065714_10005960 3300005288 Bacteria 3764
25 Ga0065704_10129945 3300005289 Bacteria 1642
26 Ga0070676_10104250 3300005328 Bacteria 1757
27 Ga0070670_100077817 3300005331 Bacteria 2849
28 Ga0070677_10002180 3300005333 Bacteria 6262
29 Ga0070677_10009441 3300005333 Bacteria 3306
30 Ga0070677_10058777 3300005333 Bacteria 1580
31 Ga0070677_10079016 3300005333 Bacteria 1403
32 Ga0068869_100144889 3300005334 Bacteria 1837
33 Ga0068869_100151206 3300005334 Bacteria 1801
34 Ga0070666_10006152 3300005335 Bacteria 7379
35 Ga0070666_10078043 3300005335 Bacteria 2260
36 Ga0070666_10224387 3300005335 Bacteria 1326
37 Ga0070666_10409168 3300005335 Bacteria 976
38 Ga0070682_100050330 3300005337 Bacteria 2601
39 Ga0070682_100087118 3300005337 Bacteria 2035
40 Ga0070689_100009734 3300005340 Bacteria 6824
41 Ga0070689_100237675 3300005340 Bacteria 1499
42 Ga0070687_100227937 3300005343 Bacteria 1145
43 Ga0070661_100526644 3300005344 Bacteria 948
44 Ga0070668_100004659 3300005347 Bacteria 10158
45 Ga0070668_100125872 3300005347 Bacteria 2052
46 Ga0070669_100009237 3300005353 Bacteria 7024
47 Ga0070669_100036006 3300005353 Bacteria 3586
48 Ga0070669_100155024 3300005353 Bacteria 1775
49 Ga0070675_100036826 3300005354 Bacteria 3983
50 Ga0070675_100173756 3300005354 Bacteria 1859
51 Ga0070671_100017879 3300005355 Bacteria 5748
52 Ga0070671_100160249 3300005355 Bacteria 1902
53 Ga0070674_100062415 3300005356 Bacteria 2604
54 Ga0070674_100091192 3300005356 Bacteria 2200
55 Ga0070674_100601823 3300005356 Bacteria 929
56 Ga0070673_100037901 3300005364 Bacteria 3677
57 Ga0070673_100076732 3300005364 Bacteria 2699
58 Ga0070673_100192846 3300005364 Bacteria 1751
59 Ga0070673_100258377 3300005364 Bacteria 1521
60 Ga0070673_100622395 3300005364 Bacteria 986
61 Ga0070688_100013923 3300005365 Bacteria 4549
62 Ga0070688_100169592 3300005365 Bacteria 1505
63 Ga0070659_100510818 3300005366 Bacteria 1025
64 Ga0070667_100003282 3300005367 Bacteria 13817
65 Ga0070667_100017213 3300005367 Bacteria 5987
66 Ga0070667_100049979 3300005367 Bacteria 3523
67 Ga0070667_100106012 3300005367 Bacteria 2433
68 Ga0070667_100437812 3300005367 Bacteria 1193
69 Ga0070667_100562324 3300005367 Bacteria 1049
70 Ga0070710_10077947 3300005437 Bacteria 1927
71 Ga0070701_10008786 3300005438 Bacteria 4389
72 Ga0070701_10327546 3300005438 Bacteria 950
73 Ga0070705_100005227 3300005440 Bacteria 6304
74 Ga0070700_100125901 3300005441 Bacteria 1723
75 Ga0070694_100223654 3300005444 Bacteria 1413
76 Ga0070663_100490115 3300005455 Bacteria 1019
77 Ga0070678_100003377 3300005456 Bacteria 8899
78 Ga0070678_100016367 3300005456 Bacteria 4743
79 Ga0070678_100083737 3300005456 Bacteria 2425
80 Ga0070662_100216883 3300005457 Bacteria 1525
81 Ga0068867_100023257 3300005459 Bacteria 4437
82 Ga0068867_100129759 3300005459 Bacteria 1958
83 Ga0068867_100256625 3300005459 Bacteria 1423
84 Ga0070685_10093852 3300005466 Bacteria 1821
85 Ga0070685_10245336 3300005466 Bacteria 1184
86 Ga0070679_100154181 3300005530 Bacteria 2273
87 Ga0070672_100011769 3300005543 Bacteria 6113
88 Ga0070672_100507585 3300005543 Bacteria 1044
89 Ga0070672_100584024 3300005543 Bacteria 972
90 Ga0070686_100116084 3300005544 Bacteria 1831
91 Ga0070686_100229536 3300005544 Bacteria 1346
92 Ga0070686_100317857 3300005544 Bacteria 1160
93 Ga0070686_100570790 3300005544 Bacteria 887
94 Ga0070665_100000424 3300005548 Bacteria 61687
95 Ga0070665_100003568 3300005548 Bacteria 16494
96 Ga0070665_100009448 3300005548 Bacteria 9867
97 Ga0070665_100047472 3300005548 Bacteria 4310
98 Ga0070665_100078675 3300005548 Bacteria 3304
99 Ga0070665_100194799 3300005548 Bacteria 2027
100 Ga0070665_100483920 3300005548 Bacteria 1248
101 Ga0068855_100084349 3300005563 Bacteria 3679
102 Ga0070664_100048248 3300005564 Bacteria 3599
103 Ga0070664_100493733 3300005564 Bacteria 1128
104 Ga0068857_100310600 3300005577 Bacteria 1454
105 Ga0068857_100402912 3300005577 Bacteria 1273
106 Ga0068857_100545827 3300005577 Bacteria 1091
107 Ga0070702_100003060 3300005615 Bacteria 7398
108 Ga0070702_100197898 3300005615 Bacteria 1328
109 Ga0068852_100523227 3300005616 Bacteria 1184
110 Ga0068859_100023183 3300005617 Bacteria 6228
111 Ga0068859_100033938 3300005617 Bacteria 5123
112 Ga0068859_100078513 3300005617 Bacteria 3341
113 Ga0068864_100130659 3300005618 Bacteria 2255
114 Ga0068864_100223102 3300005618 Bacteria 1740
115 Ga0068866_10121036 3300005718 Bacteria 1475
116 Ga0068861_100002771 3300005719 Bacteria 11498
117 Ga0068861_100012331 3300005719 Bacteria 5960
118 Ga0068861_100065622 3300005719 Bacteria 2796
119 Ga0068861_100154388 3300005719 Bacteria 1887
120 Ga0068861_100348483 3300005719 Bacteria 1298
121 Ga0068851_10153906 3300005834 Bacteria 1259
122 Ga0068870_10014301 3300005840 Bacteria 3747
123 Ga0068863_100001655 3300005841 Bacteria 22045
124 Ga0068863_100026854 3300005841 Bacteria 5491
125 Ga0068863_100027758 3300005841 Bacteria 5402
126 Ga0068863_100148415 3300005841 Bacteria 2243
127 Ga0068863_100172003 3300005841 Bacteria 2078
128 Ga0068858_100059603 3300005842 Bacteria 3528
129 Ga0068858_100358334 3300005842 Bacteria 1398
130 Ga0068860_100000352 3300005843 Bacteria 61812
131 Ga0068860_100082498 3300005843 Bacteria 3057
132 Ga0068860_100176046 3300005843 Bacteria 2068
133 Ga0068862_100017956 3300005844 Bacteria 5892
134 Ga0068862_100037840 3300005844 Bacteria 4091
135 Ga0081455_10003238 3300005937 Bacteria 18862
136 Ga0075365_10221394 3300006038 Bacteria 1328
137 Ga0075363_100006796 3300006048 Bacteria 5226
138 Ga0075363_100023822 3300006048 Bacteria 3107
139 Ga0075363_100058517 3300006048 Bacteria 2070
140 Ga0075364_10010551 3300006051 Bacteria 5585
141 Ga0075364_10321472 3300006051 Bacteria 1054
142 Ga0075432_10044328 3300006058 Bacteria 1560
143 Ga0070715_10018837 3300006163 Bacteria 2638
144 Ga0075367_10292080 3300006178 Bacteria 1026
145 Ga0075366_10087248 3300006195 Bacteria 1867
146 Ga0097621_100044687 3300006237 Bacteria 3574
147 Ga0097621_100092510 3300006237 Bacteria 2533
148 Ga0097621_100111737 3300006237 Bacteria 2309
149 Ga0097621_100211831 3300006237 Bacteria 1686
150 Ga0097621_100266208 3300006237 Bacteria 1505
151 Ga0097621_100303561 3300006237 Bacteria 1411
152 Ga0097621_100588641 3300006237 Bacteria 1016
153 Ga0075370_10003659 3300006353 Bacteria 7359
154 Ga0075370_10009760 3300006353 Bacteria 4998
155 Ga0075370_10011926 3300006353 Bacteria 4579
156 Ga0075370_10045441 3300006353 Bacteria 2484
157 Ga0075370_10081888 3300006353 Bacteria 1855
158 Ga0068871_100139323 3300006358 Bacteria 2062
159 Ga0068871_100182191 3300006358 Bacteria 1805
160 Ga0068871_100375580 3300006358 Bacteria 1262
161 Ga0068871_100496360 3300006358 Bacteria 1100
162 Ga0068865_100118688 3300006881 Bacteria 1963
163 Ga0068865_100509152 3300006881 Bacteria 1005
164 Ga0097620_100023183 3300006931 Bacteria 6228
165 Ga0097620_100078513 3300006931 Bacteria 3341
166 Ga0079104_1024276 3300006946 Bacteria 1599
167 Ga0099826_10000007 3300006948 Bacteria 393518
168 Ga0099826_10011566 3300006948 Bacteria 6640
169 Ga0099826_10148051 3300006948 Bacteria 1347
170 Ga0105251_10001536 3300009011 Bacteria 19805
171 Ga0105251_10010075 3300009011 Bacteria 5517
172 Ga0105244_10001232 3300009036 Bacteria 21006
173 Ga0105250_10165335 3300009092 Bacteria 925
174 Ga0105240_10010103 3300009093 Bacteria 13283
175 Ga0105240_10096110 3300009093 Bacteria 3611
176 Ga0105240_10334637 3300009093 Bacteria 1722
177 Ga0111539_10090632 3300009094 Bacteria 3593
178 Ga0105243_10002672 3300009148 Bacteria 14814
179 Ga0105243_10045322 3300009148 Bacteria 3455
180 Ga0105243_10075987 3300009148 Bacteria 2728
181 Ga0105241_10002121 3300009174 Bacteria 14994
182 Ga0105242_10110763 3300009176 Bacteria 2340
183 Ga0105242_10488428 3300009176 Bacteria 1169
184 Ga0105248_10067276 3300009177 Bacteria 4022
185 Ga0105248_10125024 3300009177 Bacteria 2901
186 Ga0105248_10143254 3300009177 Bacteria 2697
187 Ga0105237_10082802 3300009545 Bacteria 3200
188 Ga0105237_10255457 3300009545 Bacteria 1755
189 Ga0105237_10571375 3300009545 Bacteria 1137
190 Ga0105237_10693194 3300009545 Bacteria 1025
191 Ga0105249_10040032 3300009553 Bacteria 4257
192 Ga0105249_10081128 3300009553 Bacteria 3015
193 Ga0105249_10150774 3300009553 Bacteria 2238
194 Ga0105249_10169344 3300009553 Bacteria 2117
195 Ga0105249_10697664 3300009553 Bacteria 1075
196 Ga0105239_10243310 3300010375 Bacteria 2019
197 Ga0105246_10049393 3300011119 Bacteria 2881
198 Ga0105246_10410322 3300011119 Bacteria 1127
199 Ga0157373_10001598 3300013100 Bacteria 17300
200 Ga0157370_10389316 3300013104 Bacteria 1283
201 Ga0157369_10380620 3300013105 Bacteria 1465
202 Ga0157374_10156336 3300013296 Bacteria 2219
203 Ga0157374_10354885 3300013296 Bacteria 1457
204 Ga0163162_10036725 3300013306 Bacteria 4885
205 Ga0157375_10002431 3300013308 Bacteria 16131
206 Ga0157375_10135565 3300013308 Bacteria 2585
207 Ga0163163_10111580 3300014325 Bacteria 2763
208 Ga0163163_10509312 3300014325 Bacteria 1266
209 Ga0157380_10014739 3300014326 Bacteria 5723
210 Ga0157380_10118101 3300014326 Bacteria 2241
211 Ga0157380_10390186 3300014326 Bacteria 1317
212 Ga0157380_10444257 3300014326 Bacteria 1243
213 Ga0182008_10000041 3300014497 Bacteria 118254
214 Ga0182008_10000979 3300014497 Bacteria 19823
215 Ga0182008_10008454 3300014497 Bacteria 5619
216 Ga0182008_10107226 3300014497 Bacteria 1383
217 Ga0157377_10184960 3300014745 Bacteria 1313
218 Ga0157379_10056147 3300014968 Bacteria 3519
219 Ga0157379_10215828 3300014968 Bacteria 1738
220 Ga0157376_10036462 3300014969 Bacteria 3984
221 Ga0157376_10284656 3300014969 Bacteria 1558
222 Ga0157376_11127410 3300014969 Bacteria 811
223 Ga0182006_1002496 3300015261 Bacteria 10020
224 Ga0182006_1030272 3300015261 Bacteria 2188
225 Ga0182006_1116324 3300015261 Bacteria 934
226 Ga0182007_10000705 3300015262 Bacteria 19033
227 Ga0182007_10001863 3300015262 Bacteria 10999
228 Ga0182005_1008500 3300015265 Bacteria 3023
229 Ga0182005_1041237 3300015265 Bacteria 1255
230 Ga0163161_10066534 3300017792 Bacteria 2632
231 Ga0163161_10279416 3300017792 Bacteria 1309
232 Ga0163161_10326606 3300017792 Bacteria 1214
233 Ga0209565_1000087 3300025263 Bacteria 152027
234 Ga0209565_1000104 3300025263 Bacteria 124432
235 Ga0209565_1012602 3300025263 Bacteria 2012
236 Ga0209673_1000145 3300025273 Bacteria 152027
237 Ga0209673_1015703 3300025273 Bacteria 2863
238 Ga0209673_1050262 3300025273 Bacteria 1108
239 Ga0209675_1000085 3300025291 Bacteria 152027
240 Ga0209675_1000191 3300025291 Bacteria 67500
241 Ga0209675_1002151 3300025291 Bacteria 10391
242 Ga0209676_1000036 3300025292 Bacteria 457623
243 Ga0209676_1000172 3300025292 Bacteria 153664
244 Ga0209025_1000618 3300025294 Bacteria 63845
245 Ga0209025_1000905 3300025294 Bacteria 45998
246 Ga0209025_1001806 3300025294 Bacteria 25356
247 Ga0209025_1002048 3300025294 Bacteria 22965
248 Ga0209025_1005552 3300025294 Bacteria 10223
249 Ga0209025_1032618 3300025294 Bacteria 2429
250 Ga0209025_1056740 3300025294 Bacteria 1503
251 Ga0209564_1000688 3300025295 Bacteria 49680
252 Ga0209564_1002275 3300025295 Bacteria 15701
253 Ga0209564_1004020 3300025295 Bacteria 9304
254 Ga0209050_1000509 3300025298 Bacteria 65792
255 Ga0209256_1001092 3300025299 Bacteria 31208
256 Ga0209256_1001334 3300025299 Bacteria 26338
257 Ga0209051_1000278 3300025303 Bacteria 83769
258 Ga0209051_1000397 3300025303 Bacteria 60597
259 Ga0209051_1034250 3300025303 Bacteria 1907
260 Ga0209257_1000072 3300025304 Bacteria 332791
261 Ga0207697_10044152 3300025315 Bacteria 1833
262 Ga0207655_1012902 3300025728 Bacteria 4837
263 Ga0207713_1001292 3300025735 Bacteria 20629
264 Ga0207713_1018323 3300025735 Bacteria 3470
265 Ga0207682_10016438 3300025893 Bacteria 2886
266 Ga0207692_10034308 3300025898 Bacteria 2456
267 Ga0207642_10010527 3300025899 Bacteria 3266
268 Ga0207710_10065772 3300025900 Bacteria 1653
269 Ga0207680_10089377 3300025903 Bacteria 1955
270 Ga0207680_10193135 3300025903 Bacteria 1383
271 Ga0207685_10034844 3300025905 Bacteria 1832
272 Ga0207645_10075149 3300025907 Bacteria 2163
273 Ga0207645_10196479 3300025907 Bacteria 1326
274 Ga0207643_10006811 3300025908 Bacteria 6134
275 Ga0207643_10224950 3300025908 Bacteria 1150
276 Ga0207705_10395394 3300025909 Bacteria 1069
277 Ga0207654_10000574 3300025911 Bacteria 20794
278 Ga0207671_10375621 3300025914 Bacteria 1129
279 Ga0207663_10170254 3300025916 Bacteria 1546
280 Ga0207649_10117143 3300025920 Bacteria 1790
281 Ga0207681_10026903 3300025923 Bacteria 3714
282 Ga0207681_10038443 3300025923 Bacteria 3171
283 Ga0207681_10178362 3300025923 Bacteria 1616
284 Ga0207650_10092759 3300025925 Bacteria 2310
285 Ga0207650_10110545 3300025925 Bacteria 2127
286 Ga0207659_10142081 3300025926 Bacteria 1864
287 Ga0207644_10025817 3300025931 Bacteria 4042
288 Ga0207690_10422637 3300025932 Bacteria 1066
289 Ga0207706_10159377 3300025933 Bacteria 1984
290 Ga0207706_10278766 3300025933 Bacteria 1458
291 Ga0207706_10440163 3300025933 Bacteria 1128
292 Ga0207686_10144954 3300025934 Bacteria 1646
293 Ga0207709_10003493 3300025935 Bacteria 9312
294 Ga0207709_10718032 3300025935 Bacteria 801
295 Ga0207670_10007762 3300025936 Bacteria 6018
296 Ga0207670_10127680 3300025936 Bacteria 1858
297 Ga0207669_10036486 3300025937 Bacteria 2810
298 Ga0207669_10262548 3300025937 Bacteria 1292
299 Ga0207669_10474145 3300025937 Bacteria 996
300 Ga0207704_10087298 3300025938 Bacteria 2037
301 Ga0207704_10168775 3300025938 Bacteria 1567
302 Ga0207691_10054210 3300025940 Bacteria 3658
303 Ga0207691_10075284 3300025940 Bacteria 3044
304 Ga0207691_10076499 3300025940 Bacteria 3016
305 Ga0207711_10070534 3300025941 Bacteria 3031
306 Ga0207711_10259202 3300025941 Bacteria 1598
307 Ga0207711_10547107 3300025941 Bacteria 1080
308 Ga0207689_10016545 3300025942 Bacteria 6243
309 Ga0207689_10057396 3300025942 Bacteria 3203
310 Ga0207689_10097032 3300025942 Bacteria 2421
311 Ga0207679_10171546 3300025945 Bacteria 1786
312 Ga0207679_10263410 3300025945 Bacteria 1471
313 Ga0207679_10354027 3300025945 Bacteria 1281
314 Ga0207679_10461742 3300025945 Bacteria 1128
315 Ga0207667_10392229 3300025949 Bacteria 1414
316 Ga0207651_10048287 3300025960 Bacteria 2876
317 Ga0207651_10055295 3300025960 Bacteria 2725
318 Ga0207651_10086283 3300025960 Bacteria 2281
319 Ga0207651_10416899 3300025960 Bacteria 1145
320 Ga0207712_10046111 3300025961 Bacteria 3020
321 Ga0207712_10125354 3300025961 Bacteria 1949
322 Ga0207712_10160789 3300025961 Bacteria 1745
323 Ga0207712_10346706 3300025961 Bacteria 1233
324 Ga0207712_10358595 3300025961 Bacteria 1214
325 Ga0207712_10836371 3300025961 Bacteria 811
326 Ga0207668_10370625 3300025972 Bacteria 1202
327 Ga0207640_10252927 3300025981 Bacteria 1369
328 Ga0207658_10003371 3300025986 Bacteria 11309
329 Ga0207658_10020449 3300025986 Bacteria 4583
330 Ga0207658_10040291 3300025986 Bacteria 3376
331 Ga0207658_10155842 3300025986 Bacteria 1866
332 Ga0207658_10441742 3300025986 Bacteria 1150
333 Ga0207703_10050354 3300026035 Bacteria 3371
334 Ga0207639_10028438 3300026041 Bacteria 4082
335 Ga0207678_10040725 3300026067 Bacteria 4027
336 Ga0207678_10693110 3300026067 Bacteria 896
337 Ga0207708_10124925 3300026075 Bacteria 2007
338 Ga0207708_10550955 3300026075 Bacteria 972
339 Ga0207708_10868864 3300026075 Bacteria 779
340 Ga0207641_10000220 3300026088 Bacteria 74415
341 Ga0207641_10011553 3300026088 Bacteria 7247
342 Ga0207641_10023632 3300026088 Bacteria 5064
343 Ga0207641_10177959 3300026088 Bacteria 1946
344 Ga0207641_10246056 3300026088 Bacteria 1668
345 Ga0207648_10018789 3300026089 Bacteria 6248
346 Ga0207648_10166894 3300026089 Bacteria 1946
347 Ga0207648_10241358 3300026089 Bacteria 1609
348 Ga0207676_10080152 3300026095 Bacteria 2650
349 Ga0207676_10382768 3300026095 Bacteria 1310
350 Ga0207674_10070466 3300026116 Bacteria 3515
351 Ga0207674_10252648 3300026116 Bacteria 1710
352 Ga0207675_100006319 3300026118 Bacteria 11240
353 Ga0207675_100017126 3300026118 Bacteria 6767
354 Ga0207675_100056849 3300026118 Bacteria 3649
355 Ga0207675_100131421 3300026118 Bacteria 2374
356 Ga0207675_100149764 3300026118 Bacteria 2220
357 Ga0207675_100666500 3300026118 Bacteria 1047
358 Ga0207675_100778927 3300026118 Bacteria 969
359 Ga0207683_10008216 3300026121 Bacteria 8930
360 Ga0207683_10013773 3300026121 Bacteria 6896
361 Ga0207683_10028026 3300026121 Bacteria 4869
362 Ga0207683_10130754 3300026121 Bacteria 2258
363 Ga0207683_10201019 3300026121 Bacteria 1811
364 Ga0209282_1000021 3300027666 Bacteria 177705
365 Ga0209282_1003254 3300027666 Bacteria 9616
366 Ga0268266_10000409 3300028379 Bacteria 65290
367 Ga0268266_10006147 3300028379 Bacteria 11050
368 Ga0268266_10009480 3300028379 Bacteria 8567
369 Ga0268266_10012248 3300028379 Bacteria 7420
370 Ga0268266_10030458 3300028379 Bacteria 4584
371 Ga0268266_10039459 3300028379 Bacteria 4022
372 Ga0268266_10113364 3300028379 Bacteria 2404
373 Ga0268266_10390497 3300028379 Bacteria 1314
374 Ga0268265_10031142 3300028380 Bacteria 3851
375 Ga0268265_10046320 3300028380 Bacteria 3250
376 Ga0268265_10233499 3300028380 Bacteria 1618
377 Ga0268265_10289589 3300028380 Bacteria 1469
378 Ga0268264_10000085 3300028381 Bacteria 240739
379 Ga0268264_10143108 3300028381 Bacteria 2135
380 Ga0268264_10225339 3300028381 Bacteria 1728
381 Ga0307515_10000195 3300028794 Bacteria 148138
382 Ga0307515_10053551 3300028794 Bacteria 5950
383 Ga0307515_10237944 3300028794 Bacteria 1598
384 Ga0307511_10000204 3300030521 Bacteria 59925
385 Ga0307511_10044022 3300030521 Viruses 3717
386 Ga0316177_1083748 3300030731 Bacteria 7341
387 Ga0316176_1114549 3300030732 Bacteria 3018
388 Ga0314311_1068161 3300030733 Bacteria 3580
389 Ga0316181_1033992 3300030744 Bacteria 5651
390 Ga0316182_1107731 3300030745 Bacteria 1207
391 Ga0265327_10000640 3300031251 Bacteria 56812
392 Ga0265327_10019675 3300031251 Bacteria 4140
393 Ga0307513_10007003 3300031456 Bacteria 14668
394 Ga0307513_10016636 3300031456 Bacteria 8858
395 Ga0307513_10023455 3300031456 Bacteria 7207
396 Ga0307513_10030889 3300031456 Bacteria 6077
397 Ga0307513_10036720 3300031456 Bacteria 5461
398 Ga0307513_10073099 3300031456 Bacteria 3571
399 Ga0307513_10096801 3300031456 Bacteria 2988
400 Ga0307408_100033508 3300031548 Bacteria 3589
401 Ga0307408_100155137 3300031548 Bacteria 1812
402 Ga0307408_100272214 3300031548 Bacteria 1406
403 Ga0307405_10078596 3300031731 Bacteria 2148
404 Ga0307405_10128973 3300031731 Bacteria 1744
405 Ga0307405_10200097 3300031731 Bacteria 1450
406 Ga0307405_10201872 3300031731 Bacteria 1444
407 Ga0307405_10520081 3300031731 Bacteria 957
408 Ga0307413_10014725 3300031824 Bacteria 3983
409 Ga0307410_10003532 3300031852 Bacteria 7862
410 Ga0307410_10013410 3300031852 Bacteria 4781
411 Ga0307406_10004223 3300031901 Bacteria 7816
412 Ga0307406_10082392 3300031901 Bacteria 2142
413 Ga0307407_10099371 3300031903 Bacteria 1802
414 Ga0307407_10132987 3300031903 Bacteria 1594
415 Ga0307412_10081389 3300031911 Bacteria 2239
416 Ga0307412_10370919 3300031911 Bacteria 1156
417 Ga0307412_10398067 3300031911 Bacteria 1120
418 Ga0307409_100008635 3300031995 Bacteria 6197
419 Ga0307409_100009145 3300031995 Bacteria 6071
420 Ga0307416_100099966 3300032002 Bacteria 2521
421 Ga0307416_100190129 3300032002 Bacteria 1935
422 Ga0307416_100354000 3300032002 Bacteria 1487
423 Ga0307416_100396996 3300032002 Bacteria 1415
424 Ga0307414_10337040 3300032004 Bacteria 1289
425 Ga0307411_10186537 3300032005 Bacteria 1579
426 Ga0307411_10203522 3300032005 Bacteria 1522
427 Ga0307415_100020507 3300032126 Bacteria 4038
428 Ga0307415_100090152 3300032126 Bacteria 2217
429 Ga0307510_10000004 3300033180 Bacteria 654130
430 Ga0307510_10158236 3300033180 Bacteria 1868
431 Ga0373936_0017773 3300035113 Bacteria 2740
432 Ga0373936_0021254 3300035113 Bacteria 2523
433 Ga0373935_0110233 3300035692 Bacteria 1826
434 Ga0373933_0078327 3300035724 Bacteria 2022
435 Ga0373933_0299556 3300035724 Bacteria 1041
436 Ga0373933_0427957 3300035724 Bacteria 865
437 Ga0373937_0017834 3300036401 Bacteria 6334
438 Ga0373937_0624721 3300036401 Bacteria 1022
439 Ga0373925_0332540 3300037068 Bacteria 1231
440 Ga0373925_0377024 3300037068 Bacteria 1155
441 Ga0395905_0441951 3300037471 Bacteria 1198
442 Ga0439436_0000260 3300041404 Bacteria 12706
443 Ga0439436_0012416 3300041404 Bacteria 2586
444 Ga0439447_030299 3300041407 Bacteria 1364
445 Ga0439461_0033173 3300041410 Bacteria 1085
446 Ga0439466_0005864 3300041411 Bacteria 4679
447 Ga0439466_0010965 3300041411 Bacteria 3360
448 Ga0439466_0023327 3300041411 Bacteria 2177
449 Ga0439466_0086653 3300041411 Bacteria 984
450 Ga0439465_0006112 3300041413 Bacteria 3828
451 Ga0439465_0042948 3300041413 Bacteria 1466
452 Ga0451789_1317359 3300041443 Bacteria 1292
453 Ga0451793_0765724 3300041452 Bacteria 1430
454 Ga0451800_0302824 3300041459 Bacteria 2247
455 Ga0451802_0356051 3300041460 Bacteria 812
456 Ga0451804_0147506 3300041463 Bacteria 1560
457 Ga0451807_0481750 3300041486 Bacteria 2083
458 Ga0451807_1209868 3300041486 Bacteria 1877
459 Ga0451807_2367067 3300041486 Bacteria 1430
460 Ga0451837_0927674 3300041494 Bacteria 1352
461 Ga0451843_0219946 3300041509 Bacteria 1568
462 Ga0451855_1329526 3300041511 Bacteria 870
463 Ga0451853_0197513 3300041512 Bacteria 829
464 Ga0451853_2486265 3300041512 Bacteria 984
465 Ga0439431_0003269 3300041997 Bacteria 3564
466 Ga0439431_0073240 3300041997 Bacteria 915
467 Ga0439433_0001399 3300041999 Bacteria 4957
468 Ga0439433_0038866 3300041999 Bacteria 1104
469 Ga0439433_0060410 3300041999 Bacteria 903
470 Ga0439442_003529 3300042002 Bacteria 3092
471 Ga0439442_004209 3300042002 Bacteria 2853
472 Ga0439445_0003443 3300042004 Bacteria 3552
473 Ga0439445_0030248 3300042004 Bacteria 1403
474 Ga0439445_0121535 3300042004 Bacteria 750
475 Ga0439432_002182 3300042006 Bacteria 7390
476 Ga0439432_008573 3300042006 Bacteria 3588
477 Ga0439432_028280 3300042006 Bacteria 1826
478 Ga0439449_0000810 3300042007 Bacteria 12045
479 Ga0439449_0007367 3300042007 Bacteria 4181
480 Ga0439449_0009810 3300042007 Bacteria 3624
481 Ga0439452_004990 3300042010 Bacteria 4342
482 Ga0439455_0077550 3300042012 Bacteria 900
483 Ga0439457_005960 3300042014 Bacteria 3014
484 Ga0439462_0026761 3300042015 Bacteria 1520
485 Ga0450923_040091 3300042125 Bacteria 982
486 Ga0450897_000645 3300042128 Bacteria 2040
487 Ga0450896_036698 3300042133 Bacteria 755
488 Ga0450906_001705 3300042145 Bacteria 4805
489 Ga0439446_0051485 3300042156 Bacteria 1230
490 Ga0439446_0149516 3300042156 Bacteria 767
491 Ga0450908_006253 3300042184 Bacteria 2266
492 Ga0450908_033829 3300042184 Bacteria 886
493 Ga0439434_0001306 3300042435 Bacteria 7179
494 Ga0439434_0103329 3300042435 Bacteria 919
495 Ga0450916_002925 3300042530 Bacteria 1850
496 Ga0466965_0070652 3300044683 Bacteria 1755
497 Ga0466960_0205682 3300044901 Bacteria 1077
498 Ga0495592_0465296 3300046454 Bacteria 790
499 Ga0495590_0001681 3300046457 Bacteria 9407
500 Ga0495590_0048960 3300046457 Bacteria 1474
501 Ga0495591_053044 3300046458 Bacteria 1101
502 Ga0495638_0004727 3300046460 Bacteria 10290
503 Ga0495650_0061299 3300046471 Bacteria 1507
504 Ga0495580_0000702 3300046472 Bacteria 28637
505 Ga0495605_0009070 3300046474 Bacteria 5600
506 Ga0495639_0004033 3300046475 Bacteria 6292
507 Ga0495584_0197273 3300046491 Bacteria 1023
508 Ga0495596_0000299 3300046500 Bacteria 32765
509 Ga0495607_0021268 3300046501 Bacteria 4084
510 Ga0495606_0066692 3300046507 Bacteria 2282
511 Ga0495606_0090125 3300046507 Bacteria 1888
512 Ga0495606_0199609 3300046507 Bacteria 1141
513 Ga0495606_0372094 3300046507 Bacteria 752
514 Ga0495610_0014957 3300046512 Bacteria 4532
515 Ga0495616_0003303 3300046513 Bacteria 10370
516 Ga0495618_0158283 3300046514 Bacteria 1445
517 Ga0495631_0137044 3300046518 Bacteria 1051
518 Ga0495632_0067881 3300046519 Bacteria 1719
519 Ga0495643_0039363 3300046522 Bacteria 2586
520 Ga0495643_0112580 3300046522 Bacteria 1382
521 Ga0495648_0027242 3300046524 Bacteria 3830
522 Ga0495648_0099474 3300046524 Bacteria 1609
523 Ga0495640_0313795 3300046533 Bacteria 972
524 Ga0495586_0199321 3300046535 Bacteria 1135
525 Ga0495609_0002941 3300046538 Bacteria 10071
526 Ga0495621_0003186 3300046539 Bacteria 4500
527 Ga0495621_0081075 3300046539 Bacteria 1210
528 Ga0495622_0379944 3300046557 Bacteria 610
529 Ga0495656_0000447 3300046615 Bacteria 13485
530 Ga0495656_0160986 3300046615 Bacteria 1091
531 Ga0495668_0147327 3300046616 Bacteria 1289
532 Ga0495611_0210095 3300046648 Bacteria 906
533 Ga0495625_0000012 3300046660 Bacteria 363006
534 Ga0495625_0022933 3300046660 Bacteria 4776
535 Ga0495625_0033218 3300046660 Bacteria 3818
536 Ga0495625_0051195 3300046660 Bacteria 2961
537 Ga0495661_0023398 3300046665 Bacteria 4011
538 Ga0495588_0353182 3300046674 Bacteria 772
539 Ga0495657_0099305 3300046675 Bacteria 1857
540 Ga0495669_0075902 3300046684 Bacteria 1538
541 Ga0495670_0179196 3300046691 Bacteria 1118
542 Ga0495671_0005389 3300046692 Bacteria 7497
543 Ga0495649_0010233 3300046694 Bacteria 5540
544 Ga0495649_0447313 3300046694 Bacteria 645
545 Ga0495600_0082730 3300046809 Bacteria 2095
546 Ga0495636_0005139 3300047318 Bacteria 5138
547 Ga0495672_0019047 3300047320 Bacteria 4538
548 Ga0495672_0178348 3300047320 Bacteria 1078
549 Ga0495685_070960 3300047447 Bacteria 1166
550 Ga0495673_0017124 3300047469 Bacteria 3688
551 Ga0495593_0073206 3300047673 Bacteria 1778
552 Ga0495615_0003743 3300048090 Bacteria 2580
553 Ga0495626_0097306 3300048091 Bacteria 1287
554 Ga0496101_0000615 3300048904 Bacteria 21702
555 Ga0496102_0001349 3300048905 Bacteria 21981
556 Ga0496102_1175836 3300048905 Bacteria 686
557 Ga0496103_0021865 3300048906 Bacteria 3849
558 Ga0496104_0020542 3300048907 Bacteria 6054
559 Ga0496104_0169197 3300048907 Bacteria 2096
560 Ga0496105_0009353 3300048908 Bacteria 7660
561 Ga0496105_0645599 3300048908 Bacteria 817
562 Ga0496106_0350198 3300048909 Bacteria 1186
563 Ga0496108_0334017 3300048911 Bacteria 1322
564 Ga0496109_0419856 3300048912 Bacteria 1263
565 Ga0496111_0030992 3300048914 Bacteria 3806
566 Ga0496112_0027994 3300048915 Bacteria 5437
567 Ga0496112_0593440 3300048915 Bacteria 1040
568 Ga0496113_0319567 3300048916 Bacteria 1244
569 Ga0496114_0025835 3300048917 Bacteria 4803
570 Ga0496114_0107136 3300048917 Bacteria 2391
571 Ga0496114_0259914 3300048917 Bacteria 1529
572 Ga0496116_0008921 3300048919 Bacteria 8624
573 Ga0496116_0064717 3300048919 Bacteria 2349
574 Ga0496116_0067789 3300048919 Bacteria 2277
575 Ga0496117_0000627 3300048920 Bacteria 57244
576 Ga0496118_0000026 3300048921 Bacteria 375725
577 Ga0496119_0003877 3300048922 Bacteria 15240
578 Ga0496119_0007208 3300048922 Bacteria 10070
579 Ga0496119_0117481 3300048922 Bacteria 1466
580 Ga0496120_0001237 3300048923 Bacteria 32272
581 Ga0496120_0004425 3300048923 Bacteria 11793
582 Ga0496121_0027863 3300048924 Bacteria 5276
583 Ga0496121_0041031 3300048924 Bacteria 4051
584 Ga0496121_0092120 3300048924 Bacteria 2363
585 Ga0496122_0000528 3300048925 Bacteria 79201
586 Ga0496122_0006383 3300048925 Bacteria 13553
587 Ga0496123_0000308 3300048926 Bacteria 94712
588 Ga0496123_0005960 3300048926 Bacteria 12002
589 Ga0496123_0235673 3300048926 Bacteria 912
590 Ga0496124_0059412 3300048927 Bacteria 3212
591 Ga0496125_0005695 3300048928 Bacteria 13740
592 Ga0496125_0023864 3300048928 Bacteria 5636
593 Ga0496125_0358947 3300048928 Bacteria 867
594 Ga0496126_0347312 3300048929 Bacteria 1214
595 Ga0501031_0122545 3300049568 Bacteria 1698
596 Ga0501031_0214172 3300049568 Bacteria 1255
597 Ga0501034_0000092 3300049571 Bacteria 164224
598 Ga0501036_0278548 3300049572 Bacteria 1400
599 Ga0501036_0334203 3300049572 Bacteria 1265
600 Ga0501036_0363289 3300049572 Bacteria 1209
601 Ga0501038_0008445 3300049574 Bacteria 9473
602 Ga0501040_0009943 3300049576 Bacteria 6211
603 Ga0501040_0509334 3300049576 Bacteria 868
604 Ga0501041_0000704 3300049577 Bacteria 17791
605 Ga0501042_0120419 3300049578 Bacteria 1889
606 Ga0501042_0790455 3300049578 Bacteria 690
607 Ga0501043_0100361 3300049579 Bacteria 2275
608 Ga0501046_0517164 3300049580 Bacteria 854
609 Ga0501048_0002870 3300049582 Bacteria 13149
610 Ga0501071_0000259 3300049587 Bacteria 24780
611 Ga0501071_0036445 3300049587 Bacteria 3508
612 Ga0501072_0009981 3300049588 Bacteria 7220
613 Ga0501072_0695727 3300049588 Bacteria 799
614 Ga0501073_0009721 3300049589 Bacteria 7083
615 Ga0501073_0202314 3300049589 Bacteria 1373
616 Ga0501074_0025247 3300049590 Bacteria 4317
617 Ga0501075_0000327 3300049591 Bacteria 26752
618 Ga0501076_0000933 3300049592 Bacteria 19052
619 Ga0501076_0366840 3300049592 Bacteria 1183
620 Ga0501077_0000838 3300049593 Bacteria 18607
621 Ga0501077_0004615 3300049593 Bacteria 8365
622 Ga0501077_0299461 3300049593 Bacteria 1024
623 Ga0501249_011811 3300049679 Bacteria 1839
624 Ga0501225_0006957 3300049705 Bacteria 3295
625 Ga0501080_0056134 3300049742 Bacteria 3668
626 Ga0501080_0061373 3300049742 Bacteria 3500
627 Ga0501081_0000101 3300049743 Bacteria 35737
628 Ga0501083_0013202 3300049744 Bacteria 5773
629 Ga0501083_0087503 3300049744 Bacteria 2060
630 Ga0501262_001122 3300049759 Bacteria 3040
631 Ga0501035_0097677 3300049822 Bacteria 2579
632 Ga0501044_0029079 3300049823 Bacteria 5829
633 Ga0501045_0000042 3300049824 Bacteria 55067
634 nmdc:mga03683_12784_c1 3300050489 Bacteria 3074
635 nmdc:mga03683_95848_c1 3300050489 Bacteria 1299
636 nmdc:mga03n38_30725_c1 3300050490 Bacteria 2261
637 nmdc:mga03n38_8821_c1 3300050490 Bacteria 3637
638 nmdc:mga00v17_2820_c1 3300050491 Bacteria 7991
639 nmdc:mga0k408_10181_c1 3300050493 Bacteria 5082
640 nmdc:mga0k408_183752_c1 3300050493 Bacteria 1247
641 nmdc:mga0k408_23438_c1 3300050493 Bacteria 3482
642 nmdc:mga07m45_2056_c1 3300050496 Bacteria 9337
643 nmdc:mga07m45_49159_c1 3300050496 Bacteria 2373
644 nmdc:mga07m45_4961_c1 3300050496 Bacteria 6565
645 nmdc:mga07m45_56174_c1 3300050496 Bacteria 2225
646 nmdc:mga07m45_683_c1 3300050496 Bacteria 14405
647 nmdc:mga08y16_1123770_c1 3300050511 Bacteria 760
648 nmdc:mga08y16_114907_c1 3300050511 Bacteria 2802
649 Ga0500643_001716 3300053087 Bacteria 12170
650 Ga0500594_0068327 3300053118 Bacteria 1039
651 Ga0500559_0004582 3300053136 Bacteria 6537
652 Ga0500559_0026998 3300053136 Bacteria 2449
653 Ga0500573_0084104 3300053140 Bacteria 1806
654 Ga0500637_0008735 3300053178 Bacteria 5125
655 Ga0501084_0009092 3300054114 Bacteria 8221
656 Ga0501082_0002064 3300060353 Bacteria 17661
657 Ga0530510_0005036 3300061734 Bacteria 9125
658 Ga0530510_0073613 3300061734 Bacteria 2480
659 Ga0530510_0455245 3300061734 Bacteria 968

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0379944 Ga0495622_0379944_41_586 181
2 3300050511 nmdc:mga08y16_1123770_c1 nmdc:mga08y16_1123770_c1_184_729 181
3 3300041512 Ga0451853_2486265 Ga0451853_2486265_26_589 187
4 3300046522 Ga0495643_0039363 Ga0495643_0039363_1829_2470 188
5 3300006948 Ga0099826_10000007 Ga0099826_10000007323 189
6 3300027666 Ga0209282_1000021 Ga0209282_100002152 189
7 3300009011 Ga0105251_10010075 Ga0105251_100100754 190
8 3300025735 Ga0207713_1018323 Ga0207713_10183232 190
9 3300046458 Ga0495591_053044 Ga0495591_053044_387_1034 190
10 3300046474 Ga0495605_0009070 Ga0495605_0009070_3075_3722 190
11 3300046491 Ga0495584_0197273 Ga0495584_0197273_281_928 190
12 3300046500 Ga0495596_0000299 Ga0495596_0000299_29930_30577 190
13 3300046501 Ga0495607_0021268 Ga0495607_0021268_3123_3770 190
14 3300046507 Ga0495606_0372094 Ga0495606_0372094_55_702 190
15 3300046512 Ga0495610_0014957 Ga0495610_0014957_2080_2727 190
16 3300046513 Ga0495616_0003303 Ga0495616_0003303_1855_2502 190
17 3300046518 Ga0495631_0137044 Ga0495631_0137044_230_877 190
18 3300046524 Ga0495648_0027242 Ga0495648_0027242_65_712 190
19 3300046538 Ga0495609_0002941 Ga0495609_0002941_1712_2359 190
20 3300046648 Ga0495611_0210095 Ga0495611_0210095_232_879 190
21 3300046665 Ga0495661_0023398 Ga0495661_0023398_323_970 190
22 3300046684 Ga0495669_0075902 Ga0495669_0075902_264_911 190
23 3300046691 Ga0495670_0179196 Ga0495670_0179196_129_776 190
24 3300046692 Ga0495671_0005389 Ga0495671_0005389_4709_5356 190
25 3300046694 Ga0495649_0010233 Ga0495649_0010233_201_848 190
26 3300047320 Ga0495672_0019047 Ga0495672_0019047_2186_2833 190
27 3300047447 Ga0495685_070960 Ga0495685_070960_158_805 190
28 3300047469 Ga0495673_0017124 Ga0495673_0017124_2945_3592 190
29 3300048919 Ga0496116_0064717 Ga0496116_0064717_316_963 190
30 3300048924 Ga0496121_0041031 Ga0496121_0041031_112_759 190
31 3300048925 Ga0496122_0006383 Ga0496122_0006383_1820_2467 190
32 3300048926 Ga0496123_0005960 Ga0496123_0005960_271_918 190
33 3300048928 Ga0496125_0358947 Ga0496125_0358947_45_692 190
34 3300048929 Ga0496126_0347312 Ga0496126_0347312_431_1078 190
35 3300005834 Ga0068851_10153906 Ga0068851_101539062 200
36 3300013308 Ga0157375_10002431 Ga0157375_1000243112 200
37 3300035724 Ga0373933_0299556 Ga0373933_0299556_21_623 200
38 3300041460 Ga0451802_0356051 Ga0451802_0356051_32_634 200
39 3300041512 Ga0451853_0197513 Ga0451853_0197513_199_801 200
40 3300042530 Ga0450916_002925 Ga0450916_002925_448_1050 200
41 3300046660 Ga0495625_0033218 Ga0495625_0033218_1455_2057 200
42 3300046694 Ga0495649_0447313 Ga0495649_0447313_32_634 200
43 3300048908 Ga0496105_0645599 Ga0496105_0645599_13_615 200
44 3300049568 Ga0501031_0214172 Ga0501031_0214172_170_772 200
45 3300049578 Ga0501042_0790455 Ga0501042_0790455_34_636 200
46 3300061734 Ga0530510_0455245 Ga0530510_0455245_321_923 200
47 iso_pu_bacteria 2643221637 2644210028 201
48 iso_pu_bacteria 2643221718 2644653579 201
49 3300048915 Ga0496112_0593440 Ga0496112_0593440_170_787 204
50 iso_pu_bacteria 2513020051 2513229087 207
51 iso_pu_bacteria 2643221672 2644401735 207
52 iso_pu_bacteria 2885198086 2885203543 207
53 iso_pu_bacteria 2885211737 2885217107 207
54 iso_pu_bacteria 2842677519 2842678404 208
55 iso_pu_bacteria 2842733646 2842735380 208
56 iso_pu_bacteria 2842747753 2842748157 208
57 iso_pu_bacteria 2885192300 2885197364 208
58 iso_pu_bacteria 2904449895 2904455041 208
59 iso_pu_bacteria 2904456579 2904457401 208
60 iso_pu_bacteria 2919462493 2919465180 208
61 iso_pu_bacteria 2928115317 2928115401 208
62 iso_pu_bacteria 2929520902 2929525161 208
63 iso_pu_bacteria 2945972063 2945977798 208
64 3300033180 Ga0307510_10000004 Ga0307510_10000004132 209
65 3300048905 Ga0496102_1175836 Ga0496102_1175836_15_644 209
66 3300048909 Ga0496106_0350198 Ga0496106_0350198_389_1018 209
67 3300048919 Ga0496116_0008921 Ga0496116_0008921_4120_4749 209
68 3300048920 Ga0496117_0000627 Ga0496117_0000627_15839_16468 209
69 3300048921 Ga0496118_0000026 Ga0496118_0000026_316289_316918 209
70 3300048922 Ga0496119_0003877 Ga0496119_0003877_12271_12900 209
71 3300048922 Ga0496119_0117481 Ga0496119_0117481_29_658 209
72 3300048923 Ga0496120_0004425 Ga0496120_0004425_7552_8181 209
73 3300048924 Ga0496121_0092120 Ga0496121_0092120_823_1452 209
74 3300048928 Ga0496125_0023864 Ga0496125_0023864_4297_4926 209
75 3300025294 Ga0209025_1056740 Ga0209025_10567402 210
76 3300049592 Ga0501076_0366840 Ga0501076_0366840_101_736 210
77 3300049593 Ga0501077_0299461 Ga0501077_0299461_45_680 210
78 3300061734 Ga0530510_0073613 Ga0530510_0073613_1701_2336 210
79 iso_pu_bacteria 2887375801 2887377967 210
80 3300003773 Ga0055537_1000195 Ga0055537_100019536 211
81 3300003784 Ga0055534_1000262 Ga0055534_100026236 211
82 3300003784 Ga0055534_1000285 Ga0055534_100028527 211
83 3300003790 Ga0055528_1000371 Ga0055528_10003715 211
84 3300005288 Ga0065714_10005960 Ga0065714_100059602 211
85 3300005328 Ga0070676_10104250 Ga0070676_101042503 211
86 3300005347 Ga0070668_100004659 Ga0070668_1000046593 211
87 3300005367 Ga0070667_100017213 Ga0070667_1000172134 211
88 3300005548 Ga0070665_100000424 Ga0070665_10000042431 211
89 3300005548 Ga0070665_100047472 Ga0070665_1000474726 211
90 3300005564 Ga0070664_100048248 Ga0070664_1000482483 211
91 3300005577 Ga0068857_100310600 Ga0068857_1003106002 211
92 3300005616 Ga0068852_100523227 Ga0068852_1005232271 211
93 3300005719 Ga0068861_100348483 Ga0068861_1003484832 211
94 3300006048 Ga0075363_100023822 Ga0075363_1000238223 211
95 3300006237 Ga0097621_100266208 Ga0097621_1002662082 211
96 3300006353 Ga0075370_10045441 Ga0075370_100454412 211
97 3300006358 Ga0068871_100375580 Ga0068871_1003755802 211
98 3300006358 Ga0068871_100496360 Ga0068871_1004963602 211
99 3300006948 Ga0099826_10011566 Ga0099826_100115665 211
100 3300009011 Ga0105251_10001536 Ga0105251_100015365 211
101 3300009036 Ga0105244_10001232 Ga0105244_100012326 211
102 3300009148 Ga0105243_10002672 Ga0105243_100026723 211
103 3300009174 Ga0105241_10002121 Ga0105241_100021215 211
104 3300009176 Ga0105242_10488428 Ga0105242_104884282 211
105 3300009177 Ga0105248_10067276 Ga0105248_100672764 211
106 3300009553 Ga0105249_10040032 Ga0105249_100400323 211
107 3300011119 Ga0105246_10049393 Ga0105246_100493933 211
108 3300013100 Ga0157373_10001598 Ga0157373_100015985 211
109 3300014969 Ga0157376_10284656 Ga0157376_102846562 211
110 3300015261 Ga0182006_1002496 Ga0182006_10024964 211
111 3300015262 Ga0182007_10000705 Ga0182007_1000070515 211
112 3300015265 Ga0182005_1008500 Ga0182005_10085002 211
113 3300025263 Ga0209565_1000087 Ga0209565_100008736 211
114 3300025273 Ga0209673_1000145 Ga0209673_100014536 211
115 3300025291 Ga0209675_1000085 Ga0209675_100008536 211
116 3300025292 Ga0209676_1000172 Ga0209676_100017251 211
117 3300025298 Ga0209050_1000509 Ga0209050_100050918 211
118 3300025303 Ga0209051_1000278 Ga0209051_100027871 211
119 3300025304 Ga0209257_1000072 Ga0209257_1000072215 211
120 3300025728 Ga0207655_1012902 Ga0207655_10129023 211
121 3300025735 Ga0207713_1001292 Ga0207713_10012926 211
122 3300025911 Ga0207654_10000574 Ga0207654_100005746 211
123 3300025920 Ga0207649_10117143 Ga0207649_101171432 211
124 3300025935 Ga0207709_10003493 Ga0207709_100034934 211
125 3300025941 Ga0207711_10070534 Ga0207711_100705343 211
126 3300025945 Ga0207679_10263410 Ga0207679_102634102 211
127 3300025960 Ga0207651_10086283 Ga0207651_100862832 211
128 3300025961 Ga0207712_10046111 Ga0207712_100461113 211
129 3300025986 Ga0207658_10003371 Ga0207658_100033714 211
130 3300026116 Ga0207674_10070466 Ga0207674_100704663 211
131 3300026118 Ga0207675_100666500 Ga0207675_1006665002 211
132 3300026121 Ga0207683_10013773 Ga0207683_100137736 211
133 3300027666 Ga0209282_1003254 Ga0209282_10032548 211
134 3300028379 Ga0268266_10000409 Ga0268266_1000040931 211
135 3300028379 Ga0268266_10006147 Ga0268266_100061472 211
136 3300028380 Ga0268265_10046320 Ga0268265_100463202 211
137 3300028381 Ga0268264_10225339 Ga0268264_102253392 211
138 3300031251 Ga0265327_10000640 Ga0265327_100006406 211
139 3300031251 Ga0265327_10019675 Ga0265327_100196755 211
140 3300031548 Ga0307408_100033508 Ga0307408_1000335084 211
141 3300031731 Ga0307405_10128973 Ga0307405_101289732 211
142 3300031901 Ga0307406_10004223 Ga0307406_100042237 211
143 3300032004 Ga0307414_10337040 Ga0307414_103370402 211
144 3300032005 Ga0307411_10203522 Ga0307411_102035222 211
145 3300041411 Ga0439466_0005864 Ga0439466_0005864_2494_3135 211
146 3300041997 Ga0439431_0073240 Ga0439431_0073240_255_896 211
147 3300042002 Ga0439442_003529 Ga0439442_003529_2291_2929 211
148 3300042006 Ga0439432_002182 Ga0439432_002182_1541_2182 211
149 3300042128 Ga0450897_000645 Ga0450897_000645_115_753 211
150 3300042133 Ga0450896_036698 Ga0450896_036698_82_720 211
151 3300042145 Ga0450906_001705 Ga0450906_001705_3622_4260 211
152 3300046472 Ga0495580_0000702 Ga0495580_0000702_18523_19158 211
153 3300046514 Ga0495618_0158283 Ga0495618_0158283_699_1337 211
154 3300046524 Ga0495648_0099474 Ga0495648_0099474_908_1543 211
155 3300046539 Ga0495621_0081075 Ga0495621_0081075_26_664 211
156 3300046660 Ga0495625_0000012 Ga0495625_0000012_225100_225738 211
157 3300048919 Ga0496116_0067789 Ga0496116_0067789_975_1613 211
158 3300048922 Ga0496119_0007208 Ga0496119_0007208_7021_7656 211
159 3300048923 Ga0496120_0001237 Ga0496120_0001237_21060_21695 211
160 3300050490 nmdc:mga03n38_30725_c1 nmdc:mga03n38_30725_c1_84_722 211
161 3300050491 nmdc:mga00v17_2820_c1 nmdc:mga00v17_2820_c1_4717_5355 211
162 3300050493 nmdc:mga0k408_10181_c1 nmdc:mga0k408_10181_c1_904_1542 211
163 3300050496 nmdc:mga07m45_2056_c1 nmdc:mga07m45_2056_c1_7592_8230 211
164 3300050496 nmdc:mga07m45_4961_c1 nmdc:mga07m45_4961_c1_1193_1831 211
165 iso_pu_bacteria 2513237150 2513953844 211
166 iso_pu_bacteria 2513237165 2514039980 211
167 iso_pu_bacteria 2834641062 2834641107 211
168 iso_pu_bacteria 2901300506 2901301780 211
169 iso_pu_bacteria 644736347 644746639 211
170 iso_pu_bacteria 8003400568 8003403316 211
171 3300003781 Ga0055536_1010988 Ga0055536_10109883 212
172 3300003791 Ga0055530_10021246 Ga0055530_100212462 212
173 3300003792 Ga0055540_1000978 Ga0055540_10009785 212
174 3300003792 Ga0055540_1009078 Ga0055540_10090782 212
175 3300003794 Ga0055531_10014414 Ga0055531_100144142 212
176 3300005289 Ga0065704_10129945 Ga0065704_101299452 212
177 3300005335 Ga0070666_10006152 Ga0070666_100061525 212
178 3300005335 Ga0070666_10409168 Ga0070666_104091682 212
179 3300005344 Ga0070661_100526644 Ga0070661_1005266442 212
180 3300005353 Ga0070669_100009237 Ga0070669_1000092377 212
181 3300005356 Ga0070674_100062415 Ga0070674_1000624152 212
182 3300005356 Ga0070674_100091192 Ga0070674_1000911923 212
183 3300005364 Ga0070673_100192846 Ga0070673_1001928462 212
184 3300005364 Ga0070673_100622395 Ga0070673_1006223952 212
185 3300005367 Ga0070667_100049979 Ga0070667_1000499792 212
186 3300005367 Ga0070667_100106012 Ga0070667_1001060122 212
187 3300005456 Ga0070678_100003377 Ga0070678_1000033778 212
188 3300005459 Ga0068867_100023257 Ga0068867_1000232576 212
189 3300005466 Ga0070685_10245336 Ga0070685_102453361 212
190 3300005543 Ga0070672_100507585 Ga0070672_1005075852 212
191 3300005543 Ga0070672_100584024 Ga0070672_1005840242 212
192 3300005548 Ga0070665_100003568 Ga0070665_10000356811 212
193 3300005548 Ga0070665_100483920 Ga0070665_1004839202 212
194 3300005842 Ga0068858_100358334 Ga0068858_1003583342 212
195 3300006038 Ga0075365_10221394 Ga0075365_102213942 212
196 3300006048 Ga0075363_100006796 Ga0075363_1000067963 212
197 3300006048 Ga0075363_100058517 Ga0075363_1000585173 212
198 3300006051 Ga0075364_10010551 Ga0075364_100105514 212
199 3300006051 Ga0075364_10321472 Ga0075364_103214721 212
200 3300006058 Ga0075432_10044328 Ga0075432_100443281 212
201 3300006178 Ga0075367_10292080 Ga0075367_102920802 212
202 3300006195 Ga0075366_10087248 Ga0075366_100872482 212
203 3300006237 Ga0097621_100092510 Ga0097621_1000925102 212
204 3300006237 Ga0097621_100588641 Ga0097621_1005886411 212
205 3300006353 Ga0075370_10003659 Ga0075370_100036595 212
206 3300006353 Ga0075370_10009760 Ga0075370_100097604 212
207 3300006353 Ga0075370_10011926 Ga0075370_100119265 212
208 3300006353 Ga0075370_10081888 Ga0075370_100818882 212
209 3300006881 Ga0068865_100509152 Ga0068865_1005091522 212
210 3300006946 Ga0079104_1024276 Ga0079104_10242762 212
211 3300006948 Ga0099826_10148051 Ga0099826_101480512 212
212 3300009148 Ga0105243_10045322 Ga0105243_100453224 212
213 3300013104 Ga0157370_10389316 Ga0157370_103893162 212
214 3300013296 Ga0157374_10156336 Ga0157374_101563363 212
215 3300013308 Ga0157375_10135565 Ga0157375_101355652 212
216 3300014497 Ga0182008_10000041 Ga0182008_10000041103 212
217 3300014497 Ga0182008_10000979 Ga0182008_100009796 212
218 3300014497 Ga0182008_10008454 Ga0182008_100084544 212
219 3300014497 Ga0182008_10107226 Ga0182008_101072262 212
220 3300015261 Ga0182006_1030272 Ga0182006_10302723 212
221 3300015261 Ga0182006_1116324 Ga0182006_11163241 212
222 3300015262 Ga0182007_10001863 Ga0182007_100018635 212
223 3300015265 Ga0182005_1041237 Ga0182005_10412371 212
224 3300017792 Ga0163161_10279416 Ga0163161_102794162 212
225 3300017792 Ga0163161_10326606 Ga0163161_103266062 212
226 3300025273 Ga0209673_1015703 Ga0209673_10157033 212
227 3300025294 Ga0209025_1005552 Ga0209025_10055524 212
228 3300025303 Ga0209051_1000397 Ga0209051_100039742 212
229 3300025903 Ga0207680_10193135 Ga0207680_101931352 212
230 3300025923 Ga0207681_10026903 Ga0207681_100269032 212
231 3300025923 Ga0207681_10178362 Ga0207681_101783622 212
232 3300025933 Ga0207706_10440163 Ga0207706_104401632 212
233 3300025935 Ga0207709_10718032 Ga0207709_107180321 212
234 3300025937 Ga0207669_10262548 Ga0207669_102625482 212
235 3300025940 Ga0207691_10075284 Ga0207691_100752842 212
236 3300025949 Ga0207667_10392229 Ga0207667_103922292 212
237 3300025986 Ga0207658_10040291 Ga0207658_100402912 212
238 3300026121 Ga0207683_10008216 Ga0207683_100082168 212
239 3300028379 Ga0268266_10009480 Ga0268266_100094809 212
240 3300028379 Ga0268266_10113364 Ga0268266_101133642 212
241 3300028794 Ga0307515_10000195 Ga0307515_1000019529 212
242 3300028794 Ga0307515_10053551 Ga0307515_100535514 212
243 3300030731 Ga0316177_1083748 Ga0316177_10837486 212
244 3300030732 Ga0316176_1114549 Ga0316176_11145495 212
245 3300030733 Ga0314311_1068161 Ga0314311_10681613 212
246 3300030744 Ga0316181_1033992 Ga0316181_10339922 212
247 3300030745 Ga0316182_1107731 Ga0316182_11077311 212
248 3300031456 Ga0307513_10096801 Ga0307513_100968014 212
249 3300031548 Ga0307408_100272214 Ga0307408_1002722142 212
250 3300031731 Ga0307405_10201872 Ga0307405_102018722 212
251 3300031731 Ga0307405_10520081 Ga0307405_105200811 212
252 3300031911 Ga0307412_10081389 Ga0307412_100813892 212
253 3300032002 Ga0307416_100354000 Ga0307416_1003540002 212
254 3300032002 Ga0307416_100396996 Ga0307416_1003969962 212
255 3300032005 Ga0307411_10186537 Ga0307411_101865372 212
256 3300035692 Ga0373935_0110233 Ga0373935_0110233_549_1214 212
257 3300035724 Ga0373933_0078327 Ga0373933_0078327_920_1558 212
258 3300036401 Ga0373937_0017834 Ga0373937_0017834_4197_4835 212
259 3300037068 Ga0373925_0332540 Ga0373925_0332540_372_1037 212
260 3300041404 Ga0439436_0000260 Ga0439436_0000260_3894_4547 212
261 3300041404 Ga0439436_0012416 Ga0439436_0012416_1407_2060 212
262 3300041407 Ga0439447_030299 Ga0439447_030299_354_1007 212
263 3300041410 Ga0439461_0033173 Ga0439461_0033173_59_700 212
264 3300041411 Ga0439466_0010965 Ga0439466_0010965_1984_2625 212
265 3300041411 Ga0439466_0023327 Ga0439466_0023327_451_1104 212
266 3300041411 Ga0439466_0086653 Ga0439466_0086653_178_831 212
267 3300041413 Ga0439465_0006112 Ga0439465_0006112_814_1467 212
268 3300041413 Ga0439465_0042948 Ga0439465_0042948_584_1225 212
269 3300041509 Ga0451843_0219946 Ga0451843_0219946_529_1182 212
270 3300041511 Ga0451855_1329526 Ga0451855_1329526_13_651 212
271 3300041997 Ga0439431_0003269 Ga0439431_0003269_2028_2681 212
272 3300041999 Ga0439433_0001399 Ga0439433_0001399_362_1015 212
273 3300041999 Ga0439433_0038866 Ga0439433_0038866_173_826 212
274 3300041999 Ga0439433_0060410 Ga0439433_0060410_47_700 212
275 3300042002 Ga0439442_004209 Ga0439442_004209_41_694 212
276 3300042004 Ga0439445_0003443 Ga0439445_0003443_2521_3174 212
277 3300042004 Ga0439445_0030248 Ga0439445_0030248_615_1268 212
278 3300042004 Ga0439445_0121535 Ga0439445_0121535_16_657 212
279 3300042006 Ga0439432_008573 Ga0439432_008573_730_1383 212
280 3300042006 Ga0439432_028280 Ga0439432_028280_663_1316 212
281 3300042007 Ga0439449_0000810 Ga0439449_0000810_9446_10099 212
282 3300042007 Ga0439449_0007367 Ga0439449_0007367_2917_3570 212
283 3300042007 Ga0439449_0009810 Ga0439449_0009810_724_1377 212
284 3300042010 Ga0439452_004990 Ga0439452_004990_3312_3965 212
285 3300042012 Ga0439455_0077550 Ga0439455_0077550_170_823 212
286 3300042014 Ga0439457_005960 Ga0439457_005960_400_1053 212
287 3300042015 Ga0439462_0026761 Ga0439462_0026761_609_1262 212
288 3300042125 Ga0450923_040091 Ga0450923_040091_146_799 212
289 3300042156 Ga0439446_0051485 Ga0439446_0051485_197_850 212
290 3300042156 Ga0439446_0149516 Ga0439446_0149516_35_712 212
291 3300042184 Ga0450908_006253 Ga0450908_006253_38_679 212
292 3300042184 Ga0450908_033829 Ga0450908_033829_160_813 212
293 3300042435 Ga0439434_0001306 Ga0439434_0001306_103_744 212
294 3300042435 Ga0439434_0103329 Ga0439434_0103329_246_899 212
295 3300044683 Ga0466965_0070652 Ga0466965_0070652_262_915 212
296 3300044901 Ga0466960_0205682 Ga0466960_0205682_146_799 212
297 3300046454 Ga0495592_0465296 Ga0495592_0465296_23_664 212
298 3300046471 Ga0495650_0061299 Ga0495650_0061299_364_1008 212
299 3300046475 Ga0495639_0004033 Ga0495639_0004033_5385_6026 212
300 3300046533 Ga0495640_0313795 Ga0495640_0313795_303_944 212
301 3300046535 Ga0495586_0199321 Ga0495586_0199321_23_664 212
302 3300046539 Ga0495621_0003186 Ga0495621_0003186_1140_1781 212
303 3300046615 Ga0495656_0000447 Ga0495656_0000447_6719_7360 212
304 3300046674 Ga0495588_0353182 Ga0495588_0353182_107_748 212
305 3300046675 Ga0495657_0099305 Ga0495657_0099305_1002_1640 212
306 3300046809 Ga0495600_0082730 Ga0495600_0082730_1069_1710 212
307 3300047673 Ga0495593_0073206 Ga0495593_0073206_426_1067 212
308 3300048090 Ga0495615_0003743 Ga0495615_0003743_227_868 212
309 3300048904 Ga0496101_0000615 Ga0496101_0000615_7662_8303 212
310 3300048905 Ga0496102_0001349 Ga0496102_0001349_2092_2733 212
311 3300048906 Ga0496103_0021865 Ga0496103_0021865_2713_3354 212
312 3300048907 Ga0496104_0020542 Ga0496104_0020542_2066_2707 212
313 3300048908 Ga0496105_0009353 Ga0496105_0009353_3678_4319 212
314 3300048912 Ga0496109_0419856 Ga0496109_0419856_403_1044 212
315 3300048914 Ga0496111_0030992 Ga0496111_0030992_809_1450 212
316 3300048916 Ga0496113_0319567 Ga0496113_0319567_417_1058 212
317 3300048917 Ga0496114_0107136 Ga0496114_0107136_94_735 212
318 3300048917 Ga0496114_0259914 Ga0496114_0259914_654_1295 212
319 3300048925 Ga0496122_0000528 Ga0496122_0000528_35359_36024 212
320 3300048926 Ga0496123_0000308 Ga0496123_0000308_6053_6718 212
321 3300048926 Ga0496123_0235673 Ga0496123_0235673_135_776 212
322 3300048927 Ga0496124_0059412 Ga0496124_0059412_2450_3115 212
323 3300049679 Ga0501249_011811 Ga0501249_011811_111_752 212
324 3300049705 Ga0501225_0006957 Ga0501225_0006957_146_787 212
325 3300049759 Ga0501262_001122 Ga0501262_001122_222_863 212
326 3300049823 Ga0501044_0029079 Ga0501044_0029079_3040_3681 212
327 3300050489 nmdc:mga03683_12784_c1 nmdc:mga03683_12784_c1_357_1010 212
328 3300050489 nmdc:mga03683_95848_c1 nmdc:mga03683_95848_c1_290_931 212
329 3300050490 nmdc:mga03n38_8821_c1 nmdc:mga03n38_8821_c1_1610_2251 212
330 3300050493 nmdc:mga0k408_183752_c1 nmdc:mga0k408_183752_c1_409_1155 212
331 3300050493 nmdc:mga0k408_23438_c1 nmdc:mga0k408_23438_c1_1102_1743 212
332 3300050496 nmdc:mga07m45_49159_c1 nmdc:mga07m45_49159_c1_1660_2301 212
333 3300050496 nmdc:mga07m45_56174_c1 nmdc:mga07m45_56174_c1_514_1167 212
334 3300050496 nmdc:mga07m45_683_c1 nmdc:mga07m45_683_c1_1411_2052 212
335 3300053087 Ga0500643_001716 Ga0500643_001716_1751_2401 212
336 3300053118 Ga0500594_0068327 Ga0500594_0068327_183_848 212
337 3300053136 Ga0500559_0004582 Ga0500559_0004582_668_1333 212
338 3300053136 Ga0500559_0026998 Ga0500559_0026998_185_850 212
339 3300053140 Ga0500573_0084104 Ga0500573_0084104_569_1234 212
340 iso_pu_bacteria 2643221628 2644162487 212
341 3300005548 Ga0070665_100194799 Ga0070665_1001947992 213
342 3300009093 Ga0105240_10096110 Ga0105240_100961103 213
343 3300009553 Ga0105249_10169344 Ga0105249_101693441 213
344 3300025961 Ga0207712_10836371 Ga0207712_108363711 213
345 3300028379 Ga0268266_10030458 Ga0268266_100304584 213
346 3300035113 Ga0373936_0017773 Ga0373936_0017773_85_726 213
347 3300003316 rootH1_10133818 rootH1_101338185 214
348 3300005335 Ga0070666_10078043 Ga0070666_100780432 214
349 3300005530 Ga0070679_100154181 Ga0070679_1001541812 214
350 3300005563 Ga0068855_100084349 Ga0068855_1000843492 214
351 3300005577 Ga0068857_100402912 Ga0068857_1004029122 214
352 3300005617 Ga0068859_100033938 Ga0068859_1000339387 214
353 3300005841 Ga0068863_100001655 Ga0068863_10000165512 214
354 3300005843 Ga0068860_100000352 Ga0068860_10000035211 214
355 3300009093 Ga0105240_10010103 Ga0105240_100101036 214
356 3300009093 Ga0105240_10334637 Ga0105240_103346372 214
357 3300009545 Ga0105237_10082802 Ga0105237_100828026 214
358 3300009545 Ga0105237_10255457 Ga0105237_102554571 214
359 3300009545 Ga0105237_10571375 Ga0105237_105713751 214
360 3300009545 Ga0105237_10693194 Ga0105237_106931942 214
361 3300010375 Ga0105239_10243310 Ga0105239_102433102 214
362 3300011119 Ga0105246_10410322 Ga0105246_104103222 214
363 3300013105 Ga0157369_10380620 Ga0157369_103806202 214
364 3300014968 Ga0157379_10056147 Ga0157379_100561474 214
365 3300014968 Ga0157379_10215828 Ga0157379_102158282 214
366 3300014969 Ga0157376_11127410 Ga0157376_111274101 214
367 3300025903 Ga0207680_10089377 Ga0207680_100893772 214
368 3300025914 Ga0207671_10375621 Ga0207671_103756211 214
369 3300025961 Ga0207712_10125354 Ga0207712_101253543 214
370 3300025986 Ga0207658_10155842 Ga0207658_101558421 214
371 3300026041 Ga0207639_10028438 Ga0207639_100284384 214
372 3300026067 Ga0207678_10040725 Ga0207678_100407254 214
373 3300026088 Ga0207641_10000220 Ga0207641_100002209 214
374 3300026116 Ga0207674_10252648 Ga0207674_102526482 214
375 3300028381 Ga0268264_10000085 Ga0268264_10000085141 214
376 3300030521 Ga0307511_10000204 Ga0307511_100002048 214
377 3300030521 Ga0307511_10044022 Ga0307511_100440221 214
378 3300033180 Ga0307510_10158236 Ga0307510_101582364 214
379 3300035113 Ga0373936_0021254 Ga0373936_0021254_956_1600 214
380 3300037068 Ga0373925_0377024 Ga0373925_0377024_318_962 214
381 3300046507 Ga0495606_0090125 Ga0495606_0090125_839_1483 214
382 3300046507 Ga0495606_0199609 Ga0495606_0199609_232_876 214
383 3300046522 Ga0495643_0112580 Ga0495643_0112580_44_694 214
384 3300048911 Ga0496108_0334017 Ga0496108_0334017_636_1280 214
385 3300049568 Ga0501031_0122545 Ga0501031_0122545_133_777 214
386 3300049572 Ga0501036_0334203 Ga0501036_0334203_610_1254 214
387 3300049574 Ga0501038_0008445 Ga0501038_0008445_3809_4453 214
388 3300049576 Ga0501040_0009943 Ga0501040_0009943_3608_4252 214
389 3300049577 Ga0501041_0000704 Ga0501041_0000704_2137_2781 214
390 3300049578 Ga0501042_0120419 Ga0501042_0120419_91_735 214
391 3300049579 Ga0501043_0100361 Ga0501043_0100361_552_1196 214
392 3300049580 Ga0501046_0517164 Ga0501046_0517164_135_779 214
393 3300049582 Ga0501048_0002870 Ga0501048_0002870_122_766 214
394 3300049587 Ga0501071_0000259 Ga0501071_0000259_19942_20586 214
395 3300049588 Ga0501072_0009981 Ga0501072_0009981_3984_4628 214
396 3300049589 Ga0501073_0202314 Ga0501073_0202314_18_662 214
397 3300049590 Ga0501074_0025247 Ga0501074_0025247_164_808 214
398 3300049591 Ga0501075_0000327 Ga0501075_0000327_7715_8359 214
399 3300049592 Ga0501076_0000933 Ga0501076_0000933_18273_18917 214
400 3300049593 Ga0501077_0000838 Ga0501077_0000838_6636_7280 214
401 3300049742 Ga0501080_0056134 Ga0501080_0056134_1085_1729 214
402 3300049743 Ga0501081_0000101 Ga0501081_0000101_24036_24680 214
403 3300049744 Ga0501083_0087503 Ga0501083_0087503_1378_2022 214
404 3300049822 Ga0501035_0097677 Ga0501035_0097677_968_1612 214
405 3300049824 Ga0501045_0000042 Ga0501045_0000042_31206_31850 214
406 3300053178 Ga0500637_0008735 Ga0500637_0008735_376_1020 214
407 3300060353 Ga0501082_0002064 Ga0501082_0002064_16871_17515 214
408 3300061734 Ga0530510_0005036 Ga0530510_0005036_8265_8909 214
409 3300003187 JGI25151J46595_10001315 JGI25151J46595_100013152 215
410 3300003187 JGI25151J46595_10012244 JGI25151J46595_100122442 215
411 3300003187 JGI25151J46595_10033570 JGI25151J46595_100335703 215
412 3300003187 JGI25151J46595_10050360 JGI25151J46595_100503602 215
413 3300003771 Ga0055526_1006460 Ga0055526_10064602 215
414 3300003771 Ga0055526_1011270 Ga0055526_10112704 215
415 3300003771 Ga0055526_1011588 Ga0055526_10115882 215
416 3300003773 Ga0055537_1002374 Ga0055537_10023742 215
417 3300003775 Ga0055524_1002073 Ga0055524_10020732 215
418 3300003775 Ga0055524_1002149 Ga0055524_10021499 215
419 3300003775 Ga0055524_1005230 Ga0055524_10052304 215
420 3300003781 Ga0055536_1000134 Ga0055536_100013440 215
421 3300003911 JGI25405J52794_10026279 JGI25405J52794_100262792 215
422 3300005331 Ga0070670_100077817 Ga0070670_1000778174 215
423 3300005333 Ga0070677_10002180 Ga0070677_100021804 215
424 3300005333 Ga0070677_10009441 Ga0070677_100094411 215
425 3300005333 Ga0070677_10058777 Ga0070677_100587772 215
426 3300005333 Ga0070677_10079016 Ga0070677_100790162 215
427 3300005334 Ga0068869_100144889 Ga0068869_1001448892 215
428 3300005334 Ga0068869_100151206 Ga0068869_1001512062 215
429 3300005335 Ga0070666_10224387 Ga0070666_102243871 215
430 3300005337 Ga0070682_100050330 Ga0070682_1000503302 215
431 3300005337 Ga0070682_100087118 Ga0070682_1000871182 215
432 3300005340 Ga0070689_100009734 Ga0070689_1000097344 215
433 3300005340 Ga0070689_100237675 Ga0070689_1002376752 215
434 3300005343 Ga0070687_100227937 Ga0070687_1002279372 215
435 3300005347 Ga0070668_100125872 Ga0070668_1001258722 215
436 3300005353 Ga0070669_100036006 Ga0070669_1000360062 215
437 3300005353 Ga0070669_100155024 Ga0070669_1001550242 215
438 3300005354 Ga0070675_100036826 Ga0070675_1000368265 215
439 3300005354 Ga0070675_100173756 Ga0070675_1001737562 215
440 3300005355 Ga0070671_100017879 Ga0070671_1000178792 215
441 3300005355 Ga0070671_100160249 Ga0070671_1001602492 215
442 3300005356 Ga0070674_100601823 Ga0070674_1006018231 215
443 3300005364 Ga0070673_100037901 Ga0070673_1000379012 215
444 3300005364 Ga0070673_100076732 Ga0070673_1000767323 215
445 3300005364 Ga0070673_100258377 Ga0070673_1002583772 215
446 3300005365 Ga0070688_100013923 Ga0070688_1000139234 215
447 3300005365 Ga0070688_100169592 Ga0070688_1001695921 215
448 3300005366 Ga0070659_100510818 Ga0070659_1005108182 215
449 3300005367 Ga0070667_100003282 Ga0070667_10000328210 215
450 3300005367 Ga0070667_100437812 Ga0070667_1004378121 215
451 3300005367 Ga0070667_100562324 Ga0070667_1005623241 215
452 3300005437 Ga0070710_10077947 Ga0070710_100779472 215
453 3300005438 Ga0070701_10008786 Ga0070701_100087863 215
454 3300005438 Ga0070701_10327546 Ga0070701_103275462 215
455 3300005440 Ga0070705_100005227 Ga0070705_1000052274 215
456 3300005441 Ga0070700_100125901 Ga0070700_1001259012 215
457 3300005444 Ga0070694_100223654 Ga0070694_1002236542 215
458 3300005455 Ga0070663_100490115 Ga0070663_1004901152 215
459 3300005456 Ga0070678_100016367 Ga0070678_1000163675 215
460 3300005456 Ga0070678_100083737 Ga0070678_1000837372 215
461 3300005457 Ga0070662_100216883 Ga0070662_1002168832 215
462 3300005459 Ga0068867_100129759 Ga0068867_1001297593 215
463 3300005459 Ga0068867_100256625 Ga0068867_1002566252 215
464 3300005466 Ga0070685_10093852 Ga0070685_100938521 215
465 3300005543 Ga0070672_100011769 Ga0070672_1000117694 215
466 3300005544 Ga0070686_100116084 Ga0070686_1001160842 215
467 3300005544 Ga0070686_100229536 Ga0070686_1002295362 215
468 3300005544 Ga0070686_100317857 Ga0070686_1003178572 215
469 3300005544 Ga0070686_100570790 Ga0070686_1005707901 215
470 3300005548 Ga0070665_100009448 Ga0070665_1000094483 215
471 3300005548 Ga0070665_100078675 Ga0070665_1000786752 215
472 3300005564 Ga0070664_100493733 Ga0070664_1004937332 215
473 3300005577 Ga0068857_100545827 Ga0068857_1005458272 215
474 3300005615 Ga0070702_100003060 Ga0070702_1000030603 215
475 3300005615 Ga0070702_100197898 Ga0070702_1001978982 215
476 3300005617 Ga0068859_100023183 Ga0068859_1000231834 215
477 3300005617 Ga0068859_100078513 Ga0068859_1000785132 215
478 3300005618 Ga0068864_100130659 Ga0068864_1001306592 215
479 3300005618 Ga0068864_100223102 Ga0068864_1002231022 215
480 3300005718 Ga0068866_10121036 Ga0068866_101210362 215
481 3300005719 Ga0068861_100002771 Ga0068861_1000027714 215
482 3300005719 Ga0068861_100012331 Ga0068861_1000123317 215
483 3300005719 Ga0068861_100065622 Ga0068861_1000656223 215
484 3300005719 Ga0068861_100154388 Ga0068861_1001543882 215
485 3300005840 Ga0068870_10014301 Ga0068870_100143012 215
486 3300005841 Ga0068863_100026854 Ga0068863_1000268546 215
487 3300005841 Ga0068863_100027758 Ga0068863_1000277584 215
488 3300005841 Ga0068863_100148415 Ga0068863_1001484152 215
489 3300005841 Ga0068863_100172003 Ga0068863_1001720032 215
490 3300005842 Ga0068858_100059603 Ga0068858_1000596033 215
491 3300005843 Ga0068860_100082498 Ga0068860_1000824983 215
492 3300005843 Ga0068860_100176046 Ga0068860_1001760462 215
493 3300005844 Ga0068862_100017956 Ga0068862_1000179564 215
494 3300005844 Ga0068862_100037840 Ga0068862_1000378405 215
495 3300005937 Ga0081455_10003238 Ga0081455_100032383 215
496 3300006163 Ga0070715_10018837 Ga0070715_100188373 215
497 3300006237 Ga0097621_100044687 Ga0097621_1000446874 215
498 3300006237 Ga0097621_100111737 Ga0097621_1001117372 215
499 3300006237 Ga0097621_100211831 Ga0097621_1002118312 215
500 3300006237 Ga0097621_100303561 Ga0097621_1003035612 215
501 3300006358 Ga0068871_100139323 Ga0068871_1001393233 215
502 3300006358 Ga0068871_100182191 Ga0068871_1001821912 215
503 3300006881 Ga0068865_100118688 Ga0068865_1001186883 215
504 3300006931 Ga0097620_100023183 Ga0097620_1000231834 215
505 3300006931 Ga0097620_100078513 Ga0097620_1000785134 215
506 3300009092 Ga0105250_10165335 Ga0105250_101653352 215
507 3300009094 Ga0111539_10090632 Ga0111539_100906322 215
508 3300009148 Ga0105243_10075987 Ga0105243_100759873 215
509 3300009176 Ga0105242_10110763 Ga0105242_101107633 215
510 3300009177 Ga0105248_10125024 Ga0105248_101250245 215
511 3300009177 Ga0105248_10143254 Ga0105248_101432542 215
512 3300009553 Ga0105249_10081128 Ga0105249_100811282 215
513 3300009553 Ga0105249_10150774 Ga0105249_101507742 215
514 3300009553 Ga0105249_10697664 Ga0105249_106976642 215
515 3300013296 Ga0157374_10354885 Ga0157374_103548852 215
516 3300013306 Ga0163162_10036725 Ga0163162_100367252 215
517 3300014325 Ga0163163_10111580 Ga0163163_101115803 215
518 3300014325 Ga0163163_10509312 Ga0163163_105093122 215
519 3300014326 Ga0157380_10014739 Ga0157380_100147394 215
520 3300014326 Ga0157380_10118101 Ga0157380_101181012 215
521 3300014326 Ga0157380_10390186 Ga0157380_103901862 215
522 3300014326 Ga0157380_10444257 Ga0157380_104442572 215
523 3300014745 Ga0157377_10184960 Ga0157377_101849602 215
524 3300014969 Ga0157376_10036462 Ga0157376_100364622 215
525 3300017792 Ga0163161_10066534 Ga0163161_100665342 215
526 3300025263 Ga0209565_1000104 Ga0209565_100010430 215
527 3300025263 Ga0209565_1012602 Ga0209565_10126022 215
528 3300025273 Ga0209673_1050262 Ga0209673_10502622 215
529 3300025291 Ga0209675_1000191 Ga0209675_10001916 215
530 3300025291 Ga0209675_1002151 Ga0209675_10021515 215
531 3300025292 Ga0209676_1000036 Ga0209676_1000036400 215
532 3300025294 Ga0209025_1000618 Ga0209025_100061857 215
533 3300025294 Ga0209025_1000905 Ga0209025_100090544 215
534 3300025294 Ga0209025_1001806 Ga0209025_100180613 215
535 3300025294 Ga0209025_1002048 Ga0209025_10020486 215
536 3300025294 Ga0209025_1032618 Ga0209025_10326182 215
537 3300025295 Ga0209564_1000688 Ga0209564_10006886 215
538 3300025295 Ga0209564_1002275 Ga0209564_10022759 215
539 3300025295 Ga0209564_1004020 Ga0209564_10040202 215
540 3300025299 Ga0209256_1001092 Ga0209256_10010926 215
541 3300025299 Ga0209256_1001334 Ga0209256_100133429 215
542 3300025303 Ga0209051_1034250 Ga0209051_10342502 215
543 3300025315 Ga0207697_10044152 Ga0207697_100441522 215
544 3300025893 Ga0207682_10016438 Ga0207682_100164383 215
545 3300025898 Ga0207692_10034308 Ga0207692_100343083 215
546 3300025899 Ga0207642_10010527 Ga0207642_100105274 215
547 3300025900 Ga0207710_10065772 Ga0207710_100657722 215
548 3300025905 Ga0207685_10034844 Ga0207685_100348443 215
549 3300025907 Ga0207645_10075149 Ga0207645_100751492 215
550 3300025907 Ga0207645_10196479 Ga0207645_101964792 215
551 3300025908 Ga0207643_10006811 Ga0207643_100068112 215
552 3300025908 Ga0207643_10224950 Ga0207643_102249502 215
553 3300025909 Ga0207705_10395394 Ga0207705_103953942 215
554 3300025916 Ga0207663_10170254 Ga0207663_101702542 215
555 3300025923 Ga0207681_10038443 Ga0207681_100384434 215
556 3300025925 Ga0207650_10092759 Ga0207650_100927592 215
557 3300025925 Ga0207650_10110545 Ga0207650_101105452 215
558 3300025926 Ga0207659_10142081 Ga0207659_101420812 215
559 3300025931 Ga0207644_10025817 Ga0207644_100258176 215
560 3300025932 Ga0207690_10422637 Ga0207690_104226372 215
561 3300025933 Ga0207706_10159377 Ga0207706_101593772 215
562 3300025933 Ga0207706_10278766 Ga0207706_102787662 215
563 3300025934 Ga0207686_10144954 Ga0207686_101449542 215
564 3300025936 Ga0207670_10007762 Ga0207670_100077623 215
565 3300025936 Ga0207670_10127680 Ga0207670_101276802 215
566 3300025937 Ga0207669_10036486 Ga0207669_100364862 215
567 3300025937 Ga0207669_10474145 Ga0207669_104741452 215
568 3300025938 Ga0207704_10087298 Ga0207704_100872983 215
569 3300025938 Ga0207704_10168775 Ga0207704_101687753 215
570 3300025940 Ga0207691_10054210 Ga0207691_100542102 215
571 3300025940 Ga0207691_10076499 Ga0207691_100764992 215
572 3300025941 Ga0207711_10259202 Ga0207711_102592021 215
573 3300025941 Ga0207711_10547107 Ga0207711_105471072 215
574 3300025942 Ga0207689_10016545 Ga0207689_100165454 215
575 3300025942 Ga0207689_10057396 Ga0207689_100573962 215
576 3300025942 Ga0207689_10097032 Ga0207689_100970322 215
577 3300025945 Ga0207679_10171546 Ga0207679_101715462 215
578 3300025945 Ga0207679_10354027 Ga0207679_103540272 215
579 3300025945 Ga0207679_10461742 Ga0207679_104617422 215
580 3300025960 Ga0207651_10048287 Ga0207651_100482873 215
581 3300025960 Ga0207651_10055295 Ga0207651_100552952 215
582 3300025960 Ga0207651_10416899 Ga0207651_104168991 215
583 3300025961 Ga0207712_10160789 Ga0207712_101607891 215
584 3300025961 Ga0207712_10346706 Ga0207712_103467062 215
585 3300025961 Ga0207712_10358595 Ga0207712_103585952 215
586 3300025972 Ga0207668_10370625 Ga0207668_103706252 215
587 3300025981 Ga0207640_10252927 Ga0207640_102529272 215
588 3300025986 Ga0207658_10020449 Ga0207658_100204492 215
589 3300025986 Ga0207658_10441742 Ga0207658_104417421 215
590 3300026035 Ga0207703_10050354 Ga0207703_100503543 215
591 3300026067 Ga0207678_10693110 Ga0207678_106931101 215
592 3300026075 Ga0207708_10124925 Ga0207708_101249252 215
593 3300026075 Ga0207708_10550955 Ga0207708_105509552 215
594 3300026075 Ga0207708_10868864 Ga0207708_108688641 215
595 3300026088 Ga0207641_10011553 Ga0207641_100115534 215
596 3300026088 Ga0207641_10023632 Ga0207641_100236326 215
597 3300026088 Ga0207641_10177959 Ga0207641_101779592 215
598 3300026088 Ga0207641_10246056 Ga0207641_102460562 215
599 3300026089 Ga0207648_10018789 Ga0207648_100187894 215
600 3300026089 Ga0207648_10166894 Ga0207648_101668942 215
601 3300026089 Ga0207648_10241358 Ga0207648_102413582 215
602 3300026095 Ga0207676_10080152 Ga0207676_100801524 215
603 3300026095 Ga0207676_10382768 Ga0207676_103827682 215
604 3300026118 Ga0207675_100006319 Ga0207675_1000063194 215
605 3300026118 Ga0207675_100017126 Ga0207675_1000171263 215
606 3300026118 Ga0207675_100056849 Ga0207675_1000568492 215
607 3300026118 Ga0207675_100131421 Ga0207675_1001314213 215
608 3300026118 Ga0207675_100149764 Ga0207675_1001497643 215
609 3300026118 Ga0207675_100778927 Ga0207675_1007789272 215
610 3300026121 Ga0207683_10028026 Ga0207683_100280263 215
611 3300026121 Ga0207683_10130754 Ga0207683_101307542 215
612 3300026121 Ga0207683_10201019 Ga0207683_102010192 215
613 3300028379 Ga0268266_10012248 Ga0268266_100122487 215
614 3300028379 Ga0268266_10039459 Ga0268266_100394597 215
615 3300028379 Ga0268266_10390497 Ga0268266_103904972 215
616 3300028380 Ga0268265_10031142 Ga0268265_100311423 215
617 3300028380 Ga0268265_10233499 Ga0268265_102334992 215
618 3300028380 Ga0268265_10289589 Ga0268265_102895892 215
619 3300028381 Ga0268264_10143108 Ga0268264_101431083 215
620 3300028794 Ga0307515_10237944 Ga0307515_102379442 215
621 3300031456 Ga0307513_10007003 Ga0307513_1000700312 215
622 3300031456 Ga0307513_10016636 Ga0307513_100166369 215
623 3300031456 Ga0307513_10023455 Ga0307513_100234553 215
624 3300031456 Ga0307513_10030889 Ga0307513_100308894 215
625 3300031456 Ga0307513_10036720 Ga0307513_100367202 215
626 3300031456 Ga0307513_10073099 Ga0307513_100730992 215
627 3300031548 Ga0307408_100155137 Ga0307408_1001551373 215
628 3300031731 Ga0307405_10078596 Ga0307405_100785962 215
629 3300031731 Ga0307405_10200097 Ga0307405_102000972 215
630 3300031824 Ga0307413_10014725 Ga0307413_100147254 215
631 3300031852 Ga0307410_10003532 Ga0307410_100035322 215
632 3300031852 Ga0307410_10013410 Ga0307410_100134106 215
633 3300031901 Ga0307406_10082392 Ga0307406_100823922 215
634 3300031903 Ga0307407_10099371 Ga0307407_100993712 215
635 3300031903 Ga0307407_10132987 Ga0307407_101329872 215
636 3300031911 Ga0307412_10370919 Ga0307412_103709192 215
637 3300031911 Ga0307412_10398067 Ga0307412_103980672 215
638 3300031995 Ga0307409_100008635 Ga0307409_1000086354 215
639 3300031995 Ga0307409_100009145 Ga0307409_1000091454 215
640 3300032002 Ga0307416_100099966 Ga0307416_1000999662 215
641 3300032002 Ga0307416_100190129 Ga0307416_1001901292 215
642 3300032126 Ga0307415_100020507 Ga0307415_1000205072 215
643 3300032126 Ga0307415_100090152 Ga0307415_1000901523 215
644 3300035724 Ga0373933_0427957 Ga0373933_0427957_105_755 215
645 3300036401 Ga0373937_0624721 Ga0373937_0624721_160_810 215
646 3300037471 Ga0395905_0441951 Ga0395905_0441951_311_958 215
647 3300041443 Ga0451789_1317359 Ga0451789_1317359_256_906 215
648 3300041452 Ga0451793_0765724 Ga0451793_0765724_394_1044 215
649 3300041459 Ga0451800_0302824 Ga0451800_0302824_1487_2137 215
650 3300041463 Ga0451804_0147506 Ga0451804_0147506_514_1164 215
651 3300041486 Ga0451807_0481750 Ga0451807_0481750_1112_1762 215
652 3300041486 Ga0451807_1209868 Ga0451807_1209868_504_1154 215
653 3300041486 Ga0451807_2367067 Ga0451807_2367067_275_925 215
654 3300041494 Ga0451837_0927674 Ga0451837_0927674_77_727 215
655 3300046457 Ga0495590_0001681 Ga0495590_0001681_1691_2344 215
656 3300046457 Ga0495590_0048960 Ga0495590_0048960_424_1074 215
657 3300046460 Ga0495638_0004727 Ga0495638_0004727_2417_3067 215
658 3300046507 Ga0495606_0066692 Ga0495606_0066692_1303_1956 215
659 3300046519 Ga0495632_0067881 Ga0495632_0067881_195_845 215
660 3300046615 Ga0495656_0160986 Ga0495656_0160986_121_771 215
661 3300046616 Ga0495668_0147327 Ga0495668_0147327_618_1268 215
662 3300046660 Ga0495625_0022933 Ga0495625_0022933_1387_2037 215
663 3300046660 Ga0495625_0051195 Ga0495625_0051195_497_1147 215
664 3300047318 Ga0495636_0005139 Ga0495636_0005139_2450_3097 215
665 3300047320 Ga0495672_0178348 Ga0495672_0178348_176_826 215
666 3300048091 Ga0495626_0097306 Ga0495626_0097306_30_680 215
667 3300048907 Ga0496104_0169197 Ga0496104_0169197_98_745 215
668 3300048915 Ga0496112_0027994 Ga0496112_0027994_4037_4684 215
669 3300048917 Ga0496114_0025835 Ga0496114_0025835_2904_3554 215
670 3300048924 Ga0496121_0027863 Ga0496121_0027863_839_1486 215
671 3300048928 Ga0496125_0005695 Ga0496125_0005695_2569_3216 215
672 3300049571 Ga0501034_0000092 Ga0501034_0000092_125676_126323 215
673 3300049572 Ga0501036_0278548 Ga0501036_0278548_149_799 215
674 3300049572 Ga0501036_0363289 Ga0501036_0363289_527_1177 215
675 3300049576 Ga0501040_0509334 Ga0501040_0509334_96_746 215
676 3300049587 Ga0501071_0036445 Ga0501071_0036445_2211_2861 215
677 3300049588 Ga0501072_0695727 Ga0501072_0695727_24_674 215
678 3300049589 Ga0501073_0009721 Ga0501073_0009721_1384_2034 215
679 3300049593 Ga0501077_0004615 Ga0501077_0004615_55_705 215
680 3300049742 Ga0501080_0061373 Ga0501080_0061373_2106_2756 215
681 3300049744 Ga0501083_0013202 Ga0501083_0013202_19_669 215
682 3300050511 nmdc:mga08y16_114907_c1 nmdc:mga08y16_114907_c1_1388_2038 215
683 3300054114 Ga0501084_0009092 Ga0501084_0009092_1621_2271 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

35

110

0.98

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

44

111

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

39

116

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.964 3 215
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.963 2 215
3niv-assembly1.cif.gz_A the crystal structure of glutathione s-transferase from legionella pneumophila 0.96 4 208
8e8p-assembly1.cif.gz_B gstz1a 0.9592 1 215
2cz2-assembly1.cif.gz_A-2 crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) 0.9584 2 215
ID Description Score Start End Superfamily
4kaeA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9654 86 215 1.20.1050.10
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.962 86 215 1.20.1050.10
6jwkA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9619 86 215 1.20.1050.10
af_Q6DGL3_95_220_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9604 86 215 1.20.1050.10
2cz3A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9582 86 215 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A1F3ZLJ3-F1-model_v4 Maleylacetoacetate isomerase 0.9805 3 215 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A7V7KHR4-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9791 3 211 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A4R6F2N1-F1-model_v4 Maleylacetoacetate isomerase 0.9772 2 215 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A7T8B6B4-F1-model_v4 deleted 0.9772 2 215
AF-A0A0P7XB45-F1-model_v4 Maleylacetoacetate isomerase Mai 0.9764 3 215 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
96.15 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map