F475040

General Info

Members Datasets Scaffolds Average Seq Length
684 240 683 256

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100196804|Ga0068859_1001968042
Length 287
Sequence MSAAGPPQGANFTPSAGSDPAAAVSAEALRDVVHVVKMPVSSARPAAARTLSIRVLRYNPQDPASVPHLEAYELEEADGMTLFIALNEIREKQDPSLQFDFVCRAGICGSCAMIIDGRPGLACRTLTKNLGKEITLAPLPVFELIGDLSVNTGKWMRAMSERLQAWLHAKQAEVDLRRMEERMEPDLAQEIYELDRCIECGCCVAGCGTARMREDFVGAVGLNKIARFRLDPRDTRSDDDFYEVVGNDQGVFGCMSLLACHDVCPKQLPLATQIAFIRRKMAGMGWK

Samples

Sample ID Description Type Environment
1 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
177 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
178 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
181 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 4.09
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10073390 3300005290 Bacteria 4408
2 Ga0065715_10090300 3300005293 Bacteria 7271
3 Ga0065707_10002989 3300005295 Bacteria 10649
4 Ga0070658_10441387 3300005327 Bacteria 1121
5 Ga0070676_10024944 3300005328 Bacteria 3374
6 Ga0070676_10145080 3300005328 Bacteria 1514
7 Ga0070676_10171557 3300005328 Bacteria 1403
8 Ga0070676_10191223 3300005328 Bacteria 1336
9 Ga0070683_100018349 3300005329 Bacteria 6194
10 Ga0070690_100016596 3300005330 Bacteria 4415
11 Ga0070690_100103823 3300005330 Bacteria 1887
12 Ga0070670_100005270 3300005331 Bacteria 10892
13 Ga0070670_100008262 3300005331 Bacteria 8863
14 Ga0070670_100052530 3300005331 Bacteria 3500
15 Ga0070670_100105972 3300005331 Bacteria 2422
16 Ga0070670_100268014 3300005331 Bacteria 1490
17 Ga0070670_100302880 3300005331 Bacteria 1398
18 Ga0068869_100037516 3300005334 Bacteria 3446
19 Ga0068869_100147098 3300005334 Bacteria 1824
20 Ga0068869_100183496 3300005334 Bacteria 1641
21 Ga0068869_100183614 3300005334 Bacteria 1641
22 Ga0070666_10039066 3300005335 Bacteria 3161
23 Ga0070666_10081066 3300005335 Bacteria 2218
24 Ga0070680_100115060 3300005336 Bacteria 2241
25 Ga0068868_100037364 3300005338 Bacteria 3764
26 Ga0068868_100159883 3300005338 Bacteria 1860
27 Ga0068868_100546299 3300005338 Bacteria 1020
28 Ga0070660_100033125 3300005339 Bacteria 3892
29 Ga0070660_100102423 3300005339 Bacteria 2269
30 Ga0070660_100338109 3300005339 Bacteria 1239
31 Ga0070689_100001097 3300005340 Bacteria 16989
32 Ga0070689_100195965 3300005340 Unclassified 1647
33 Ga0070689_100305178 3300005340 Bacteria 1326
34 Ga0070689_100575908 3300005340 Bacteria 973
35 Ga0070687_100115915 3300005343 Bacteria 1524
36 Ga0070661_100034438 3300005344 Bacteria 3672
37 Ga0070661_100044811 3300005344 Bacteria 3232
38 Ga0070661_100057128 3300005344 Bacteria 2859
39 Ga0070661_100183319 3300005344 Bacteria 1593
40 Ga0070661_100251150 3300005344 Bacteria 1365
41 Ga0070692_10108701 3300005345 Bacteria 1531
42 Ga0070668_100004282 3300005347 Bacteria 10588
43 Ga0070668_100036551 3300005347 Bacteria 3749
44 Ga0070668_100086662 3300005347 Bacteria 2463
45 Ga0070668_100128244 3300005347 Bacteria 2034
46 Ga0070668_100513743 3300005347 Bacteria 1038
47 Ga0070669_100010576 3300005353 Bacteria 6552
48 Ga0070669_100021621 3300005353 Bacteria 4598
49 Ga0070669_100026606 3300005353 Bacteria 4163
50 Ga0070669_100026890 3300005353 Bacteria 4140
51 Ga0070669_100047459 3300005353 Bacteria 3133
52 Ga0070669_100051584 3300005353 Bacteria 3008
53 Ga0070669_100192226 3300005353 Bacteria 1601
54 Ga0070669_100357018 3300005353 Bacteria 1188
55 Ga0070669_100598449 3300005353 Bacteria 923
56 Ga0070675_100023093 3300005354 Bacteria 4970
57 Ga0070675_100029309 3300005354 Bacteria 4438
58 Ga0070675_100057032 3300005354 Bacteria 3220
59 Ga0070675_100060926 3300005354 Bacteria 3115
60 Ga0070675_100074333 3300005354 Bacteria 2823
61 Ga0070675_100286706 3300005354 Bacteria 1448
62 Ga0070675_100308031 3300005354 Bacteria 1397
63 Ga0070671_100002596 3300005355 Bacteria 13991
64 Ga0070671_100146443 3300005355 Bacteria 1993
65 Ga0070674_100060954 3300005356 Bacteria 2631
66 Ga0070674_100081267 3300005356 Bacteria 2316
67 Ga0070673_100027623 3300005364 Bacteria 4209
68 Ga0070673_100033558 3300005364 Bacteria 3878
69 Ga0070673_100068132 3300005364 Bacteria 2849
70 Ga0070673_100080367 3300005364 Bacteria 2641
71 Ga0070673_100146997 3300005364 Bacteria 1993
72 Ga0070688_100007046 3300005365 Bacteria 6046
73 Ga0070688_100208915 3300005365 Bacteria 1370
74 Ga0070688_100296548 3300005365 Bacteria 1167
75 Ga0070659_100055933 3300005366 Bacteria 3110
76 Ga0070667_100006493 3300005367 Bacteria 9724
77 Ga0070667_100017624 3300005367 Bacteria 5916
78 Ga0070667_100038224 3300005367 Bacteria 4024
79 Ga0070667_100048343 3300005367 Bacteria 3580
80 Ga0070667_100111613 3300005367 Bacteria 2372
81 Ga0070667_100227246 3300005367 Bacteria 1663
82 Ga0070701_10041544 3300005438 Bacteria 2344
83 Ga0070701_10085273 3300005438 Bacteria 1719
84 Ga0070701_10132072 3300005438 Bacteria 1419
85 Ga0070705_100170128 3300005440 Bacteria 1466
86 Ga0070700_100273925 3300005441 Bacteria 1221
87 Ga0070694_100182860 3300005444 Bacteria 1551
88 Ga0070694_100252878 3300005444 Bacteria 1334
89 Ga0070663_100269744 3300005455 Bacteria 1352
90 Ga0070678_100034019 3300005456 Bacteria 3545
91 Ga0070678_100169720 3300005456 Bacteria 1776
92 Ga0070678_100184479 3300005456 Bacteria 1711
93 Ga0070678_100312141 3300005456 Bacteria 1340
94 Ga0070678_100436060 3300005456 Bacteria 1145
95 Ga0070678_100615453 3300005456 Bacteria 971
96 Ga0070662_100009881 3300005457 Bacteria 6251
97 Ga0070662_100054467 3300005457 Bacteria 2899
98 Ga0070662_100103759 3300005457 Bacteria 2156
99 Ga0070662_100137326 3300005457 Bacteria 1891
100 Ga0070662_100244374 3300005457 Bacteria 1440
101 Ga0070681_10052249 3300005458 Bacteria 4075
102 Ga0070681_10068041 3300005458 Bacteria 3529
103 Ga0070681_10108695 3300005458 Bacteria 2713
104 Ga0068867_100090086 3300005459 Bacteria 2326
105 Ga0068867_100101704 3300005459 Bacteria 2196
106 Ga0068867_100197851 3300005459 Bacteria 1607
107 Ga0068867_100676758 3300005459 Bacteria 908
108 Ga0070685_10148130 3300005466 Bacteria 1485
109 Ga0070685_10157165 3300005466 Bacteria 1446
110 Ga0070698_100202045 3300005471 Bacteria 1923
111 Ga0070679_100145092 3300005530 Bacteria 2351
112 Ga0070679_100303600 3300005530 Bacteria 1547
113 Ga0070684_100063752 3300005535 Bacteria 3231
114 Ga0070684_100185049 3300005535 Bacteria 1894
115 Ga0070684_100327121 3300005535 Bacteria 1408
116 Ga0068853_100040526 3300005539 Bacteria 3974
117 Ga0068853_100254461 3300005539 Bacteria 1613
118 Ga0070672_100004002 3300005543 Bacteria 9608
119 Ga0070672_100031647 3300005543 Bacteria 3984
120 Ga0070672_100046716 3300005543 Bacteria 3355
121 Ga0070672_100057437 3300005543 Bacteria 3055
122 Ga0070672_100076620 3300005543 Bacteria 2672
123 Ga0070672_100120559 3300005543 Bacteria 2146
124 Ga0070686_100025228 3300005544 Bacteria 3574
125 Ga0070686_100054663 3300005544 Bacteria 2555
126 Ga0070686_100150390 3300005544 Bacteria 1630
127 Ga0070695_100044604 3300005545 Bacteria 2824
128 Ga0070695_100226665 3300005545 Bacteria 1349
129 Ga0070695_100616149 3300005545 Bacteria 853
130 Ga0070696_100013077 3300005546 Bacteria 5568
131 Ga0070665_100005511 3300005548 Bacteria 13028
132 Ga0070665_100058191 3300005548 Bacteria 3875
133 Ga0070665_100169020 3300005548 Bacteria 2188
134 Ga0070665_100199078 3300005548 Bacteria 2004
135 Ga0070665_100345972 3300005548 Bacteria 1492
136 Ga0070704_100080749 3300005549 Bacteria 2393
137 Ga0070704_100772794 3300005549 Bacteria 857
138 Ga0068855_100102065 3300005563 Bacteria 3301
139 Ga0068855_100224946 3300005563 Bacteria 2103
140 Ga0070664_100070501 3300005564 Bacteria 2993
141 Ga0070664_100317291 3300005564 Bacteria 1411
142 Ga0070664_100543863 3300005564 Bacteria 1073
143 Ga0068857_100042247 3300005577 Bacteria 4043
144 Ga0068857_100074294 3300005577 Bacteria 3029
145 Ga0068857_100378644 3300005577 Bacteria 1314
146 Ga0068854_100046269 3300005578 Bacteria 3097
147 Ga0068854_100096339 3300005578 Bacteria 2211
148 Ga0068854_100427723 3300005578 Bacteria 1101
149 Ga0070702_100030857 3300005615 Bacteria 2926
150 Ga0068852_100007226 3300005616 Bacteria 8100
151 Ga0068852_100144045 3300005616 Bacteria 2208
152 Ga0068859_100004393 3300005617 Bacteria 14383
153 Ga0068859_100196804 3300005617 Bacteria 2100
154 Ga0068859_100319519 3300005617 Bacteria 1646
155 Ga0068864_100002253 3300005618 Bacteria 15949
156 Ga0068864_100002433 3300005618 Bacteria 15392
157 Ga0068864_100087853 3300005618 Bacteria 2737
158 Ga0068864_100142329 3300005618 Bacteria 2165
159 Ga0068864_100430929 3300005618 Bacteria 1258
160 Ga0068866_10003907 3300005718 Bacteria 6117
161 Ga0068861_100037111 3300005719 Bacteria 3622
162 Ga0068861_100067854 3300005719 Bacteria 2754
163 Ga0068861_100126473 3300005719 Bacteria 2068
164 Ga0068861_100282217 3300005719 Bacteria 1431
165 Ga0068851_10010569 3300005834 Bacteria 4310
166 Ga0068851_10029828 3300005834 Bacteria 2702
167 Ga0068851_10283706 3300005834 Bacteria 948
168 Ga0068870_10049727 3300005840 Bacteria 2213
169 Ga0068870_10169802 3300005840 Bacteria 1301
170 Ga0068863_100006387 3300005841 Bacteria 11561
171 Ga0068863_100028525 3300005841 Bacteria 5330
172 Ga0068863_100051893 3300005841 Bacteria 3887
173 Ga0068863_100080259 3300005841 Bacteria 3090
174 Ga0068863_100110976 3300005841 Bacteria 2612
175 Ga0068863_100208406 3300005841 Bacteria 1882
176 Ga0068863_100454908 3300005841 Bacteria 1257
177 Ga0068858_100005933 3300005842 Bacteria 11926
178 Ga0068858_100014006 3300005842 Bacteria 7566
179 Ga0068858_100148739 3300005842 Bacteria 2201
180 Ga0068858_100283902 3300005842 Bacteria 1576
181 Ga0068860_100011123 3300005843 Bacteria 8865
182 Ga0068860_100019589 3300005843 Bacteria 6561
183 Ga0068860_100021053 3300005843 Bacteria 6318
184 Ga0068860_100077769 3300005843 Bacteria 3156
185 Ga0068860_100114044 3300005843 Bacteria 2584
186 Ga0068860_100268498 3300005843 Bacteria 1664
187 Ga0068860_100317981 3300005843 Bacteria 1527
188 Ga0068862_100141802 3300005844 Bacteria 2133
189 Ga0068862_100210286 3300005844 Bacteria 1757
190 Ga0068862_100399305 3300005844 Bacteria 1286
191 Ga0068862_100486870 3300005844 Bacteria 1168
192 Ga0081538_10002640 3300005981 Bacteria 17308
193 Ga0081538_10041681 3300005981 Bacteria 2909
194 Ga0070712_100015334 3300006175 Bacteria 4932
195 Ga0075369_10053566 3300006186 Bacteria 1751
196 Ga0075366_10000429 3300006195 Bacteria 19662
197 Ga0097621_100018546 3300006237 Bacteria 5319
198 Ga0097621_100113172 3300006237 Bacteria 2295
199 Ga0097621_100130415 3300006237 Bacteria 2140
200 Ga0068871_100026413 3300006358 Bacteria 4531
201 Ga0068871_100085925 3300006358 Bacteria 2613
202 Ga0075428_100001720 3300006844 Bacteria 23394
203 Ga0075428_100016022 3300006844 Bacteria 8290
204 Ga0075428_100131517 3300006844 Bacteria 2722
205 Ga0075428_100186313 3300006844 Bacteria 2246
206 Ga0075431_100000325 3300006847 Bacteria 37691
207 Ga0075431_100003569 3300006847 Bacteria 15068
208 Ga0075433_10002325 3300006852 Bacteria 14474
209 Ga0075433_10018745 3300006852 Bacteria 5758
210 Ga0075433_10047154 3300006852 Bacteria 3748
211 Ga0075433_10056426 3300006852 Bacteria 3430
212 Ga0075433_10084371 3300006852 Bacteria 2804
213 Ga0075433_10148791 3300006852 Bacteria 2082
214 Ga0075433_10406666 3300006852 Bacteria 1201
215 Ga0075434_100002836 3300006871 Bacteria 15354
216 Ga0075434_100008905 3300006871 Bacteria 9342
217 Ga0075434_100017855 3300006871 Bacteria 6844
218 Ga0075434_100019818 3300006871 Bacteria 6512
219 Ga0075434_100078105 3300006871 Bacteria 3305
220 Ga0075434_100251306 3300006871 Bacteria 1787
221 Ga0075434_100440200 3300006871 Bacteria 1324
222 Ga0075429_100049199 3300006880 Bacteria 3666
223 Ga0068865_100006814 3300006881 Bacteria 6996
224 Ga0068865_100183086 3300006881 Bacteria 1615
225 Ga0068865_100502931 3300006881 Bacteria 1011
226 Ga0075436_100029694 3300006914 Bacteria 3760
227 Ga0097620_100004393 3300006931 Bacteria 14383
228 Ga0097620_100196804 3300006931 Bacteria 2100
229 Ga0097620_100319536 3300006931 Bacteria 1646
230 Ga0075435_100015332 3300007076 Bacteria 5759
231 Ga0075435_100037701 3300007076 Bacteria 3850
232 Ga0075435_100090484 3300007076 Bacteria 2524
233 Ga0075435_100199113 3300007076 Bacteria 1697
234 Ga0105240_10237501 3300009093 Bacteria 2114
235 Ga0111539_10000087 3300009094 Bacteria 95344
236 Ga0111539_10008130 3300009094 Bacteria 13365
237 Ga0111539_10034034 3300009094 Bacteria 6182
238 Ga0111539_10042845 3300009094 Bacteria 5431
239 Ga0111539_10170719 3300009094 Bacteria 2541
240 Ga0111539_10256629 3300009094 Bacteria 2036
241 Ga0111539_10576345 3300009094 Bacteria 1311
242 Ga0111539_10814899 3300009094 Bacteria 1086
243 Ga0105245_10064970 3300009098 Bacteria 3299
244 Ga0105245_10346664 3300009098 Bacteria 1470
245 Ga0105247_10014517 3300009101 Bacteria 4725
246 Ga0105247_10050147 3300009101 Bacteria 2568
247 Ga0114129_10004609 3300009147 Bacteria 19462
248 Ga0114129_10088672 3300009147 Bacteria 4288
249 Ga0105243_10012320 3300009148 Bacteria 6467
250 Ga0105243_10063916 3300009148 Bacteria 2951
251 Ga0105243_10236056 3300009148 Bacteria 1625
252 Ga0105243_10437064 3300009148 Bacteria 1224
253 Ga0105241_10063317 3300009174 Bacteria 2853
254 Ga0105241_10091221 3300009174 Bacteria 2403
255 Ga0105242_10000690 3300009176 Bacteria 26481
256 Ga0105242_10009955 3300009176 Bacteria 7280
257 Ga0105242_10259794 3300009176 Bacteria 1568
258 Ga0105248_10006666 3300009177 Bacteria 12669
259 Ga0105248_10008024 3300009177 Bacteria 11592
260 Ga0105248_10604382 3300009177 Bacteria 1237
261 Ga0105248_10625069 3300009177 Bacteria 1215
262 Ga0105248_10698704 3300009177 Bacteria 1144
263 Ga0105237_10129384 3300009545 Bacteria 2519
264 Ga0105237_10610753 3300009545 Bacteria 1097
265 Ga0105238_10020021 3300009551 Bacteria 6812
266 Ga0105238_10226912 3300009551 Bacteria 1844
267 Ga0105238_10306449 3300009551 Bacteria 1572
268 Ga0105249_10098367 3300009553 Bacteria 2748
269 Ga0105249_10537476 3300009553 Bacteria 1218
270 Ga0105249_10778485 3300009553 Bacteria 1020
271 Ga0105239_10206508 3300010375 Bacteria 2201
272 Ga0157346_1001567 3300012480 Bacteria 1100
273 Ga0157373_10024795 3300013100 Bacteria 4342
274 Ga0157370_10215235 3300013104 Bacteria 1780
275 Ga0157374_10014018 3300013296 Bacteria 7006
276 Ga0157374_10034766 3300013296 Bacteria 4607
277 Ga0157374_10068119 3300013296 Bacteria 3348
278 Ga0157378_10114508 3300013297 Bacteria 2477
279 Ga0157378_10128244 3300013297 Bacteria 2345
280 Ga0157378_10158345 3300013297 Bacteria 2116
281 Ga0157378_10173718 3300013297 Bacteria 2023
282 Ga0163162_10045703 3300013306 Bacteria 4387
283 Ga0163162_10088143 3300013306 Bacteria 3183
284 Ga0163162_10106671 3300013306 Bacteria 2897
285 Ga0163162_10109838 3300013306 Bacteria 2855
286 Ga0163162_10111964 3300013306 Bacteria 2828
287 Ga0163162_10200590 3300013306 Bacteria 2124
288 Ga0163162_10223661 3300013306 Bacteria 2012
289 Ga0163162_10404038 3300013306 Bacteria 1499
290 Ga0157372_10004478 3300013307 Bacteria 14904
291 Ga0157372_10164549 3300013307 Bacteria 2565
292 Ga0157375_10003441 3300013308 Bacteria 13718
293 Ga0157375_10082441 3300013308 Bacteria 3258
294 Ga0157375_10277416 3300013308 Bacteria 1839
295 Ga0157375_10349250 3300013308 Bacteria 1645
296 Ga0157375_10356103 3300013308 Bacteria 1630
297 Ga0157375_10384726 3300013308 Bacteria 1570
298 Ga0157375_10799927 3300013308 Bacteria 1092
299 Ga0163163_10029639 3300014325 Bacteria 5267
300 Ga0163163_10043724 3300014325 Bacteria 4393
301 Ga0163163_10087767 3300014325 Bacteria 3121
302 Ga0163163_10324714 3300014325 Bacteria 1593
303 Ga0157380_10044340 3300014326 Bacteria 3485
304 Ga0157380_10055257 3300014326 Bacteria 3152
305 Ga0157380_10448877 3300014326 Bacteria 1238
306 Ga0157380_10487577 3300014326 Bacteria 1194
307 Ga0157380_10579425 3300014326 Bacteria 1106
308 Ga0157380_10589005 3300014326 Bacteria 1098
309 Ga0157377_10014904 3300014745 Bacteria 3966
310 Ga0157377_10065159 3300014745 Bacteria 2092
311 Ga0157379_10000258 3300014968 Bacteria 41557
312 Ga0157379_10012433 3300014968 Bacteria 7431
313 Ga0157379_10015823 3300014968 Bacteria 6628
314 Ga0157379_10051815 3300014968 Bacteria 3664
315 Ga0157379_10278329 3300014968 Bacteria 1522
316 Ga0157379_10293566 3300014968 Bacteria 1481
317 Ga0157379_10302798 3300014968 Bacteria 1457
318 Ga0157379_10337298 3300014968 Bacteria 1378
319 Ga0157379_10814879 3300014968 Bacteria 882
320 Ga0157376_10021387 3300014969 Bacteria 5023
321 Ga0157376_10089099 3300014969 Bacteria 2667
322 Ga0157376_10157603 3300014969 Bacteria 2054
323 Ga0157376_10237997 3300014969 Bacteria 1695
324 Ga0157376_10294439 3300014969 Bacteria 1534
325 Ga0157376_10442528 3300014969 Bacteria 1266
326 Ga0157376_10524870 3300014969 Bacteria 1168
327 Ga0182007_10050280 3300015262 Bacteria 1376
328 Ga0163161_10033921 3300017792 Bacteria 3649
329 Ga0163161_10042264 3300017792 Bacteria 3278
330 Ga0163161_10079019 3300017792 Bacteria 2418
331 Ga0163161_10083418 3300017792 Bacteria 2355
332 Ga0163161_10124543 3300017792 Bacteria 1939
333 Ga0163161_10136961 3300017792 Bacteria 1852
334 Ga0163161_10409115 3300017792 Bacteria 1089
335 Ga0207697_10012327 3300025315 Bacteria 3586
336 Ga0207697_10019382 3300025315 Bacteria 2786
337 Ga0207697_10034474 3300025315 Bacteria 2072
338 Ga0207656_10007772 3300025321 Bacteria 3923
339 Ga0207656_10113279 3300025321 Bacteria 1256
340 Ga0207682_10001219 3300025893 Bacteria 11881
341 Ga0207682_10003685 3300025893 Bacteria 6603
342 Ga0207642_10077772 3300025899 Bacteria 1601
343 Ga0207710_10018460 3300025900 Bacteria 2967
344 Ga0207710_10019528 3300025900 Bacteria 2891
345 Ga0207688_10010228 3300025901 Bacteria 5107
346 Ga0207688_10015810 3300025901 Bacteria 4094
347 Ga0207680_10027620 3300025903 Bacteria 3163
348 Ga0207680_10307947 3300025903 Bacteria 1105
349 Ga0207645_10000785 3300025907 Bacteria 26534
350 Ga0207645_10023449 3300025907 Bacteria 4012
351 Ga0207645_10104512 3300025907 Bacteria 1829
352 Ga0207645_10141501 3300025907 Bacteria 1568
353 Ga0207645_10181860 3300025907 Bacteria 1379
354 Ga0207643_10002722 3300025908 Bacteria 9562
355 Ga0207643_10031102 3300025908 Bacteria 2974
356 Ga0207643_10233012 3300025908 Bacteria 1130
357 Ga0207684_10007261 3300025910 Bacteria 10005
358 Ga0207707_10004795 3300025912 Bacteria 11864
359 Ga0207707_10117379 3300025912 Bacteria 2326
360 Ga0207693_10080665 3300025915 Bacteria 2547
361 Ga0207660_10016052 3300025917 Bacteria 4951
362 Ga0207660_10202949 3300025917 Bacteria 1549
363 Ga0207662_10004859 3300025918 Bacteria 7107
364 Ga0207662_10090639 3300025918 Bacteria 1880
365 Ga0207662_10141029 3300025918 Bacteria 1527
366 Ga0207662_10223304 3300025918 Bacteria 1228
367 Ga0207657_10006112 3300025919 Bacteria 12517
368 Ga0207657_10012335 3300025919 Bacteria 8442
369 Ga0207657_10047273 3300025919 Bacteria 3764
370 Ga0207657_10392255 3300025919 Bacteria 1092
371 Ga0207649_10190169 3300025920 Bacteria 1443
372 Ga0207649_10337160 3300025920 Bacteria 1112
373 Ga0207681_10007613 3300025923 Bacteria 6638
374 Ga0207681_10017691 3300025923 Bacteria 4480
375 Ga0207681_10094434 3300025923 Bacteria 2143
376 Ga0207681_10102019 3300025923 Bacteria 2071
377 Ga0207681_10136991 3300025923 Bacteria 1818
378 Ga0207681_10182349 3300025923 Bacteria 1600
379 Ga0207681_10324994 3300025923 Bacteria 1224
380 Ga0207681_10411979 3300025923 Bacteria 1093
381 Ga0207694_10078519 3300025924 Bacteria 2588
382 Ga0207650_10004321 3300025925 Bacteria 9702
383 Ga0207650_10009523 3300025925 Bacteria 6639
384 Ga0207650_10010604 3300025925 Bacteria 6328
385 Ga0207650_10014282 3300025925 Bacteria 5517
386 Ga0207650_10059079 3300025925 Bacteria 2857
387 Ga0207650_10218435 3300025925 Bacteria 1533
388 Ga0207659_10003261 3300025926 Bacteria 9718
389 Ga0207659_10031306 3300025926 Bacteria 3641
390 Ga0207659_10035447 3300025926 Bacteria 3448
391 Ga0207659_10127287 3300025926 Bacteria 1961
392 Ga0207659_10372857 3300025926 Bacteria 1189
393 Ga0207687_10081776 3300025927 Bacteria 2335
394 Ga0207644_10010061 3300025931 Bacteria 6228
395 Ga0207644_10237416 3300025931 Bacteria 1450
396 Ga0207644_10266629 3300025931 Bacteria 1371
397 Ga0207706_10011667 3300025933 Bacteria 8012
398 Ga0207706_10018722 3300025933 Bacteria 6229
399 Ga0207706_10045851 3300025933 Bacteria 3872
400 Ga0207706_10129922 3300025933 Bacteria 2215
401 Ga0207706_10296525 3300025933 Bacteria 1409
402 Ga0207686_10019007 3300025934 Bacteria 3899
403 Ga0207709_10032220 3300025935 Bacteria 3067
404 Ga0207709_10069819 3300025935 Bacteria 2225
405 Ga0207670_10209835 3300025936 Bacteria 1485
406 Ga0207669_10009851 3300025937 Bacteria 4571
407 Ga0207669_10117476 3300025937 Bacteria 1797
408 Ga0207669_10130156 3300025937 Bacteria 1727
409 Ga0207704_10045810 3300025938 Bacteria 2601
410 Ga0207704_10067998 3300025938 Bacteria 2244
411 Ga0207704_10106221 3300025938 Bacteria 1885
412 Ga0207704_10507308 3300025938 Bacteria 973
413 Ga0207665_10214678 3300025939 Bacteria 1407
414 Ga0207691_10002075 3300025940 Bacteria 19550
415 Ga0207691_10009142 3300025940 Bacteria 9510
416 Ga0207691_10009216 3300025940 Bacteria 9475
417 Ga0207691_10020396 3300025940 Bacteria 6265
418 Ga0207691_10026948 3300025940 Bacteria 5392
419 Ga0207691_10032258 3300025940 Bacteria 4885
420 Ga0207691_10062638 3300025940 Bacteria 3374
421 Ga0207691_10072660 3300025940 Bacteria 3103
422 Ga0207691_10073795 3300025940 Bacteria 3077
423 Ga0207711_10005459 3300025941 Bacteria 10749
424 Ga0207711_10011471 3300025941 Bacteria 7367
425 Ga0207711_10012512 3300025941 Bacteria 7052
426 Ga0207711_10024048 3300025941 Bacteria 5100
427 Ga0207711_10215708 3300025941 Bacteria 1754
428 Ga0207711_10496893 3300025941 Bacteria 1137
429 Ga0207711_10592112 3300025941 Bacteria 1035
430 Ga0207689_10006427 3300025942 Bacteria 10390
431 Ga0207689_10020331 3300025942 Bacteria 5590
432 Ga0207689_10036483 3300025942 Bacteria 4081
433 Ga0207689_10046656 3300025942 Bacteria 3580
434 Ga0207689_10183144 3300025942 Bacteria 1727
435 Ga0207661_10254103 3300025944 Bacteria 1563
436 Ga0207679_10042031 3300025945 Bacteria 3282
437 Ga0207679_10124586 3300025945 Bacteria 2057
438 Ga0207651_10004677 3300025960 Bacteria 6938
439 Ga0207651_10027955 3300025960 Bacteria 3550
440 Ga0207651_10128361 3300025960 Bacteria 1936
441 Ga0207668_10021382 3300025972 Bacteria 4126
442 Ga0207668_10058562 3300025972 Bacteria 2694
443 Ga0207668_10060856 3300025972 Bacteria 2652
444 Ga0207668_10083171 3300025972 Bacteria 2328
445 Ga0207668_10155315 3300025972 Bacteria 1777
446 Ga0207668_10187998 3300025972 Bacteria 1634
447 Ga0207668_10304655 3300025972 Bacteria 1316
448 Ga0207668_10629778 3300025972 Bacteria 937
449 Ga0207640_10033612 3300025981 Bacteria 3193
450 Ga0207658_10002792 3300025986 Bacteria 12572
451 Ga0207658_10014853 3300025986 Bacteria 5336
452 Ga0207658_10135974 3300025986 Bacteria 1982
453 Ga0207658_10159901 3300025986 Bacteria 1845
454 Ga0207658_10170402 3300025986 Bacteria 1793
455 Ga0207658_10286440 3300025986 Bacteria 1414
456 Ga0207677_10016037 3300026023 Bacteria 4425
457 Ga0207677_10110792 3300026023 Bacteria 2044
458 Ga0207677_10325908 3300026023 Bacteria 1278
459 Ga0207703_10001830 3300026035 Bacteria 18952
460 Ga0207703_10270702 3300026035 Bacteria 1539
461 Ga0207639_10057431 3300026041 Bacteria 2988
462 Ga0207639_10151264 3300026041 Bacteria 1944
463 Ga0207678_10016032 3300026067 Bacteria 6581
464 Ga0207678_10365930 3300026067 Bacteria 1245
465 Ga0207708_10006845 3300026075 Bacteria 8432
466 Ga0207708_10028014 3300026075 Bacteria 4266
467 Ga0207708_10083596 3300026075 Bacteria 2454
468 Ga0207708_10107813 3300026075 Bacteria 2160
469 Ga0207708_10139409 3300026075 Bacteria 1901
470 Ga0207708_10190974 3300026075 Bacteria 1630
471 Ga0207641_10021712 3300026088 Bacteria 5276
472 Ga0207641_10046854 3300026088 Bacteria 3644
473 Ga0207641_10151936 3300026088 Bacteria 2097
474 Ga0207641_10208336 3300026088 Bacteria 1807
475 Ga0207641_10406917 3300026088 Bacteria 1307
476 Ga0207641_10474123 3300026088 Bacteria 1212
477 Ga0207648_10006409 3300026089 Bacteria 11698
478 Ga0207648_10021348 3300026089 Bacteria 5820
479 Ga0207648_10061431 3300026089 Bacteria 3276
480 Ga0207648_10121750 3300026089 Bacteria 2294
481 Ga0207648_10506975 3300026089 Bacteria 1105
482 Ga0207676_10003990 3300026095 Bacteria 10418
483 Ga0207676_10010289 3300026095 Bacteria 6659
484 Ga0207676_10010862 3300026095 Bacteria 6495
485 Ga0207676_10065895 3300026095 Bacteria 2886
486 Ga0207676_10139344 3300026095 Bacteria 2074
487 Ga0207676_10177221 3300026095 Bacteria 1863
488 Ga0207676_10193761 3300026095 Bacteria 1790
489 Ga0207676_10419711 3300026095 Bacteria 1254
490 Ga0207676_10933625 3300026095 Bacteria 852
491 Ga0207674_10003711 3300026116 Bacteria 18650
492 Ga0207674_10003982 3300026116 Bacteria 17963
493 Ga0207674_10128648 3300026116 Bacteria 2497
494 Ga0207674_10194405 3300026116 Bacteria 1978
495 Ga0207675_100003497 3300026118 Bacteria 15329
496 Ga0207675_100009247 3300026118 Bacteria 9242
497 Ga0207675_100027220 3300026118 Bacteria 5325
498 Ga0207675_100046886 3300026118 Bacteria 4037
499 Ga0207675_100071767 3300026118 Bacteria 3238
500 Ga0207675_100150809 3300026118 Bacteria 2212
501 Ga0207675_100252473 3300026118 Bacteria 1707
502 Ga0207675_100564426 3300026118 Bacteria 1138
503 Ga0207675_100622829 3300026118 Bacteria 1084
504 Ga0207683_10011064 3300026121 Bacteria 7688
505 Ga0207683_10023373 3300026121 Bacteria 5317
506 Ga0207683_10050984 3300026121 Bacteria 3626
507 Ga0207683_10073344 3300026121 Bacteria 3028
508 Ga0207683_10192935 3300026121 Bacteria 1850
509 Ga0207698_10754363 3300026142 Bacteria 972
510 Ga0209588_1019933 3300027671 Bacteria 2097
511 Ga0207428_10000173 3300027907 Bacteria 90064
512 Ga0207428_10021067 3300027907 Bacteria 5523
513 Ga0207428_10203295 3300027907 Bacteria 1490
514 Ga0268266_10032193 3300028379 Bacteria 4455
515 Ga0268266_10061594 3300028379 Bacteria 3236
516 Ga0268265_10025711 3300028380 Bacteria 4182
517 Ga0268265_10052152 3300028380 Bacteria 3092
518 Ga0268265_10163389 3300028380 Bacteria 1894
519 Ga0268265_10189021 3300028380 Bacteria 1776
520 Ga0268265_10192693 3300028380 Bacteria 1762
521 Ga0268265_10215774 3300028380 Bacteria 1675
522 Ga0268264_10015506 3300028381 Bacteria 6247
523 Ga0268264_10038152 3300028381 Bacteria 3964
524 Ga0268264_10063390 3300028381 Bacteria 3106
525 Ga0268264_10091217 3300028381 Bacteria 2628
526 Ga0268264_10098867 3300028381 Bacteria 2531
527 Ga0268264_10106873 3300028381 Bacteria 2444
528 Ga0268264_10834834 3300028381 Bacteria 922
529 Ga0316576_10009155 3300031727 Bacteria 6380
530 Ga0316576_10223423 3300031727 Bacteria 1416
531 Ga0316576_10224033 3300031727 Bacteria 1414
532 Ga0316578_10022953 3300031728 Bacteria 3487
533 Ga0316578_10026806 3300031728 Bacteria 3252
534 Ga0316578_10094029 3300031728 Bacteria 1793
535 Ga0373941_0025253 3300035115 Bacteria 1714
536 Ga0373943_0057696 3300035170 Bacteria 1930
537 Ga0316574_0013405 3300035398 Bacteria 4712
538 Ga0316574_0091542 3300035398 Bacteria 1939
539 Ga0316574_0162373 3300035398 Bacteria 1438
540 Ga0316574_0234698 3300035398 Bacteria 1173
541 Ga0373931_0044342 3300035691 Bacteria 2345
542 Ga0373947_0299335 3300035725 Bacteria 1072
543 Ga0373937_0781629 3300036401 Bacteria 902
544 Ga0316582_0176801 3300036647 Bacteria 1451
545 Ga0316584_0033030 3300036712 Bacteria 3831
546 Ga0316584_0060277 3300036712 Bacteria 2842
547 Ga0373925_0065745 3300037068 Bacteria 2732
548 Ga0395900_0019377 3300037418 Bacteria 6939
549 Ga0395898_0011982 3300037466 Bacteria 8976
550 Ga0395901_0106947 3300038443 Bacteria 2936
551 Ga0400490_18295 3300038726 Bacteria 112507
552 Ga0400490_32130 3300038726 Bacteria 32229
553 Ga0242420_010195 3300038996 Bacteria 1556
554 Ga0242420_017358 3300038996 Bacteria 1259
555 Ga0400489_49957 3300039093 Bacteria 3355
556 Ga0400489_76612 3300039093 Bacteria 4860
557 Ga0436361_0660602 3300039447 Bacteria 1244
558 Ga0439437_008944 3300042000 Bacteria 1132
559 Ga0439441_015581 3300042001 Bacteria 1346
560 Ga0439435_0035175 3300042436 Bacteria 1380
561 Ga0439464_0005561 3300042439 Bacteria 3262
562 Ga0439460_0007985 3300042461 Bacteria 2664
563 Ga0451577_0000160 3300042876 Bacteria 147192
564 Ga0451577_0001218 3300042876 Bacteria 35907
565 Ga0451577_0001837 3300042876 Bacteria 27069
566 Ga0451577_0007430 3300042876 Bacteria 10763
567 Ga0451577_0031034 3300042876 Bacteria 4823
568 Ga0451577_0221954 3300042876 Bacteria 1708
569 Ga0453683_0105625 3300044673 Bacteria 1769
570 Ga0453684_0000052 3300044712 Bacteria 546732
571 Ga0453684_0004837 3300044712 Bacteria 27646
572 Ga0453684_0208023 3300044712 Bacteria 2276
573 Ga0453684_0254204 3300044712 Bacteria 2016
574 Ga0451576_0002497 3300045051 Bacteria 27315
575 Ga0451576_0005175 3300045051 Bacteria 16499
576 Ga0451576_0054692 3300045051 Bacteria 4178
577 Ga0451576_0067314 3300045051 Bacteria 3728
578 Ga0451576_0506517 3300045051 Bacteria 1268
579 Ga0451576_0575168 3300045051 Bacteria 1184
580 Ga0495651_0030705 3300046462 Bacteria 4190
581 Ga0495580_0046889 3300046472 Bacteria 3065
582 Ga0495580_0055245 3300046472 Bacteria 2799
583 Ga0495580_0062009 3300046472 Bacteria 2624
584 Ga0495608_0021110 3300046511 Bacteria 4472
585 Ga0495628_0169725 3300046516 Bacteria 1655
586 Ga0495587_0017851 3300046536 Bacteria 4402
587 Ga0495598_0007215 3300046537 Bacteria 2540
588 Ga0495645_0092355 3300046543 Bacteria 2161
589 Ga0495645_0099786 3300046543 Bacteria 2066
590 Ga0495635_0042778 3300046663 Bacteria 3127
591 Ga0495599_0042229 3300046678 Bacteria 2861
592 Ga0496100_0007430 3300048903 Bacteria 6046
593 Ga0496101_0064399 3300048904 Bacteria 2670
594 Ga0496101_0246262 3300048904 Bacteria 1392
595 Ga0496102_0052531 3300048905 Bacteria 3714
596 Ga0496102_0094632 3300048905 Bacteria 2768
597 Ga0496102_0261851 3300048905 Bacteria 1630
598 Ga0496102_0351204 3300048905 Bacteria 1388
599 Ga0496103_0063395 3300048906 Bacteria 2302
600 Ga0496104_0004946 3300048907 Bacteria 11627
601 Ga0496104_0176282 3300048907 Bacteria 2048
602 Ga0496105_0084637 3300048908 Bacteria 2620
603 Ga0496106_0006839 3300048909 Bacteria 8440
604 Ga0496106_0008227 3300048909 Bacteria 7712
605 Ga0496106_0189753 3300048909 Bacteria 1634
606 Ga0496106_0237528 3300048909 Bacteria 1456
607 Ga0496107_0024302 3300048910 Bacteria 4287
608 Ga0496108_0001021 3300048911 Bacteria 21815
609 Ga0496109_0004372 3300048912 Bacteria 11803
610 Ga0496109_0103452 3300048912 Bacteria 2643
611 Ga0496109_0356851 3300048912 Bacteria 1381
612 Ga0496110_0005019 3300048913 Bacteria 10339
613 Ga0496110_0791656 3300048913 Bacteria 852
614 Ga0496111_0084883 3300048914 Bacteria 2315
615 Ga0496111_0388539 3300048914 Bacteria 1032
616 Ga0496112_0004051 3300048915 Bacteria 12294
617 Ga0496112_0400101 3300048915 Bacteria 1313
618 Ga0496114_0082340 3300048917 Bacteria 2720
619 Ga0496115_0009812 3300048918 Bacteria 7130
620 Ga0501036_0721957 3300049572 Bacteria 823
621 Ga0501039_0275476 3300049575 Bacteria 1323
622 Ga0501040_0134244 3300049576 Bacteria 1742
623 Ga0501042_0069222 3300049578 Bacteria 2524
624 Ga0501046_0102722 3300049580 Bacteria 2192
625 Ga0501071_0129139 3300049587 Bacteria 1877
626 Ga0501071_0392852 3300049587 Bacteria 1059
627 Ga0501072_0044585 3300049588 Bacteria 3487
628 Ga0501072_0048788 3300049588 Bacteria 3333
629 Ga0501074_0240647 3300049590 Bacteria 1287
630 Ga0501075_0102302 3300049591 Bacteria 2176
631 Ga0501075_0288523 3300049591 Bacteria 1250
632 Ga0501076_0024570 3300049592 Bacteria 4659
633 Ga0501076_0178277 3300049592 Bacteria 1732
634 Ga0501079_0031280 3300049741 Bacteria 4090
635 Ga0501079_0154103 3300049741 Bacteria 1791
636 Ga0501080_0217170 3300049742 Bacteria 1751
637 Ga0501081_0002423 3300049743 Bacteria 11770
638 Ga0501081_0378874 3300049743 Bacteria 1045
639 Ga0501081_0507897 3300049743 Bacteria 899
640 Ga0501035_0377398 3300049822 Bacteria 1183
641 Ga0501045_0309217 3300049824 Bacteria 1176
642 nmdc:mga00v17_35925_c1 3300050491 Bacteria 2951
643 nmdc:mga0k408_1278_c1 3300050493 Bacteria 13673
644 nmdc:mga05p37_166192_c1 3300050507 Bacteria 2693
645 nmdc:mga05p37_180919_c1 3300050507 Bacteria 2565
646 nmdc:mga05p37_84428_c1 3300050507 Bacteria 2991
647 nmdc:mga05p37_9619_c1 3300050507 Bacteria 11451
648 nmdc:mga06r32_156967_c1 3300050510 Bacteria 2257
649 nmdc:mga06r32_16654_c1 3300050510 Bacteria 6698
650 nmdc:mga06r32_286_c1 3300050510 Bacteria 41965
651 nmdc:mga06r32_88481_c1 3300050510 Bacteria 3023
652 nmdc:mga08y16_140837_c1 3300050511 Bacteria 2508
653 nmdc:mga08y16_14929_c1 3300050511 Bacteria 8171
654 nmdc:mga08y16_156697_c1 3300050511 Bacteria 2367
655 nmdc:mga08y16_179843_c1 3300050511 Bacteria 2196
656 nmdc:mga08y16_54272_c1 3300050511 Bacteria 4187
657 nmdc:mga08y16_602856_c1 3300050511 Bacteria 1107
658 nmdc:mga08y16_689087_c1 3300050511 Bacteria 1023
659 nmdc:mga0n895_16330_c1 3300050512 Bacteria 6808
660 nmdc:mga0n895_25942_c1 3300050512 Bacteria 5542
661 nmdc:mga0n895_48798_c1 3300050512 Bacteria 4146
662 nmdc:mga0n895_50709_c1 3300050512 Bacteria 4069
663 nmdc:mga0n895_55301_c1 3300050512 Bacteria 3906
664 nmdc:mga0n895_61760_c1 3300050512 Bacteria 3701
665 nmdc:mga0rr50_10137_c1 3300050513 Bacteria 5964
666 nmdc:mga0rr50_106589_c1 3300050513 Bacteria 2211
667 nmdc:mga0rr50_45039_c1 3300050513 Bacteria 1925
668 nmdc:mga0rr50_48728_c1 3300050513 Bacteria 3133
669 nmdc:mga0rr50_99667_c1 3300050513 Bacteria 2280
670 nmdc:mga0a205_10348_c1 3300050515 Bacteria 8575
671 nmdc:mga0a205_16323_c1 3300050515 Bacteria 6953
672 nmdc:mga0a205_182442_c1 3300050515 Bacteria 1993
673 nmdc:mga0a205_2381_c1 3300050515 Bacteria 16567
674 nmdc:mga0a205_244182_c1 3300050515 Bacteria 1676
675 nmdc:mga0a205_47526_c1 3300050515 Bacteria 4141
676 nmdc:mga0a205_50867_c1 3300050515 Bacteria 4000
677 nmdc:mga0a205_9660_c1 3300050515 Bacteria 7226
678 nmdc:mga0sz30_6388_c1 3300050516 Bacteria 1775
679 Ga0495601_0046049 3300053077 Bacteria 2745
680 Ga0501084_0021865 3300054114 Bacteria 5334
681 Ga0501084_0186722 3300054114 Bacteria 1749
682 Ga0501082_0007685 3300060353 Bacteria 9305
683 Ga0530510_0567996 3300061734 Bacteria 862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10579425 Ga0157380_105794252 233
2 iso_pu_bacteria 2523533628 2524003562 236
3 3300005331 Ga0070670_100268014 Ga0070670_1002680142 237
4 3300009148 Ga0105243_10437064 Ga0105243_104370642 237
5 3300009176 Ga0105242_10009955 Ga0105242_100099557 237
6 3300009553 Ga0105249_10778485 Ga0105249_107784852 237
7 3300010375 Ga0105239_10206508 Ga0105239_102065082 237
8 3300013296 Ga0157374_10014018 Ga0157374_100140185 237
9 3300013308 Ga0157375_10356103 Ga0157375_103561032 237
10 3300014325 Ga0163163_10043724 Ga0163163_100437242 237
11 3300014326 Ga0157380_10448877 Ga0157380_104488771 237
12 3300014745 Ga0157377_10014904 Ga0157377_100149042 237
13 3300014968 Ga0157379_10015823 Ga0157379_100158236 237
14 3300014969 Ga0157376_10442528 Ga0157376_104425282 237
15 3300025925 Ga0207650_10218435 Ga0207650_102184352 237
16 3300035170 Ga0373943_0057696 Ga0373943_0057696_137_850 237
17 3300044673 Ga0453683_0105625 Ga0453683_0105625_632_1360 237
18 3300048904 Ga0496101_0246262 Ga0496101_0246262_357_1070 237
19 3300048905 Ga0496102_0052531 Ga0496102_0052531_2913_3626 237
20 3300048907 Ga0496104_0004946 Ga0496104_0004946_8050_8763 237
21 3300048909 Ga0496106_0006839 Ga0496106_0006839_3647_4360 237
22 3300048911 Ga0496108_0001021 Ga0496108_0001021_21039_21752 237
23 3300048912 Ga0496109_0004372 Ga0496109_0004372_7912_8625 237
24 3300048913 Ga0496110_0005019 Ga0496110_0005019_2830_3543 237
25 3300048917 Ga0496114_0082340 Ga0496114_0082340_286_999 237
26 3300050511 nmdc:mga08y16_179843_c1 nmdc:mga08y16_179843_c1_1176_1889 237
27 3300009177 Ga0105248_10698704 Ga0105248_106987042 238
28 3300014326 Ga0157380_10487577 Ga0157380_104875771 238
29 3300025941 Ga0207711_10592112 Ga0207711_105921122 238
30 3300031728 Ga0316578_10022953 Ga0316578_100229531 238
31 3300035398 Ga0316574_0234698 Ga0316574_0234698_32_775 238
32 3300036712 Ga0316584_0060277 Ga0316584_0060277_461_1204 238
33 3300050511 nmdc:mga08y16_689087_c1 nmdc:mga08y16_689087_c1_10_726 238
34 3300025919 Ga0207657_10012335 Ga0207657_100123352 239
35 3300031727 Ga0316576_10009155 Ga0316576_100091553 239
36 3300031727 Ga0316576_10223423 Ga0316576_102234232 239
37 3300031728 Ga0316578_10026806 Ga0316578_100268062 239
38 3300031728 Ga0316578_10094029 Ga0316578_100940292 239
39 3300035398 Ga0316574_0013405 Ga0316574_0013405_862_1608 239
40 3300035398 Ga0316574_0162373 Ga0316574_0162373_607_1353 239
41 3300036712 Ga0316584_0033030 Ga0316584_0033030_323_1069 239
42 3300006186 Ga0075369_10053566 Ga0075369_100535662 240
43 3300006195 Ga0075366_10000429 Ga0075366_1000042910 240
44 3300050491 nmdc:mga00v17_35925_c1 nmdc:mga00v17_35925_c1_234_959 240
45 3300050493 nmdc:mga0k408_1278_c1 nmdc:mga0k408_1278_c1_10119_10844 240
46 3300050516 nmdc:mga0sz30_6388_c1 nmdc:mga0sz30_6388_c1_639_1364 240
47 3300005842 Ga0068858_100014006 Ga0068858_1000140062 241
48 3300009148 Ga0105243_10012320 Ga0105243_100123207 241
49 3300009176 Ga0105242_10000690 Ga0105242_1000069020 241
50 3300009551 Ga0105238_10226912 Ga0105238_102269123 241
51 3300013306 Ga0163162_10223661 Ga0163162_102236612 241
52 3300013306 Ga0163162_10404038 Ga0163162_104040382 241
53 3300014969 Ga0157376_10524870 Ga0157376_105248701 241
54 3300017792 Ga0163161_10042264 Ga0163161_100422642 241
55 3300017792 Ga0163161_10136961 Ga0163161_101369611 241
56 3300025934 Ga0207686_10019007 Ga0207686_100190072 241
57 3300025942 Ga0207689_10046656 Ga0207689_100466562 241
58 3300025972 Ga0207668_10629778 Ga0207668_106297782 241
59 3300026088 Ga0207641_10208336 Ga0207641_102083362 241
60 3300035691 Ga0373931_0044342 Ga0373931_0044342_1313_2065 241
61 3300036401 Ga0373937_0781629 Ga0373937_0781629_109_891 241
62 3300038726 Ga0400490_18295 Ga0400490_18295_64201_64989 241
63 3300038726 Ga0400490_32130 Ga0400490_32130_28114_28908 241
64 3300039093 Ga0400489_49957 Ga0400489_49957_169_963 241
65 3300039093 Ga0400489_76612 Ga0400489_76612_3983_4771 241
66 3300005347 Ga0070668_100513743 Ga0070668_1005137432 242
67 3300025923 Ga0207681_10411979 Ga0207681_104119792 242
68 3300025972 Ga0207668_10304655 Ga0207668_103046552 242
69 3300042876 Ga0451577_0007430 Ga0451577_0007430_6208_6939 242
70 3300046472 Ga0495580_0062009 Ga0495580_0062009_710_1501 242
71 3300046537 Ga0495598_0007215 Ga0495598_0007215_1784_2515 242
72 3300005356 Ga0070674_100081267 Ga0070674_1000812672 243
73 3300005438 Ga0070701_10041544 Ga0070701_100415442 243
74 3300014326 Ga0157380_10589005 Ga0157380_105890052 243
75 3300025924 Ga0207694_10078519 Ga0207694_100785192 243
76 3300026075 Ga0207708_10083596 Ga0207708_100835962 243
77 3300026089 Ga0207648_10121750 Ga0207648_101217502 243
78 3300028381 Ga0268264_10834834 Ga0268264_108348341 244
79 3300039447 Ga0436361_0660602 Ga0436361_0660602_363_1127 244
80 3300005471 Ga0070698_100202045 Ga0070698_1002020454 245
81 3300013307 Ga0157372_10004478 Ga0157372_1000447810 245
82 3300025918 Ga0207662_10223304 Ga0207662_102233042 245
83 3300026089 Ga0207648_10506975 Ga0207648_105069752 245
84 3300026118 Ga0207675_100622829 Ga0207675_1006228292 245
85 3300035398 Ga0316574_0091542 Ga0316574_0091542_771_1517 245
86 3300036647 Ga0316582_0176801 Ga0316582_0176801_296_1042 245
87 3300042876 Ga0451577_0000160 Ga0451577_0000160_138237_138974 245
88 3300044712 Ga0453684_0000052 Ga0453684_0000052_222139_222876 245
89 3300044712 Ga0453684_0254204 Ga0453684_0254204_868_1704 245
90 3300045051 Ga0451576_0506517 Ga0451576_0506517_124_960 245
91 3300049572 Ga0501036_0721957 Ga0501036_0721957_55_792 245
92 3300049578 Ga0501042_0069222 Ga0501042_0069222_893_1630 245
93 3300049587 Ga0501071_0129139 Ga0501071_0129139_281_1018 245
94 3300049587 Ga0501071_0392852 Ga0501071_0392852_228_965 245
95 3300049588 Ga0501072_0048788 Ga0501072_0048788_884_1621 245
96 3300049590 Ga0501074_0240647 Ga0501074_0240647_104_841 245
97 3300049591 Ga0501075_0102302 Ga0501075_0102302_1233_1970 245
98 3300049592 Ga0501076_0024570 Ga0501076_0024570_640_1377 245
99 3300049741 Ga0501079_0031280 Ga0501079_0031280_418_1155 245
100 3300049742 Ga0501080_0217170 Ga0501080_0217170_268_1005 245
101 3300049743 Ga0501081_0002423 Ga0501081_0002423_1973_2710 245
102 3300054114 Ga0501084_0021865 Ga0501084_0021865_2925_3662 245
103 3300060353 Ga0501082_0007685 Ga0501082_0007685_1476_2213 245
104 3300005290 Ga0065712_10073390 Ga0065712_100733902 246
105 3300005293 Ga0065715_10090300 Ga0065715_100903006 246
106 3300005295 Ga0065707_10002989 Ga0065707_100029893 246
107 3300005327 Ga0070658_10441387 Ga0070658_104413872 246
108 3300005328 Ga0070676_10024944 Ga0070676_100249442 246
109 3300005328 Ga0070676_10145080 Ga0070676_101450801 246
110 3300005328 Ga0070676_10171557 Ga0070676_101715572 246
111 3300005328 Ga0070676_10191223 Ga0070676_101912232 246
112 3300005329 Ga0070683_100018349 Ga0070683_1000183496 246
113 3300005330 Ga0070690_100016596 Ga0070690_1000165962 246
114 3300005330 Ga0070690_100103823 Ga0070690_1001038232 246
115 3300005331 Ga0070670_100005270 Ga0070670_1000052709 246
116 3300005331 Ga0070670_100008262 Ga0070670_1000082627 246
117 3300005331 Ga0070670_100052530 Ga0070670_1000525302 246
118 3300005331 Ga0070670_100105972 Ga0070670_1001059721 246
119 3300005331 Ga0070670_100302880 Ga0070670_1003028802 246
120 3300005334 Ga0068869_100037516 Ga0068869_1000375163 246
121 3300005334 Ga0068869_100147098 Ga0068869_1001470982 246
122 3300005334 Ga0068869_100183496 Ga0068869_1001834961 246
123 3300005334 Ga0068869_100183614 Ga0068869_1001836142 246
124 3300005335 Ga0070666_10039066 Ga0070666_100390663 246
125 3300005335 Ga0070666_10081066 Ga0070666_100810663 246
126 3300005336 Ga0070680_100115060 Ga0070680_1001150602 246
127 3300005338 Ga0068868_100037364 Ga0068868_1000373644 246
128 3300005338 Ga0068868_100159883 Ga0068868_1001598831 246
129 3300005338 Ga0068868_100546299 Ga0068868_1005462991 246
130 3300005339 Ga0070660_100033125 Ga0070660_1000331252 246
131 3300005339 Ga0070660_100102423 Ga0070660_1001024232 246
132 3300005339 Ga0070660_100338109 Ga0070660_1003381091 246
133 3300005340 Ga0070689_100001097 Ga0070689_1000010975 246
134 3300005340 Ga0070689_100195965 Ga0070689_1001959652 246
135 3300005340 Ga0070689_100305178 Ga0070689_1003051782 246
136 3300005340 Ga0070689_100575908 Ga0070689_1005759081 246
137 3300005343 Ga0070687_100115915 Ga0070687_1001159152 246
138 3300005344 Ga0070661_100034438 Ga0070661_1000344382 246
139 3300005344 Ga0070661_100044811 Ga0070661_1000448112 246
140 3300005344 Ga0070661_100057128 Ga0070661_1000571282 246
141 3300005344 Ga0070661_100183319 Ga0070661_1001833192 246
142 3300005344 Ga0070661_100251150 Ga0070661_1002511502 246
143 3300005345 Ga0070692_10108701 Ga0070692_101087012 246
144 3300005347 Ga0070668_100004282 Ga0070668_1000042828 246
145 3300005347 Ga0070668_100036551 Ga0070668_1000365512 246
146 3300005347 Ga0070668_100086662 Ga0070668_1000866622 246
147 3300005347 Ga0070668_100128244 Ga0070668_1001282442 246
148 3300005353 Ga0070669_100010576 Ga0070669_1000105766 246
149 3300005353 Ga0070669_100021621 Ga0070669_1000216212 246
150 3300005353 Ga0070669_100026606 Ga0070669_1000266062 246
151 3300005353 Ga0070669_100026890 Ga0070669_1000268903 246
152 3300005353 Ga0070669_100047459 Ga0070669_1000474592 246
153 3300005353 Ga0070669_100051584 Ga0070669_1000515842 246
154 3300005353 Ga0070669_100192226 Ga0070669_1001922262 246
155 3300005353 Ga0070669_100357018 Ga0070669_1003570182 246
156 3300005353 Ga0070669_100598449 Ga0070669_1005984491 246
157 3300005354 Ga0070675_100023093 Ga0070675_1000230933 246
158 3300005354 Ga0070675_100029309 Ga0070675_1000293093 246
159 3300005354 Ga0070675_100057032 Ga0070675_1000570324 246
160 3300005354 Ga0070675_100060926 Ga0070675_1000609265 246
161 3300005354 Ga0070675_100074333 Ga0070675_1000743332 246
162 3300005354 Ga0070675_100286706 Ga0070675_1002867061 246
163 3300005354 Ga0070675_100308031 Ga0070675_1003080311 246
164 3300005355 Ga0070671_100002596 Ga0070671_1000025967 246
165 3300005355 Ga0070671_100146443 Ga0070671_1001464432 246
166 3300005356 Ga0070674_100060954 Ga0070674_1000609543 246
167 3300005364 Ga0070673_100027623 Ga0070673_1000276233 246
168 3300005364 Ga0070673_100033558 Ga0070673_1000335581 246
169 3300005364 Ga0070673_100068132 Ga0070673_1000681322 246
170 3300005364 Ga0070673_100080367 Ga0070673_1000803671 246
171 3300005364 Ga0070673_100146997 Ga0070673_1001469972 246
172 3300005365 Ga0070688_100007046 Ga0070688_1000070464 246
173 3300005365 Ga0070688_100208915 Ga0070688_1002089152 246
174 3300005365 Ga0070688_100296548 Ga0070688_1002965482 246
175 3300005366 Ga0070659_100055933 Ga0070659_1000559332 246
176 3300005367 Ga0070667_100006493 Ga0070667_1000064935 246
177 3300005367 Ga0070667_100017624 Ga0070667_1000176242 246
178 3300005367 Ga0070667_100038224 Ga0070667_1000382242 246
179 3300005367 Ga0070667_100048343 Ga0070667_1000483434 246
180 3300005367 Ga0070667_100111613 Ga0070667_1001116132 246
181 3300005367 Ga0070667_100227246 Ga0070667_1002272463 246
182 3300005438 Ga0070701_10085273 Ga0070701_100852732 246
183 3300005438 Ga0070701_10132072 Ga0070701_101320721 246
184 3300005440 Ga0070705_100170128 Ga0070705_1001701282 246
185 3300005441 Ga0070700_100273925 Ga0070700_1002739252 246
186 3300005444 Ga0070694_100182860 Ga0070694_1001828602 246
187 3300005444 Ga0070694_100252878 Ga0070694_1002528781 246
188 3300005455 Ga0070663_100269744 Ga0070663_1002697442 246
189 3300005456 Ga0070678_100034019 Ga0070678_1000340192 246
190 3300005456 Ga0070678_100169720 Ga0070678_1001697201 246
191 3300005456 Ga0070678_100184479 Ga0070678_1001844792 246
192 3300005456 Ga0070678_100312141 Ga0070678_1003121412 246
193 3300005456 Ga0070678_100436060 Ga0070678_1004360602 246
194 3300005456 Ga0070678_100615453 Ga0070678_1006154531 246
195 3300005457 Ga0070662_100009881 Ga0070662_1000098816 246
196 3300005457 Ga0070662_100054467 Ga0070662_1000544672 246
197 3300005457 Ga0070662_100103759 Ga0070662_1001037592 246
198 3300005457 Ga0070662_100137326 Ga0070662_1001373262 246
199 3300005457 Ga0070662_100244374 Ga0070662_1002443742 246
200 3300005458 Ga0070681_10052249 Ga0070681_100522492 246
201 3300005458 Ga0070681_10068041 Ga0070681_100680412 246
202 3300005458 Ga0070681_10108695 Ga0070681_101086952 246
203 3300005459 Ga0068867_100090086 Ga0068867_1000900863 246
204 3300005459 Ga0068867_100101704 Ga0068867_1001017043 246
205 3300005459 Ga0068867_100197851 Ga0068867_1001978512 246
206 3300005459 Ga0068867_100676758 Ga0068867_1006767581 246
207 3300005466 Ga0070685_10148130 Ga0070685_101481303 246
208 3300005466 Ga0070685_10157165 Ga0070685_101571652 246
209 3300005530 Ga0070679_100145092 Ga0070679_1001450922 246
210 3300005530 Ga0070679_100303600 Ga0070679_1003036002 246
211 3300005535 Ga0070684_100063752 Ga0070684_1000637522 246
212 3300005535 Ga0070684_100185049 Ga0070684_1001850492 246
213 3300005535 Ga0070684_100327121 Ga0070684_1003271212 246
214 3300005539 Ga0068853_100040526 Ga0068853_1000405262 246
215 3300005539 Ga0068853_100254461 Ga0068853_1002544612 246
216 3300005543 Ga0070672_100004002 Ga0070672_1000040027 246
217 3300005543 Ga0070672_100031647 Ga0070672_1000316472 246
218 3300005543 Ga0070672_100046716 Ga0070672_1000467163 246
219 3300005543 Ga0070672_100057437 Ga0070672_1000574372 246
220 3300005543 Ga0070672_100076620 Ga0070672_1000766202 246
221 3300005543 Ga0070672_100120559 Ga0070672_1001205591 246
222 3300005544 Ga0070686_100025228 Ga0070686_1000252283 246
223 3300005544 Ga0070686_100054663 Ga0070686_1000546632 246
224 3300005544 Ga0070686_100150390 Ga0070686_1001503902 246
225 3300005545 Ga0070695_100044604 Ga0070695_1000446042 246
226 3300005545 Ga0070695_100226665 Ga0070695_1002266652 246
227 3300005545 Ga0070695_100616149 Ga0070695_1006161491 246
228 3300005546 Ga0070696_100013077 Ga0070696_1000130774 246
229 3300005548 Ga0070665_100005511 Ga0070665_10000551113 246
230 3300005548 Ga0070665_100058191 Ga0070665_1000581913 246
231 3300005548 Ga0070665_100169020 Ga0070665_1001690202 246
232 3300005548 Ga0070665_100199078 Ga0070665_1001990782 246
233 3300005548 Ga0070665_100345972 Ga0070665_1003459722 246
234 3300005549 Ga0070704_100080749 Ga0070704_1000807492 246
235 3300005549 Ga0070704_100772794 Ga0070704_1007727941 246
236 3300005563 Ga0068855_100102065 Ga0068855_1001020651 246
237 3300005563 Ga0068855_100224946 Ga0068855_1002249462 246
238 3300005564 Ga0070664_100070501 Ga0070664_1000705012 246
239 3300005564 Ga0070664_100317291 Ga0070664_1003172911 246
240 3300005564 Ga0070664_100543863 Ga0070664_1005438631 246
241 3300005577 Ga0068857_100042247 Ga0068857_1000422472 246
242 3300005577 Ga0068857_100074294 Ga0068857_1000742942 246
243 3300005577 Ga0068857_100378644 Ga0068857_1003786442 246
244 3300005578 Ga0068854_100046269 Ga0068854_1000462692 246
245 3300005578 Ga0068854_100096339 Ga0068854_1000963392 246
246 3300005578 Ga0068854_100427723 Ga0068854_1004277231 246
247 3300005615 Ga0070702_100030857 Ga0070702_1000308571 246
248 3300005616 Ga0068852_100007226 Ga0068852_1000072263 246
249 3300005616 Ga0068852_100144045 Ga0068852_1001440453 246
250 3300005617 Ga0068859_100004393 Ga0068859_10000439310 246
251 3300005617 Ga0068859_100196804 Ga0068859_1001968042 246
252 3300005617 Ga0068859_100319519 Ga0068859_1003195192 246
253 3300005618 Ga0068864_100002253 Ga0068864_1000022536 246
254 3300005618 Ga0068864_100002433 Ga0068864_1000024333 246
255 3300005618 Ga0068864_100087853 Ga0068864_1000878532 246
256 3300005618 Ga0068864_100142329 Ga0068864_1001423292 246
257 3300005618 Ga0068864_100430929 Ga0068864_1004309292 246
258 3300005718 Ga0068866_10003907 Ga0068866_100039072 246
259 3300005719 Ga0068861_100037111 Ga0068861_1000371112 246
260 3300005719 Ga0068861_100067854 Ga0068861_1000678541 246
261 3300005719 Ga0068861_100126473 Ga0068861_1001264733 246
262 3300005719 Ga0068861_100282217 Ga0068861_1002822172 246
263 3300005834 Ga0068851_10010569 Ga0068851_100105694 246
264 3300005834 Ga0068851_10029828 Ga0068851_100298282 246
265 3300005834 Ga0068851_10283706 Ga0068851_102837061 246
266 3300005840 Ga0068870_10049727 Ga0068870_100497272 246
267 3300005840 Ga0068870_10169802 Ga0068870_101698022 246
268 3300005841 Ga0068863_100006387 Ga0068863_1000063871 246
269 3300005841 Ga0068863_100028525 Ga0068863_1000285252 246
270 3300005841 Ga0068863_100051893 Ga0068863_1000518932 246
271 3300005841 Ga0068863_100080259 Ga0068863_1000802592 246
272 3300005841 Ga0068863_100110976 Ga0068863_1001109762 246
273 3300005841 Ga0068863_100208406 Ga0068863_1002084062 246
274 3300005841 Ga0068863_100454908 Ga0068863_1004549081 246
275 3300005842 Ga0068858_100005933 Ga0068858_1000059334 246
276 3300005842 Ga0068858_100148739 Ga0068858_1001487392 246
277 3300005842 Ga0068858_100283902 Ga0068858_1002839022 246
278 3300005843 Ga0068860_100011123 Ga0068860_1000111235 246
279 3300005843 Ga0068860_100019589 Ga0068860_1000195893 246
280 3300005843 Ga0068860_100021053 Ga0068860_1000210532 246
281 3300005843 Ga0068860_100077769 Ga0068860_1000777693 246
282 3300005843 Ga0068860_100114044 Ga0068860_1001140441 246
283 3300005843 Ga0068860_100268498 Ga0068860_1002684982 246
284 3300005843 Ga0068860_100317981 Ga0068860_1003179811 246
285 3300005844 Ga0068862_100141802 Ga0068862_1001418022 246
286 3300005844 Ga0068862_100210286 Ga0068862_1002102862 246
287 3300005844 Ga0068862_100399305 Ga0068862_1003993052 246
288 3300005844 Ga0068862_100486870 Ga0068862_1004868703 246
289 3300005981 Ga0081538_10002640 Ga0081538_1000264010 246
290 3300005981 Ga0081538_10041681 Ga0081538_100416812 246
291 3300006175 Ga0070712_100015334 Ga0070712_1000153343 246
292 3300006237 Ga0097621_100018546 Ga0097621_1000185466 246
293 3300006237 Ga0097621_100113172 Ga0097621_1001131723 246
294 3300006237 Ga0097621_100130415 Ga0097621_1001304152 246
295 3300006358 Ga0068871_100026413 Ga0068871_1000264133 246
296 3300006358 Ga0068871_100085925 Ga0068871_1000859252 246
297 3300006844 Ga0075428_100001720 Ga0075428_10000172015 246
298 3300006844 Ga0075428_100016022 Ga0075428_1000160225 246
299 3300006844 Ga0075428_100131517 Ga0075428_1001315172 246
300 3300006844 Ga0075428_100186313 Ga0075428_1001863132 246
301 3300006847 Ga0075431_100000325 Ga0075431_10000032512 246
302 3300006847 Ga0075431_100003569 Ga0075431_1000035698 246
303 3300006852 Ga0075433_10002325 Ga0075433_100023254 246
304 3300006852 Ga0075433_10018745 Ga0075433_100187453 246
305 3300006852 Ga0075433_10047154 Ga0075433_100471543 246
306 3300006852 Ga0075433_10056426 Ga0075433_100564262 246
307 3300006852 Ga0075433_10084371 Ga0075433_100843712 246
308 3300006852 Ga0075433_10148791 Ga0075433_101487912 246
309 3300006852 Ga0075433_10406666 Ga0075433_104066662 246
310 3300006871 Ga0075434_100002836 Ga0075434_1000028369 246
311 3300006871 Ga0075434_100008905 Ga0075434_1000089052 246
312 3300006871 Ga0075434_100017855 Ga0075434_1000178555 246
313 3300006871 Ga0075434_100019818 Ga0075434_1000198183 246
314 3300006871 Ga0075434_100078105 Ga0075434_1000781052 246
315 3300006871 Ga0075434_100251306 Ga0075434_1002513062 246
316 3300006871 Ga0075434_100440200 Ga0075434_1004402002 246
317 3300006880 Ga0075429_100049199 Ga0075429_1000491992 246
318 3300006881 Ga0068865_100006814 Ga0068865_10000681410 246
319 3300006881 Ga0068865_100183086 Ga0068865_1001830862 246
320 3300006881 Ga0068865_100502931 Ga0068865_1005029311 246
321 3300006914 Ga0075436_100029694 Ga0075436_1000296941 246
322 3300006931 Ga0097620_100004393 Ga0097620_1000043934 246
323 3300006931 Ga0097620_100196804 Ga0097620_1001968042 246
324 3300006931 Ga0097620_100319536 Ga0097620_1003195362 246
325 3300007076 Ga0075435_100015332 Ga0075435_1000153324 246
326 3300007076 Ga0075435_100037701 Ga0075435_1000377013 246
327 3300007076 Ga0075435_100090484 Ga0075435_1000904842 246
328 3300007076 Ga0075435_100199113 Ga0075435_1001991131 246
329 3300009093 Ga0105240_10237501 Ga0105240_102375012 246
330 3300009094 Ga0111539_10000087 Ga0111539_1000008714 246
331 3300009094 Ga0111539_10008130 Ga0111539_100081307 246
332 3300009094 Ga0111539_10034034 Ga0111539_100340343 246
333 3300009094 Ga0111539_10042845 Ga0111539_100428454 246
334 3300009094 Ga0111539_10170719 Ga0111539_101707191 246
335 3300009094 Ga0111539_10256629 Ga0111539_102566292 246
336 3300009094 Ga0111539_10576345 Ga0111539_105763452 246
337 3300009094 Ga0111539_10814899 Ga0111539_108148991 246
338 3300009098 Ga0105245_10064970 Ga0105245_100649702 246
339 3300009098 Ga0105245_10346664 Ga0105245_103466642 246
340 3300009101 Ga0105247_10014517 Ga0105247_100145174 246
341 3300009101 Ga0105247_10050147 Ga0105247_100501472 246
342 3300009147 Ga0114129_10004609 Ga0114129_100046099 246
343 3300009147 Ga0114129_10088672 Ga0114129_100886722 246
344 3300009148 Ga0105243_10063916 Ga0105243_100639162 246
345 3300009148 Ga0105243_10236056 Ga0105243_102360561 246
346 3300009174 Ga0105241_10063317 Ga0105241_100633172 246
347 3300009174 Ga0105241_10091221 Ga0105241_100912212 246
348 3300009176 Ga0105242_10259794 Ga0105242_102597941 246
349 3300009177 Ga0105248_10006666 Ga0105248_100066666 246
350 3300009177 Ga0105248_10008024 Ga0105248_100080246 246
351 3300009177 Ga0105248_10604382 Ga0105248_106043821 246
352 3300009177 Ga0105248_10625069 Ga0105248_106250692 246
353 3300009545 Ga0105237_10129384 Ga0105237_101293842 246
354 3300009545 Ga0105237_10610753 Ga0105237_106107531 246
355 3300009551 Ga0105238_10020021 Ga0105238_100200212 246
356 3300009551 Ga0105238_10306449 Ga0105238_103064492 246
357 3300009553 Ga0105249_10098367 Ga0105249_100983673 246
358 3300009553 Ga0105249_10537476 Ga0105249_105374762 246
359 3300012480 Ga0157346_1001567 Ga0157346_10015672 246
360 3300013100 Ga0157373_10024795 Ga0157373_100247954 246
361 3300013104 Ga0157370_10215235 Ga0157370_102152352 246
362 3300013296 Ga0157374_10034766 Ga0157374_100347662 246
363 3300013296 Ga0157374_10068119 Ga0157374_100681191 246
364 3300013297 Ga0157378_10114508 Ga0157378_101145082 246
365 3300013297 Ga0157378_10128244 Ga0157378_101282442 246
366 3300013297 Ga0157378_10158345 Ga0157378_101583453 246
367 3300013297 Ga0157378_10173718 Ga0157378_101737182 246
368 3300013306 Ga0163162_10045703 Ga0163162_100457033 246
369 3300013306 Ga0163162_10088143 Ga0163162_100881433 246
370 3300013306 Ga0163162_10106671 Ga0163162_101066712 246
371 3300013306 Ga0163162_10109838 Ga0163162_101098382 246
372 3300013306 Ga0163162_10111964 Ga0163162_101119642 246
373 3300013306 Ga0163162_10200590 Ga0163162_102005902 246
374 3300013307 Ga0157372_10164549 Ga0157372_101645492 246
375 3300013308 Ga0157375_10003441 Ga0157375_100034414 246
376 3300013308 Ga0157375_10082441 Ga0157375_100824412 246
377 3300013308 Ga0157375_10277416 Ga0157375_102774162 246
378 3300013308 Ga0157375_10349250 Ga0157375_103492502 246
379 3300013308 Ga0157375_10384726 Ga0157375_103847262 246
380 3300013308 Ga0157375_10799927 Ga0157375_107999272 246
381 3300014325 Ga0163163_10029639 Ga0163163_100296393 246
382 3300014325 Ga0163163_10087767 Ga0163163_100877672 246
383 3300014325 Ga0163163_10324714 Ga0163163_103247142 246
384 3300014326 Ga0157380_10044340 Ga0157380_100443403 246
385 3300014326 Ga0157380_10055257 Ga0157380_100552572 246
386 3300014745 Ga0157377_10065159 Ga0157377_100651592 246
387 3300014968 Ga0157379_10000258 Ga0157379_100002588 246
388 3300014968 Ga0157379_10012433 Ga0157379_100124332 246
389 3300014968 Ga0157379_10051815 Ga0157379_100518152 246
390 3300014968 Ga0157379_10278329 Ga0157379_102783292 246
391 3300014968 Ga0157379_10293566 Ga0157379_102935662 246
392 3300014968 Ga0157379_10302798 Ga0157379_103027982 246
393 3300014968 Ga0157379_10337298 Ga0157379_103372981 246
394 3300014968 Ga0157379_10814879 Ga0157379_108148791 246
395 3300014969 Ga0157376_10021387 Ga0157376_100213872 246
396 3300014969 Ga0157376_10089099 Ga0157376_100890992 246
397 3300014969 Ga0157376_10157603 Ga0157376_101576032 246
398 3300014969 Ga0157376_10237997 Ga0157376_102379972 246
399 3300014969 Ga0157376_10294439 Ga0157376_102944392 246
400 3300015262 Ga0182007_10050280 Ga0182007_100502802 246
401 3300017792 Ga0163161_10033921 Ga0163161_100339213 246
402 3300017792 Ga0163161_10079019 Ga0163161_100790192 246
403 3300017792 Ga0163161_10083418 Ga0163161_100834182 246
404 3300017792 Ga0163161_10124543 Ga0163161_101245432 246
405 3300017792 Ga0163161_10409115 Ga0163161_104091152 246
406 3300025315 Ga0207697_10012327 Ga0207697_100123272 246
407 3300025315 Ga0207697_10019382 Ga0207697_100193822 246
408 3300025315 Ga0207697_10034474 Ga0207697_100344741 246
409 3300025321 Ga0207656_10007772 Ga0207656_100077727 246
410 3300025321 Ga0207656_10113279 Ga0207656_101132792 246
411 3300025893 Ga0207682_10001219 Ga0207682_100012193 246
412 3300025893 Ga0207682_10003685 Ga0207682_100036855 246
413 3300025899 Ga0207642_10077772 Ga0207642_100777722 246
414 3300025900 Ga0207710_10018460 Ga0207710_100184601 246
415 3300025900 Ga0207710_10019528 Ga0207710_100195282 246
416 3300025901 Ga0207688_10010228 Ga0207688_100102282 246
417 3300025901 Ga0207688_10015810 Ga0207688_100158103 246
418 3300025903 Ga0207680_10027620 Ga0207680_100276203 246
419 3300025903 Ga0207680_10307947 Ga0207680_103079472 246
420 3300025907 Ga0207645_10000785 Ga0207645_1000078518 246
421 3300025907 Ga0207645_10023449 Ga0207645_100234492 246
422 3300025907 Ga0207645_10104512 Ga0207645_101045122 246
423 3300025907 Ga0207645_10141501 Ga0207645_101415012 246
424 3300025907 Ga0207645_10181860 Ga0207645_101818602 246
425 3300025908 Ga0207643_10002722 Ga0207643_100027225 246
426 3300025908 Ga0207643_10031102 Ga0207643_100311022 246
427 3300025908 Ga0207643_10233012 Ga0207643_102330121 246
428 3300025910 Ga0207684_10007261 Ga0207684_100072612 246
429 3300025912 Ga0207707_10004795 Ga0207707_100047959 246
430 3300025912 Ga0207707_10117379 Ga0207707_101173792 246
431 3300025915 Ga0207693_10080665 Ga0207693_100806652 246
432 3300025917 Ga0207660_10016052 Ga0207660_100160523 246
433 3300025917 Ga0207660_10202949 Ga0207660_102029492 246
434 3300025918 Ga0207662_10004859 Ga0207662_100048596 246
435 3300025918 Ga0207662_10090639 Ga0207662_100906391 246
436 3300025918 Ga0207662_10141029 Ga0207662_101410291 246
437 3300025919 Ga0207657_10006112 Ga0207657_100061129 246
438 3300025919 Ga0207657_10047273 Ga0207657_100472732 246
439 3300025919 Ga0207657_10392255 Ga0207657_103922552 246
440 3300025920 Ga0207649_10190169 Ga0207649_101901692 246
441 3300025920 Ga0207649_10337160 Ga0207649_103371601 246
442 3300025923 Ga0207681_10007613 Ga0207681_100076136 246
443 3300025923 Ga0207681_10017691 Ga0207681_100176912 246
444 3300025923 Ga0207681_10094434 Ga0207681_100944343 246
445 3300025923 Ga0207681_10102019 Ga0207681_101020192 246
446 3300025923 Ga0207681_10136991 Ga0207681_101369912 246
447 3300025923 Ga0207681_10182349 Ga0207681_101823491 246
448 3300025923 Ga0207681_10324994 Ga0207681_103249941 246
449 3300025925 Ga0207650_10004321 Ga0207650_100043213 246
450 3300025925 Ga0207650_10009523 Ga0207650_100095232 246
451 3300025925 Ga0207650_10010604 Ga0207650_100106044 246
452 3300025925 Ga0207650_10014282 Ga0207650_100142822 246
453 3300025925 Ga0207650_10059079 Ga0207650_100590792 246
454 3300025926 Ga0207659_10003261 Ga0207659_100032615 246
455 3300025926 Ga0207659_10031306 Ga0207659_100313062 246
456 3300025926 Ga0207659_10035447 Ga0207659_100354473 246
457 3300025926 Ga0207659_10127287 Ga0207659_101272871 246
458 3300025926 Ga0207659_10372857 Ga0207659_103728572 246
459 3300025927 Ga0207687_10081776 Ga0207687_100817761 246
460 3300025931 Ga0207644_10010061 Ga0207644_100100617 246
461 3300025931 Ga0207644_10237416 Ga0207644_102374162 246
462 3300025931 Ga0207644_10266629 Ga0207644_102666293 246
463 3300025933 Ga0207706_10011667 Ga0207706_100116679 246
464 3300025933 Ga0207706_10018722 Ga0207706_100187222 246
465 3300025933 Ga0207706_10045851 Ga0207706_100458512 246
466 3300025933 Ga0207706_10129922 Ga0207706_101299222 246
467 3300025933 Ga0207706_10296525 Ga0207706_102965252 246
468 3300025935 Ga0207709_10032220 Ga0207709_100322201 246
469 3300025935 Ga0207709_10069819 Ga0207709_100698192 246
470 3300025936 Ga0207670_10209835 Ga0207670_102098352 246
471 3300025937 Ga0207669_10009851 Ga0207669_100098514 246
472 3300025937 Ga0207669_10117476 Ga0207669_101174762 246
473 3300025937 Ga0207669_10130156 Ga0207669_101301562 246
474 3300025938 Ga0207704_10045810 Ga0207704_100458101 246
475 3300025938 Ga0207704_10067998 Ga0207704_100679982 246
476 3300025938 Ga0207704_10106221 Ga0207704_101062212 246
477 3300025938 Ga0207704_10507308 Ga0207704_105073081 246
478 3300025939 Ga0207665_10214678 Ga0207665_102146782 246
479 3300025940 Ga0207691_10002075 Ga0207691_100020754 246
480 3300025940 Ga0207691_10009142 Ga0207691_100091427 246
481 3300025940 Ga0207691_10009216 Ga0207691_1000921611 246
482 3300025940 Ga0207691_10020396 Ga0207691_100203962 246
483 3300025940 Ga0207691_10026948 Ga0207691_100269483 246
484 3300025940 Ga0207691_10032258 Ga0207691_100322586 246
485 3300025940 Ga0207691_10062638 Ga0207691_100626382 246
486 3300025940 Ga0207691_10072660 Ga0207691_100726602 246
487 3300025940 Ga0207691_10073795 Ga0207691_100737952 246
488 3300025941 Ga0207711_10005459 Ga0207711_100054595 246
489 3300025941 Ga0207711_10011471 Ga0207711_100114712 246
490 3300025941 Ga0207711_10012512 Ga0207711_100125123 246
491 3300025941 Ga0207711_10024048 Ga0207711_100240484 246
492 3300025941 Ga0207711_10215708 Ga0207711_102157082 246
493 3300025941 Ga0207711_10496893 Ga0207711_104968931 246
494 3300025942 Ga0207689_10006427 Ga0207689_100064276 246
495 3300025942 Ga0207689_10020331 Ga0207689_100203314 246
496 3300025942 Ga0207689_10036483 Ga0207689_100364833 246
497 3300025942 Ga0207689_10183144 Ga0207689_101831442 246
498 3300025944 Ga0207661_10254103 Ga0207661_102541032 246
499 3300025945 Ga0207679_10042031 Ga0207679_100420312 246
500 3300025945 Ga0207679_10124586 Ga0207679_101245863 246
501 3300025960 Ga0207651_10004677 Ga0207651_100046772 246
502 3300025960 Ga0207651_10027955 Ga0207651_100279552 246
503 3300025960 Ga0207651_10128361 Ga0207651_101283612 246
504 3300025972 Ga0207668_10021382 Ga0207668_100213824 246
505 3300025972 Ga0207668_10058562 Ga0207668_100585623 246
506 3300025972 Ga0207668_10060856 Ga0207668_100608562 246
507 3300025972 Ga0207668_10083171 Ga0207668_100831712 246
508 3300025972 Ga0207668_10155315 Ga0207668_101553152 246
509 3300025972 Ga0207668_10187998 Ga0207668_101879981 246
510 3300025981 Ga0207640_10033612 Ga0207640_100336121 246
511 3300025986 Ga0207658_10002792 Ga0207658_100027923 246
512 3300025986 Ga0207658_10014853 Ga0207658_100148536 246
513 3300025986 Ga0207658_10135974 Ga0207658_101359742 246
514 3300025986 Ga0207658_10159901 Ga0207658_101599012 246
515 3300025986 Ga0207658_10170402 Ga0207658_101704021 246
516 3300025986 Ga0207658_10286440 Ga0207658_102864402 246
517 3300026023 Ga0207677_10016037 Ga0207677_100160372 246
518 3300026023 Ga0207677_10110792 Ga0207677_101107921 246
519 3300026023 Ga0207677_10325908 Ga0207677_103259082 246
520 3300026035 Ga0207703_10001830 Ga0207703_100018303 246
521 3300026035 Ga0207703_10270702 Ga0207703_102707022 246
522 3300026041 Ga0207639_10057431 Ga0207639_100574312 246
523 3300026041 Ga0207639_10151264 Ga0207639_101512642 246
524 3300026067 Ga0207678_10016032 Ga0207678_100160326 246
525 3300026067 Ga0207678_10365930 Ga0207678_103659301 246
526 3300026075 Ga0207708_10006845 Ga0207708_100068456 246
527 3300026075 Ga0207708_10028014 Ga0207708_100280142 246
528 3300026075 Ga0207708_10107813 Ga0207708_101078132 246
529 3300026075 Ga0207708_10139409 Ga0207708_101394092 246
530 3300026075 Ga0207708_10190974 Ga0207708_101909742 246
531 3300026088 Ga0207641_10021712 Ga0207641_100217125 246
532 3300026088 Ga0207641_10046854 Ga0207641_100468542 246
533 3300026088 Ga0207641_10151936 Ga0207641_101519362 246
534 3300026088 Ga0207641_10406917 Ga0207641_104069172 246
535 3300026088 Ga0207641_10474123 Ga0207641_104741232 246
536 3300026089 Ga0207648_10006409 Ga0207648_100064096 246
537 3300026089 Ga0207648_10021348 Ga0207648_100213482 246
538 3300026089 Ga0207648_10061431 Ga0207648_100614312 246
539 3300026095 Ga0207676_10003990 Ga0207676_100039909 246
540 3300026095 Ga0207676_10010289 Ga0207676_100102892 246
541 3300026095 Ga0207676_10010862 Ga0207676_100108622 246
542 3300026095 Ga0207676_10065895 Ga0207676_100658952 246
543 3300026095 Ga0207676_10139344 Ga0207676_101393443 246
544 3300026095 Ga0207676_10177221 Ga0207676_101772212 246
545 3300026095 Ga0207676_10193761 Ga0207676_101937612 246
546 3300026095 Ga0207676_10419711 Ga0207676_104197112 246
547 3300026095 Ga0207676_10933625 Ga0207676_109336251 246
548 3300026116 Ga0207674_10003711 Ga0207674_100037113 246
549 3300026116 Ga0207674_10003982 Ga0207674_100039829 246
550 3300026116 Ga0207674_10128648 Ga0207674_101286482 246
551 3300026116 Ga0207674_10194405 Ga0207674_101944052 246
552 3300026118 Ga0207675_100003497 Ga0207675_10000349713 246
553 3300026118 Ga0207675_100009247 Ga0207675_1000092474 246
554 3300026118 Ga0207675_100027220 Ga0207675_1000272202 246
555 3300026118 Ga0207675_100046886 Ga0207675_1000468863 246
556 3300026118 Ga0207675_100071767 Ga0207675_1000717672 246
557 3300026118 Ga0207675_100150809 Ga0207675_1001508092 246
558 3300026118 Ga0207675_100252473 Ga0207675_1002524732 246
559 3300026118 Ga0207675_100564426 Ga0207675_1005644261 246
560 3300026121 Ga0207683_10011064 Ga0207683_100110646 246
561 3300026121 Ga0207683_10023373 Ga0207683_100233732 246
562 3300026121 Ga0207683_10050984 Ga0207683_100509843 246
563 3300026121 Ga0207683_10073344 Ga0207683_100733443 246
564 3300026121 Ga0207683_10192935 Ga0207683_101929352 246
565 3300026142 Ga0207698_10754363 Ga0207698_107543631 246
566 3300027671 Ga0209588_1019933 Ga0209588_10199332 246
567 3300027907 Ga0207428_10000173 Ga0207428_1000017322 246
568 3300027907 Ga0207428_10021067 Ga0207428_100210672 246
569 3300027907 Ga0207428_10203295 Ga0207428_102032952 246
570 3300028379 Ga0268266_10032193 Ga0268266_100321932 246
571 3300028379 Ga0268266_10061594 Ga0268266_100615944 246
572 3300028380 Ga0268265_10025711 Ga0268265_100257112 246
573 3300028380 Ga0268265_10052152 Ga0268265_100521522 246
574 3300028380 Ga0268265_10163389 Ga0268265_101633892 246
575 3300028380 Ga0268265_10189021 Ga0268265_101890212 246
576 3300028380 Ga0268265_10192693 Ga0268265_101926932 246
577 3300028380 Ga0268265_10215774 Ga0268265_102157742 246
578 3300028381 Ga0268264_10015506 Ga0268264_100155062 246
579 3300028381 Ga0268264_10038152 Ga0268264_100381522 246
580 3300028381 Ga0268264_10063390 Ga0268264_100633902 246
581 3300028381 Ga0268264_10091217 Ga0268264_100912172 246
582 3300028381 Ga0268264_10098867 Ga0268264_100988673 246
583 3300028381 Ga0268264_10106873 Ga0268264_101068731 246
584 3300031727 Ga0316576_10224033 Ga0316576_102240332 246
585 3300035115 Ga0373941_0025253 Ga0373941_0025253_878_1663 246
586 3300035725 Ga0373947_0299335 Ga0373947_0299335_124_864 246
587 3300037068 Ga0373925_0065745 Ga0373925_0065745_1661_2401 246
588 3300037418 Ga0395900_0019377 Ga0395900_0019377_362_1102 246
589 3300037466 Ga0395898_0011982 Ga0395898_0011982_6039_6779 246
590 3300038443 Ga0395901_0106947 Ga0395901_0106947_2174_2914 246
591 3300038996 Ga0242420_010195 Ga0242420_010195_90_830 246
592 3300038996 Ga0242420_017358 Ga0242420_017358_161_901 246
593 3300042000 Ga0439437_008944 Ga0439437_008944_189_989 246
594 3300042001 Ga0439441_015581 Ga0439441_015581_145_885 246
595 3300042436 Ga0439435_0035175 Ga0439435_0035175_480_1220 246
596 3300042439 Ga0439464_0005561 Ga0439464_0005561_1654_2454 246
597 3300042461 Ga0439460_0007985 Ga0439460_0007985_49_849 246
598 3300042876 Ga0451577_0001218 Ga0451577_0001218_24603_25409 246
599 3300042876 Ga0451577_0001837 Ga0451577_0001837_26066_26806 246
600 3300042876 Ga0451577_0031034 Ga0451577_0031034_378_1214 246
601 3300042876 Ga0451577_0221954 Ga0451577_0221954_583_1329 246
602 3300044712 Ga0453684_0004837 Ga0453684_0004837_17151_17891 246
603 3300044712 Ga0453684_0208023 Ga0453684_0208023_470_1261 246
604 3300045051 Ga0451576_0002497 Ga0451576_0002497_24492_25232 246
605 3300045051 Ga0451576_0005175 Ga0451576_0005175_12004_12795 246
606 3300045051 Ga0451576_0054692 Ga0451576_0054692_1935_2678 246
607 3300045051 Ga0451576_0067314 Ga0451576_0067314_1071_1859 246
608 3300045051 Ga0451576_0575168 Ga0451576_0575168_341_1081 246
609 3300046462 Ga0495651_0030705 Ga0495651_0030705_2900_3673 246
610 3300046472 Ga0495580_0046889 Ga0495580_0046889_1298_2071 246
611 3300046472 Ga0495580_0055245 Ga0495580_0055245_192_932 246
612 3300046511 Ga0495608_0021110 Ga0495608_0021110_1498_2271 246
613 3300046516 Ga0495628_0169725 Ga0495628_0169725_713_1486 246
614 3300046536 Ga0495587_0017851 Ga0495587_0017851_2169_2942 246
615 3300046543 Ga0495645_0092355 Ga0495645_0092355_1056_1829 246
616 3300046543 Ga0495645_0099786 Ga0495645_0099786_327_1112 246
617 3300046663 Ga0495635_0042778 Ga0495635_0042778_1210_1983 246
618 3300046678 Ga0495599_0042229 Ga0495599_0042229_1711_2484 246
619 3300048903 Ga0496100_0007430 Ga0496100_0007430_4659_5444 246
620 3300048904 Ga0496101_0064399 Ga0496101_0064399_57_842 246
621 3300048905 Ga0496102_0094632 Ga0496102_0094632_564_1304 246
622 3300048905 Ga0496102_0261851 Ga0496102_0261851_156_932 246
623 3300048905 Ga0496102_0351204 Ga0496102_0351204_484_1269 246
624 3300048906 Ga0496103_0063395 Ga0496103_0063395_700_1473 246
625 3300048907 Ga0496104_0176282 Ga0496104_0176282_361_1146 246
626 3300048908 Ga0496105_0084637 Ga0496105_0084637_1796_2581 246
627 3300048909 Ga0496106_0008227 Ga0496106_0008227_1058_1843 246
628 3300048909 Ga0496106_0189753 Ga0496106_0189753_436_1212 246
629 3300048909 Ga0496106_0237528 Ga0496106_0237528_40_789 246
630 3300048910 Ga0496107_0024302 Ga0496107_0024302_3060_3845 246
631 3300048912 Ga0496109_0103452 Ga0496109_0103452_268_1053 246
632 3300048912 Ga0496109_0356851 Ga0496109_0356851_552_1328 246
633 3300048913 Ga0496110_0791656 Ga0496110_0791656_10_795 246
634 3300048914 Ga0496111_0084883 Ga0496111_0084883_444_1229 246
635 3300048914 Ga0496111_0388539 Ga0496111_0388539_131_871 246
636 3300048915 Ga0496112_0004051 Ga0496112_0004051_3192_3986 246
637 3300048915 Ga0496112_0400101 Ga0496112_0400101_32_826 246
638 3300048918 Ga0496115_0009812 Ga0496115_0009812_5270_6055 246
639 3300049575 Ga0501039_0275476 Ga0501039_0275476_571_1311 246
640 3300049576 Ga0501040_0134244 Ga0501040_0134244_328_1068 246
641 3300049580 Ga0501046_0102722 Ga0501046_0102722_798_1538 246
642 3300049588 Ga0501072_0044585 Ga0501072_0044585_2182_2922 246
643 3300049591 Ga0501075_0288523 Ga0501075_0288523_423_1163 246
644 3300049592 Ga0501076_0178277 Ga0501076_0178277_977_1717 246
645 3300049741 Ga0501079_0154103 Ga0501079_0154103_780_1520 246
646 3300049743 Ga0501081_0378874 Ga0501081_0378874_266_1006 246
647 3300049743 Ga0501081_0507897 Ga0501081_0507897_36_779 246
648 3300049822 Ga0501035_0377398 Ga0501035_0377398_209_1042 246
649 3300049824 Ga0501045_0309217 Ga0501045_0309217_81_821 246
650 3300050507 nmdc:mga05p37_166192_c1 nmdc:mga05p37_166192_c1_1817_2557 246
651 3300050507 nmdc:mga05p37_180919_c1 nmdc:mga05p37_180919_c1_524_1267 246
652 3300050507 nmdc:mga05p37_84428_c1 nmdc:mga05p37_84428_c1_1104_1844 246
653 3300050507 nmdc:mga05p37_9619_c1 nmdc:mga05p37_9619_c1_3180_3920 246
654 3300050510 nmdc:mga06r32_156967_c1 nmdc:mga06r32_156967_c1_1101_1844 246
655 3300050510 nmdc:mga06r32_16654_c1 nmdc:mga06r32_16654_c1_5462_6202 246
656 3300050510 nmdc:mga06r32_286_c1 nmdc:mga06r32_286_c1_5012_5755 246
657 3300050510 nmdc:mga06r32_88481_c1 nmdc:mga06r32_88481_c1_532_1272 246
658 3300050511 nmdc:mga08y16_140837_c1 nmdc:mga08y16_140837_c1_115_855 246
659 3300050511 nmdc:mga08y16_14929_c1 nmdc:mga08y16_14929_c1_6590_7330 246
660 3300050511 nmdc:mga08y16_156697_c1 nmdc:mga08y16_156697_c1_255_995 246
661 3300050511 nmdc:mga08y16_54272_c1 nmdc:mga08y16_54272_c1_1935_2699 246
662 3300050511 nmdc:mga08y16_602856_c1 nmdc:mga08y16_602856_c1_102_887 246
663 3300050512 nmdc:mga0n895_16330_c1 nmdc:mga0n895_16330_c1_3163_3903 246
664 3300050512 nmdc:mga0n895_25942_c1 nmdc:mga0n895_25942_c1_566_1306 246
665 3300050512 nmdc:mga0n895_48798_c1 nmdc:mga0n895_48798_c1_1864_2604 246
666 3300050512 nmdc:mga0n895_50709_c1 nmdc:mga0n895_50709_c1_1016_1756 246
667 3300050512 nmdc:mga0n895_55301_c1 nmdc:mga0n895_55301_c1_1574_2314 246
668 3300050512 nmdc:mga0n895_61760_c1 nmdc:mga0n895_61760_c1_566_1309 246
669 3300050513 nmdc:mga0rr50_10137_c1 nmdc:mga0rr50_10137_c1_3722_4462 246
670 3300050513 nmdc:mga0rr50_106589_c1 nmdc:mga0rr50_106589_c1_564_1304 246
671 3300050513 nmdc:mga0rr50_45039_c1 nmdc:mga0rr50_45039_c1_739_1479 246
672 3300050513 nmdc:mga0rr50_48728_c1 nmdc:mga0rr50_48728_c1_1111_1851 246
673 3300050513 nmdc:mga0rr50_99667_c1 nmdc:mga0rr50_99667_c1_1077_1820 246
674 3300050515 nmdc:mga0a205_10348_c1 nmdc:mga0a205_10348_c1_101_841 246
675 3300050515 nmdc:mga0a205_16323_c1 nmdc:mga0a205_16323_c1_1375_2115 246
676 3300050515 nmdc:mga0a205_182442_c1 nmdc:mga0a205_182442_c1_916_1656 246
677 3300050515 nmdc:mga0a205_2381_c1 nmdc:mga0a205_2381_c1_9313_10053 246
678 3300050515 nmdc:mga0a205_244182_c1 nmdc:mga0a205_244182_c1_485_1225 246
679 3300050515 nmdc:mga0a205_47526_c1 nmdc:mga0a205_47526_c1_3163_3903 246
680 3300050515 nmdc:mga0a205_50867_c1 nmdc:mga0a205_50867_c1_564_1307 246
681 3300050515 nmdc:mga0a205_9660_c1 nmdc:mga0a205_9660_c1_5087_5827 246
682 3300053077 Ga0495601_0046049 Ga0495601_0046049_1796_2569 246
683 3300054114 Ga0501084_0186722 Ga0501084_0186722_341_1081 246
684 3300061734 Ga0530510_0567996 Ga0530510_0567996_97_837 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

52

157

0.95

PF13183

Fer4_8

4Fe-4S dicluster domain

193

268

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kcm-assembly1.cif.gz_C full-length human mitochondrial hsp90 (trap1) in complex with sdhb in the presence of amp-pnp 0.6988 8 126
7kcm-assembly1.cif.gz_C full-length human mitochondrial hsp90 (trap1) in complex with sdhb in the presence of amp-pnp 0.6829 8 126
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.6794 29 98
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.6668 8 98
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.6547 9 99
ID Description Score Start End Superfamily
5xmjN01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9778 7 110 3.10.20.30
5xmjN01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9597 7 110 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.919 8 110 3.10.20.30
4kx6N01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9059 8 110 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9019 8 110 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A643CY32-F1-model_v4 Succinate dehydrogenase iron-sulfur subunit (EC 1.3.5.1) 0.9726 7 104 GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A3D4GDS9-F1-model_v4 deleted 0.9703 6 86
AF-A0A2T6RWR4-F1-model_v4 deleted 0.9642 4 86
AF-A0A842PZP7-F1-model_v4 deleted 0.9595 9 109
AF-K6GK16-F1-model_v4 Succinate dehydogenase/fumarate reductase N-terminal domain-containing protein 0.9591 7 126 GO:0009055
GO:0009060
GO:0022904
GO:0051537

Feature Viewer

pLDDT pTM Quality
59.93 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map