F475097

General Info

Members Datasets Scaffolds Average Seq Length
684 307 630 282

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221664|2644357488
Length 281
Sequence ISEHACHGGVQRFYKHDSSAIGLPMRFSAFIPPHADAARLPALFYLAGLTCTEETFPIKAGAQRVAAELGLILIAPDTSPRGAGVPGETDAWDFGAGAGFYIDATEAPWSQHYRMESYIHELRELVTATLPLDAARVGIFGHSMGGHGALTLALKRPEVFRSVSAFAPIAAPTRCPWGKKAFSGYLGRDESAWRAHDASELMAAASTPFPQGILIDQGLGDKFLAEQLYPEAFEEACRQAAQPLQLRRHAGYDHGYYFVSSFIEDHLRFHAANLGGLRAAR

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
5 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
6 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
7 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
8 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
9 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
10 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
11 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
12 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
13 2643221556 Massilia sp. Root1485 Isolate Unclassified
14 2643221638 Duganella sp. Root336D2 Isolate Unclassified
15 2643221664 Massilia sp. Root418 Isolate Unclassified
16 2643221684 Massilia sp. Root133 Isolate Unclassified
17 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
18 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
19 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
20 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
21 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
22 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
23 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
24 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
25 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
26 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
27 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
28 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
29 2818991450 Burkholderia sp. 604 Isolate Unclassified
30 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
31 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
32 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
33 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
34 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
35 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
36 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
37 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
38 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
39 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
40 2919476304 Duganella sp. 3397 Isolate Unclassified
41 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
42 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
43 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
44 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
45 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
46 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
47 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
50 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
51 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
52 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
55 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
56 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
61 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
62 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
63 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
64 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
65 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
66 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
67 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
68 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
69 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
73 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
74 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
75 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
76 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
77 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
167 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
262 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
263 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
264 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
302 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
303 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
304 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
305 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
306 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
307 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 0
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.4
Nodule 2.63
Rhizoplane 4.68
Rhizosphere 71.05
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013522 3300001979 Bacteria 3040
2 JGI24739J22299_10009746 3300001989 Bacteria 3574
3 JGI24739J22299_10010108 3300001989 Bacteria 3507
4 JGI24737J22298_10046768 3300001990 Bacteria 1320
5 JGI24735J21928_10001177 3300002067 Bacteria 9339
6 JGI24735J21928_10028235 3300002067 Bacteria 1676
7 JGI25156J39149_1000404 3300002705 Bacteria 27020
8 JGI25156J39149_1001094 3300002705 Bacteria 12391
9 JGI25156J39149_1001662 3300002705 Bacteria 8996
10 JGI25152J39213_1000242 3300002773 Bacteria 36400
11 JGI25152J39213_1013483 3300002773 Bacteria 1702
12 JGI25150J39212_1009142 3300002774 Bacteria 1905
13 JGI25159J45721_1000340 3300002987 Bacteria 21597
14 JGI25151J46595_10000121 3300003187 Bacteria 106308
15 JGI25165J46597_1002600 3300003214 Bacteria 5489
16 JGI25153J46596_10001631 3300003215 Bacteria 13301
17 rootH1_10003596 3300003316 Bacteria 2941
18 rootL2_10018938 3300003322 Bacteria 3814
19 JGI25161J50226_1003685 3300003374 Bacteria 3427
20 JGI25161J50226_1004633 3300003374 Bacteria 2832
21 Ga0055533_1000381 3300003756 Bacteria 17748
22 Ga0055533_1001333 3300003756 Bacteria 6685
23 Ga0055532_1000012 3300003758 Bacteria 382698
24 Ga0055527_1000011 3300003760 Bacteria 354560
25 Ga0055535_1000009 3300003761 Bacteria 382698
26 Ga0055542_1000015 3300003762 Bacteria 382698
27 Ga0055529_1000011 3300003763 Bacteria 382698
28 Ga0055526_1000602 3300003771 Bacteria 28135
29 Ga0055526_1015001 3300003771 Bacteria 3140
30 Ga0055537_1010418 3300003773 Bacteria 1961
31 Ga0055524_1000003 3300003775 Bacteria 399748
32 Ga0055524_1000223 3300003775 Bacteria 60211
33 Ga0055524_1006395 3300003775 Bacteria 5111
34 Ga0055524_1006501 3300003775 Bacteria 5062
35 Ga0055528_1009739 3300003790 Bacteria 3988
36 Ga0055530_10013666 3300003791 Bacteria 2756
37 Ga0055531_10009510 3300003794 Bacteria 4962
38 Ga0055543_1000136 3300004625 Bacteria 60943
39 Ga0065165_1000340 3300005262 Bacteria 76653
40 Ga0065165_1001278 3300005262 Bacteria 28419
41 Ga0065165_1023776 3300005262 Bacteria 2070
42 Ga0070658_10003119 3300005327 Bacteria 13676
43 Ga0070658_10073628 3300005327 Bacteria 2801
44 Ga0068869_100174554 3300005334 Bacteria 1681
45 Ga0070660_100047662 3300005339 Bacteria 3289
46 Ga0070660_100063105 3300005339 Bacteria 2880
47 Ga0070660_100324756 3300005339 Bacteria 1265
48 Ga0070659_100003989 3300005366 Bacteria 10508
49 Ga0070659_100133148 3300005366 Bacteria 2020
50 Ga0070694_100472760 3300005444 Bacteria 993
51 Ga0070663_100002763 3300005455 Bacteria 9950
52 Ga0070663_100043236 3300005455 Bacteria 3170
53 Ga0070663_100332489 3300005455 Bacteria 1225
54 Ga0070662_100267283 3300005457 Bacteria 1380
55 Ga0070681_10037120 3300005458 Bacteria 4891
56 Ga0068867_100372316 3300005459 Bacteria 1198
57 Ga0068855_100002603 3300005563 Bacteria 22237
58 Ga0068855_100190876 3300005563 Bacteria 2311
59 Ga0068855_100225092 3300005563 Bacteria 2102
60 Ga0068857_100063667 3300005577 Bacteria 3279
61 Ga0068852_100711535 3300005616 Bacteria 1015
62 Ga0075364_10058832 3300006051 Bacteria 2519
63 Ga0070712_100015033 3300006175 Bacteria 4977
64 Ga0075366_10030683 3300006195 Bacteria 3161
65 Ga0068865_100055022 3300006881 Bacteria 2767
66 Ga0068865_100252598 3300006881 Bacteria 1392
67 Ga0099826_10000002 3300006948 Bacteria 1125830
68 Ga0105251_10000047 3300009011 Bacteria 110996
69 Ga0105251_10036799 3300009011 Bacteria 2405
70 Ga0105240_10057081 3300009093 Bacteria 4881
71 Ga0105240_10061556 3300009093 Bacteria 4677
72 Ga0105240_10186024 3300009093 Bacteria 2446
73 Ga0105240_10257525 3300009093 Bacteria 2015
74 Ga0105240_10625804 3300009093 Bacteria 1182
75 Ga0105243_10182818 3300009148 Bacteria 1825
76 Ga0105248_10017065 3300009177 Bacteria 7995
77 Ga0105237_10010747 3300009545 Bacteria 9713
78 Ga0105237_10159421 3300009545 Bacteria 2254
79 Ga0105238_10084943 3300009551 Bacteria 3154
80 Ga0105238_10121334 3300009551 Bacteria 2593
81 Ga0105238_10191917 3300009551 Bacteria 2019
82 Ga0105239_10401285 3300010375 Bacteria 1551
83 Ga0105239_10416415 3300010375 Bacteria 1522
84 Ga0157370_10001954 3300013104 Bacteria 25399
85 Ga0157369_10016425 3300013105 Bacteria 8325
86 Ga0157369_10322990 3300013105 Bacteria 1604
87 Ga0157369_10635774 3300013105 Bacteria 1101
88 Ga0157378_10140308 3300013297 Bacteria 2244
89 Ga0163162_10004530 3300013306 Bacteria 13382
90 Ga0163162_10341198 3300013306 Bacteria 1630
91 Ga0157375_10032281 3300013308 Bacteria 4965
92 Ga0182008_10029155 3300014497 Bacteria 2789
93 Ga0182007_10000513 3300015262 Bacteria 22905
94 Ga0183361_10001 3300016635 Bacteria 908583
95 Ga0163161_10152355 3300017792 Bacteria 1758
96 Ga0209436_100216 3300025208 Bacteria 26447
97 Ga0209674_100013 3300025226 Bacteria 813140
98 Ga0209674_100276 3300025226 Bacteria 38687
99 Ga0209672_100010 3300025228 Bacteria 873151
100 Ga0209147_100006 3300025229 Bacteria 873276
101 Ga0209563_106070 3300025230 Bacteria 2112
102 Ga0207427_102617 3300025231 Bacteria 4608
103 Ga0209258_100010 3300025242 Bacteria 873276
104 Ga0207425_1000001 3300025245 Bacteria 2525432
105 Ga0207425_1000039 3300025245 Bacteria 219078
106 Ga0209026_1004840 3300025250 Bacteria 3830
107 Ga0209148_1000018 3300025254 Bacteria 756247
108 Ga0209148_1002082 3300025254 Bacteria 7618
109 Ga0209759_1000132 3300025256 Bacteria 127521
110 Ga0209759_1000276 3300025256 Bacteria 72540
111 Ga0209759_1000971 3300025256 Bacteria 19897
112 Ga0209129_1000001 3300025258 Bacteria 1452436
113 Ga0209129_1001725 3300025258 Bacteria 11783
114 Ga0209233_1000093 3300025261 Bacteria 306016
115 Ga0209565_1000901 3300025263 Bacteria 16057
116 Ga0209565_1002806 3300025263 Bacteria 6029
117 Ga0209565_1005237 3300025263 Bacteria 3801
118 Ga0209565_1013447 3300025263 Bacteria 1915
119 Ga0209455_1000015 3300025272 Bacteria 756128
120 Ga0209673_1017929 3300025273 Bacteria 2594
121 Ga0209130_1001043 3300025284 Bacteria 21026
122 Ga0209130_1003615 3300025284 Bacteria 6428
123 Ga0209130_1006258 3300025284 Bacteria 3904
124 Ga0209675_1001665 3300025291 Bacteria 12372
125 Ga0209675_1002349 3300025291 Bacteria 9767
126 Ga0209675_1017292 3300025291 Bacteria 2064
127 Ga0209025_1000019 3300025294 Bacteria 631548
128 Ga0209564_1000109 3300025295 Bacteria 212912
129 Ga0209564_1021824 3300025295 Bacteria 2287
130 Ga0209758_1000020 3300025297 Bacteria 734220
131 Ga0209050_1000074 3300025298 Bacteria 289334
132 Ga0209050_1007129 3300025298 Bacteria 6381
133 Ga0209256_1000007 3300025299 Bacteria 1136599
134 Ga0209256_1000028 3300025299 Bacteria 420213
135 Ga0209256_1002827 3300025299 Bacteria 13252
136 Ga0209256_1008481 3300025299 Bacteria 4755
137 Ga0207426_1000007 3300025302 Bacteria 971011
138 Ga0207426_1002201 3300025302 Bacteria 13112
139 Ga0209257_1000003 3300025304 Bacteria 1702593
140 Ga0207713_1000041 3300025735 Bacteria 244768
141 Ga0207647_10007105 3300025904 Bacteria 8118
142 Ga0207647_10007767 3300025904 Bacteria 7721
143 Ga0207647_10009486 3300025904 Bacteria 6912
144 Ga0207705_10002916 3300025909 Bacteria 13072
145 Ga0207705_10004186 3300025909 Bacteria 10947
146 Ga0207705_10471091 3300025909 Bacteria 975
147 Ga0207695_10199206 3300025913 Bacteria 1917
148 Ga0207695_10250281 3300025913 Bacteria 1671
149 Ga0207671_10008421 3300025914 Bacteria 8749
150 Ga0207693_10022515 3300025915 Bacteria 5007
151 Ga0207660_10174955 3300025917 Bacteria 1664
152 Ga0207657_10052565 3300025919 Bacteria 3535
153 Ga0207657_10060043 3300025919 Bacteria 3264
154 Ga0207649_10015872 3300025920 Bacteria 4235
155 Ga0207690_10010502 3300025932 Bacteria 5506
156 Ga0207690_10095998 3300025932 Bacteria 2107
157 Ga0207706_10030803 3300025933 Bacteria 4784
158 Ga0207709_10294564 3300025935 Bacteria 1204
159 Ga0207711_10038979 3300025941 Bacteria 4040
160 Ga0207711_10054246 3300025941 Bacteria 3439
161 Ga0207679_10003425 3300025945 Bacteria 9784
162 Ga0207679_10435947 3300025945 Bacteria 1159
163 Ga0207667_10000751 3300025949 Bacteria 42107
164 Ga0207668_10026063 3300025972 Bacteria 3792
165 Ga0207658_10050557 3300025986 Bacteria 3059
166 Ga0207678_10002539 3300026067 Bacteria 16635
167 Ga0207678_10049167 3300026067 Bacteria 3644
168 Ga0207674_10175689 3300026116 Bacteria 2094
169 Ga0207683_10054218 3300026121 Bacteria 3516
170 Ga0207698_10165042 3300026142 Bacteria 1942
171 Ga0209282_1000001 3300027666 Bacteria 2450367
172 Ga0307408_100000126 3300031548 Bacteria 84345
173 Ga0307408_100002340 3300031548 Bacteria 13420
174 Ga0307408_100043019 3300031548 Bacteria 3212
175 Ga0307405_10002999 3300031731 Bacteria 7638
176 Ga0307412_10000016 3300031911 Bacteria 312878
177 Ga0307416_100003374 3300032002 Bacteria 9359
178 Ga0395899_0002693 3300037312 Bacteria 14324
179 Ga0395899_0006087 3300037312 Bacteria 9358
180 Ga0395899_0074778 3300037312 Bacteria 2474
181 Ga0395899_0289310 3300037312 Bacteria 1112
182 Ga0395900_0001653 3300037418 Bacteria 26100
183 Ga0395900_0215898 3300037418 Bacteria 1935
184 Ga0395898_0005070 3300037466 Bacteria 14281
185 Ga0395898_0110321 3300037466 Bacteria 2637
186 Ga0395898_0178786 3300037466 Bacteria 2027
187 Ga0395898_0183186 3300037466 Bacteria 2001
188 Ga0395898_0552658 3300037466 Bacteria 1093
189 Ga0395905_0000059 3300037471 Bacteria 198101
190 Ga0395905_0239070 3300037471 Bacteria 1697
191 Ga0395901_0000002 3300038443 Bacteria 761045
192 Ga0395901_0013746 3300038443 Bacteria 8227
193 Ga0395901_0069769 3300038443 Bacteria 3660
194 Ga0439439_0047336 3300041406 Bacteria 1124
195 Ga0439449_0011088 3300042007 Bacteria 3397
196 Ga0439454_016708 3300042011 Bacteria 1041
197 Ga0450904_001126 3300042139 Bacteria 4073
198 Ga0439458_0004961 3300042157 Bacteria 3015
199 Ga0450893_0034145 3300042532 Bacteria 915
200 Ga0466969_0026683 3300044656 Bacteria 2961
201 Ga0466965_0047204 3300044683 Bacteria 2132
202 Ga0466966_0008269 3300044684 Bacteria 6900
203 Ga0466961_0043123 3300044693 Bacteria 2890
204 Ga0466961_0176980 3300044693 Bacteria 1325
205 Ga0466963_0030022 3300044694 Bacteria 3504
206 Ga0466964_0000688 3300044706 Bacteria 10930
207 Ga0466964_0097458 3300044706 Bacteria 1290
208 Ga0466970_0211715 3300044765 Bacteria 1080
209 Ga0466957_0010852 3300044842 Bacteria 5238
210 Ga0466959_0062816 3300045049 Bacteria 2698
211 Ga0466958_0056458 3300045836 Bacteria 2385
212 Ga0466967_0038095 3300045976 Bacteria 4120
213 Ga0495617_000260 3300046452 Bacteria 30575
214 Ga0495627_000610 3300046453 Bacteria 28427
215 Ga0495627_013749 3300046453 Bacteria 2842
216 Ga0495627_040644 3300046453 Bacteria 1431
217 Ga0495592_0009476 3300046454 Bacteria 7320
218 Ga0495592_0177846 3300046454 Bacteria 1451
219 Ga0495603_0000668 3300046455 Bacteria 19416
220 Ga0495590_0001174 3300046457 Bacteria 11467
221 Ga0495590_0003130 3300046457 Bacteria 6766
222 Ga0495590_0017684 3300046457 Bacteria 2561
223 Ga0495590_0022965 3300046457 Bacteria 2204
224 Ga0495591_007718 3300046458 Bacteria 4517
225 Ga0495591_031123 3300046458 Bacteria 1604
226 Ga0495629_0000120 3300046459 Bacteria 69885
227 Ga0495629_0001049 3300046459 Bacteria 22104
228 Ga0495629_0027538 3300046459 Bacteria 4035
229 Ga0495629_0094565 3300046459 Bacteria 2085
230 Ga0495629_0154420 3300046459 Bacteria 1595
231 Ga0495638_0010584 3300046460 Bacteria 6390
232 Ga0495651_0115456 3300046462 Bacteria 1979
233 Ga0495651_0120632 3300046462 Bacteria 1927
234 Ga0495653_0013668 3300046463 Bacteria 6617
235 Ga0495653_0080399 3300046463 Bacteria 2412
236 Ga0495653_0176369 3300046463 Bacteria 1470
237 Ga0495653_0276602 3300046463 Bacteria 1103
238 Ga0495650_0000051 3300046471 Bacteria 318297
239 Ga0495650_0008207 3300046471 Bacteria 6135
240 Ga0495650_0008274 3300046471 Bacteria 6097
241 Ga0495650_0016809 3300046471 Bacteria 3688
242 Ga0495650_0037064 3300046471 Bacteria 2126
243 Ga0495650_0066530 3300046471 Bacteria 1426
244 Ga0495580_0000028 3300046472 Bacteria 80902
245 Ga0495580_0008072 3300046472 Bacteria 8400
246 Ga0495580_0016658 3300046472 Bacteria 5515
247 Ga0495580_0045978 3300046472 Bacteria 3099
248 Ga0495580_0166519 3300046472 Bacteria 1524
249 Ga0495580_0200591 3300046472 Bacteria 1374
250 Ga0495580_0294152 3300046472 Bacteria 1106
251 Ga0495582_0008117 3300046473 Bacteria 5797
252 Ga0495582_0014905 3300046473 Bacteria 4271
253 Ga0495582_0034169 3300046473 Bacteria 2795
254 Ga0495605_0000035 3300046474 Bacteria 208069
255 Ga0495605_0004281 3300046474 Bacteria 8410
256 Ga0495605_0012279 3300046474 Bacteria 4754
257 Ga0495605_0013814 3300046474 Bacteria 4437
258 Ga0495605_0016733 3300046474 Bacteria 3963
259 Ga0495605_0069880 3300046474 Bacteria 1661
260 Ga0495605_0113498 3300046474 Bacteria 1234
261 Ga0495605_0113596 3300046474 Bacteria 1233
262 Ga0495639_0103464 3300046475 Bacteria 1346
263 Ga0495662_0128911 3300046476 Bacteria 1243
264 Ga0495662_0147265 3300046476 Bacteria 1159
265 Ga0495662_0148055 3300046476 Bacteria 1156
266 Ga0495664_0016766 3300046477 Bacteria 4179
267 Ga0495584_0000720 3300046491 Bacteria 21815
268 Ga0495584_0090646 3300046491 Bacteria 1541
269 Ga0495584_0144566 3300046491 Bacteria 1208
270 Ga0495585_0004571 3300046492 Bacteria 8946
271 Ga0495585_0007350 3300046492 Bacteria 6751
272 Ga0495585_0008113 3300046492 Bacteria 6381
273 Ga0495585_0027845 3300046492 Bacteria 3225
274 Ga0495585_0073644 3300046492 Bacteria 1859
275 Ga0495594_0003218 3300046499 Bacteria 8461
276 Ga0495594_0035600 3300046499 Bacteria 2712
277 Ga0495596_0000013 3300046500 Bacteria 125228
278 Ga0495596_0000690 3300046500 Bacteria 20959
279 Ga0495596_0002683 3300046500 Bacteria 9393
280 Ga0495596_0004946 3300046500 Bacteria 6390
281 Ga0495596_0015854 3300046500 Bacteria 3142
282 Ga0495596_0024718 3300046500 Bacteria 2431
283 Ga0495596_0084219 3300046500 Bacteria 1234
284 Ga0495607_0015522 3300046501 Bacteria 4934
285 Ga0495607_0024290 3300046501 Bacteria 3781
286 Ga0495607_0055607 3300046501 Bacteria 2276
287 Ga0495583_0000388 3300046506 Bacteria 67604
288 Ga0495583_0002472 3300046506 Bacteria 15732
289 Ga0495583_0004126 3300046506 Bacteria 10644
290 Ga0495583_0005417 3300046506 Bacteria 8670
291 Ga0495583_0006367 3300046506 Bacteria 7739
292 Ga0495583_0025046 3300046506 Bacteria 2988
293 Ga0495583_0060984 3300046506 Bacteria 1684
294 Ga0495583_0066207 3300046506 Bacteria 1599
295 Ga0495583_0123775 3300046506 Bacteria 1086
296 Ga0495606_0000123 3300046507 Bacteria 131654
297 Ga0495606_0007590 3300046507 Bacteria 9655
298 Ga0495606_0016631 3300046507 Bacteria 5599
299 Ga0495606_0026434 3300046507 Bacteria 4138
300 Ga0495606_0029268 3300046507 Bacteria 3870
301 Ga0495606_0044154 3300046507 Bacteria 2966
302 Ga0495606_0060527 3300046507 Bacteria 2425
303 Ga0495606_0252576 3300046507 Bacteria 977
304 Ga0495608_0004593 3300046511 Bacteria 9857
305 Ga0495608_0018322 3300046511 Bacteria 4832
306 Ga0495610_0040787 3300046512 Bacteria 2336
307 Ga0495616_0000148 3300046513 Bacteria 61405
308 Ga0495616_0000445 3300046513 Bacteria 31542
309 Ga0495616_0005879 3300046513 Bacteria 7486
310 Ga0495616_0006755 3300046513 Bacteria 6916
311 Ga0495616_0010838 3300046513 Bacteria 5254
312 Ga0495616_0013674 3300046513 Bacteria 4570
313 Ga0495616_0015165 3300046513 Bacteria 4288
314 Ga0495616_0070946 3300046513 Bacteria 1685
315 Ga0495618_0000783 3300046514 Bacteria 22179
316 Ga0495618_0128847 3300046514 Bacteria 1619
317 Ga0495618_0168025 3300046514 Bacteria 1396
318 Ga0495620_0062997 3300046515 Bacteria 1538
319 Ga0495620_0069794 3300046515 Bacteria 1440
320 Ga0495628_0002218 3300046516 Bacteria 17573
321 Ga0495628_0012519 3300046516 Bacteria 7149
322 Ga0495628_0030813 3300046516 Bacteria 4341
323 Ga0495628_0398597 3300046516 Bacteria 1005
324 Ga0495630_0108629 3300046517 Bacteria 2101
325 Ga0495630_0143641 3300046517 Bacteria 1814
326 Ga0495631_0000474 3300046518 Bacteria 27019
327 Ga0495631_0001082 3300046518 Bacteria 16898
328 Ga0495631_0001317 3300046518 Bacteria 15204
329 Ga0495631_0001563 3300046518 Bacteria 13751
330 Ga0495631_0005278 3300046518 Bacteria 6788
331 Ga0495631_0007568 3300046518 Bacteria 5523
332 Ga0495631_0015778 3300046518 Bacteria 3612
333 Ga0495631_0044341 3300046518 Bacteria 1960
334 Ga0495631_0055375 3300046518 Bacteria 1728
335 Ga0495632_0000034 3300046519 Bacteria 162850
336 Ga0495632_0000972 3300046519 Bacteria 25009
337 Ga0495632_0001458 3300046519 Bacteria 19650
338 Ga0495643_0000259 3300046522 Bacteria 77609
339 Ga0495643_0027451 3300046522 Bacteria 3199
340 Ga0495644_0011392 3300046523 Bacteria 3423
341 Ga0495644_0019752 3300046523 Bacteria 2572
342 Ga0495644_0025894 3300046523 Bacteria 2225
343 Ga0495644_0030773 3300046523 Bacteria 2027
344 Ga0495648_0002868 3300046524 Bacteria 15528
345 Ga0495648_0060857 3300046524 Bacteria 2244
346 Ga0495648_0080577 3300046524 Bacteria 1854
347 Ga0495648_0102191 3300046524 Bacteria 1579
348 Ga0495648_0162592 3300046524 Bacteria 1152
349 Ga0495666_0005557 3300046526 Bacteria 6351
350 Ga0495666_0027001 3300046526 Bacteria 2826
351 Ga0495666_0027811 3300046526 Bacteria 2783
352 Ga0495666_0042475 3300046526 Bacteria 2198
353 Ga0495666_0112784 3300046526 Bacteria 1276
354 Ga0495642_0000005 3300046528 Bacteria 176726
355 Ga0495642_0000267 3300046528 Bacteria 29446
356 Ga0495642_0000674 3300046528 Bacteria 16988
357 Ga0495642_0008978 3300046528 Bacteria 3825
358 Ga0495642_0010874 3300046528 Bacteria 3488
359 Ga0495642_0024206 3300046528 Bacteria 2401
360 Ga0495652_0069592 3300046529 Bacteria 2945
361 Ga0495654_0004267 3300046530 Bacteria 8538
362 Ga0495654_0005983 3300046530 Bacteria 6990
363 Ga0495654_0021694 3300046530 Bacteria 3340
364 Ga0495654_0023968 3300046530 Bacteria 3157
365 Ga0495665_0012149 3300046531 Bacteria 4662
366 Ga0495665_0089268 3300046531 Bacteria 1619
367 Ga0495665_0162270 3300046531 Bacteria 1164
368 Ga0495665_0220162 3300046531 Bacteria 981
369 Ga0495640_0024515 3300046533 Bacteria 4387
370 Ga0495640_0069911 3300046533 Bacteria 2360
371 Ga0495640_0128259 3300046533 Bacteria 1643
372 Ga0495586_0026601 3300046535 Bacteria 3095
373 Ga0495586_0126500 3300046535 Bacteria 1429
374 Ga0495587_0113172 3300046536 Bacteria 1557
375 Ga0495587_0128295 3300046536 Bacteria 1450
376 Ga0495609_0000852 3300046538 Bacteria 22505
377 Ga0495609_0026819 3300046538 Bacteria 2636
378 Ga0495609_0041799 3300046538 Bacteria 2059
379 Ga0495609_0061387 3300046538 Bacteria 1660
380 Ga0495597_0000260 3300046542 Bacteria 48197
381 Ga0495597_0000736 3300046542 Bacteria 26118
382 Ga0495597_0006318 3300046542 Bacteria 6138
383 Ga0495597_0087232 3300046542 Bacteria 1328
384 Ga0495645_0025344 3300046543 Bacteria 4303
385 Ga0495645_0129885 3300046543 Bacteria 1766
386 Ga0495622_0000900 3300046557 Bacteria 16166
387 Ga0495622_0005910 3300046557 Bacteria 5684
388 Ga0495622_0014043 3300046557 Bacteria 3716
389 Ga0495633_0010176 3300046558 Bacteria 5147
390 Ga0495667_0030677 3300046559 Bacteria 3612
391 Ga0495667_0035247 3300046559 Bacteria 3345
392 Ga0495667_0220532 3300046559 Bacteria 1210
393 Ga0495656_0003365 3300046615 Bacteria 5406
394 Ga0495668_0000845 3300046616 Bacteria 34738
395 Ga0495668_0001020 3300046616 Bacteria 29835
396 Ga0495668_0001671 3300046616 Bacteria 20616
397 Ga0495668_0001969 3300046616 Bacteria 18089
398 Ga0495668_0056500 3300046616 Bacteria 2166
399 Ga0495634_0019131 3300046642 Bacteria 4867
400 Ga0495634_0175704 3300046642 Bacteria 1344
401 Ga0495611_0007359 3300046648 Bacteria 4674
402 Ga0495611_0022925 3300046648 Bacteria 2704
403 Ga0495611_0040857 3300046648 Bacteria 2068
404 Ga0495611_0044735 3300046648 Bacteria 1981
405 Ga0495611_0100557 3300046648 Bacteria 1342
406 Ga0495611_0146222 3300046648 Bacteria 1103
407 Ga0495625_0156463 3300046660 Bacteria 1529
408 Ga0495635_0014195 3300046663 Bacteria 5575
409 Ga0495635_0014602 3300046663 Bacteria 5493
410 Ga0495635_0231001 3300046663 Bacteria 1250
411 Ga0495661_0000430 3300046665 Bacteria 44306
412 Ga0495661_0001021 3300046665 Bacteria 24862
413 Ga0495661_0001062 3300046665 Bacteria 24266
414 Ga0495661_0013437 3300046665 Bacteria 5497
415 Ga0495661_0015841 3300046665 Bacteria 5019
416 Ga0495661_0037472 3300046665 Bacteria 3027
417 Ga0495661_0043068 3300046665 Bacteria 2778
418 Ga0495661_0050510 3300046665 Bacteria 2517
419 Ga0495661_0091596 3300046665 Bacteria 1728
420 Ga0495661_0095308 3300046665 Bacteria 1685
421 Ga0495588_0000055 3300046674 Bacteria 280059
422 Ga0495588_0006444 3300046674 Bacteria 5286
423 Ga0495588_0007023 3300046674 Bacteria 5105
424 Ga0495588_0034103 3300046674 Bacteria 2574
425 Ga0495588_0209815 3300046674 Bacteria 1028
426 Ga0495657_0148191 3300046675 Bacteria 1459
427 Ga0495599_0007864 3300046678 Bacteria 6467
428 Ga0495599_0150340 3300046678 Bacteria 1442
429 Ga0495599_0223061 3300046678 Bacteria 1152
430 Ga0495623_0015721 3300046679 Bacteria 4890
431 Ga0495623_0112604 3300046679 Bacteria 1647
432 Ga0495646_0014995 3300046680 Bacteria 4923
433 Ga0495646_0037982 3300046680 Bacteria 2975
434 Ga0495646_0056992 3300046680 Bacteria 2341
435 Ga0495646_0096627 3300046680 Bacteria 1698
436 Ga0495646_0231855 3300046680 Bacteria 995
437 Ga0495669_0000053 3300046684 Bacteria 79258
438 Ga0495669_0003341 3300046684 Bacteria 6604
439 Ga0495669_0006203 3300046684 Bacteria 4988
440 Ga0495669_0013211 3300046684 Bacteria 3517
441 Ga0495669_0016595 3300046684 Bacteria 3154
442 Ga0495669_0018580 3300046684 Bacteria 2990
443 Ga0495669_0150374 3300046684 Bacteria 1102
444 Ga0495613_0013994 3300046689 Bacteria 5955
445 Ga0495613_0041998 3300046689 Bacteria 3384
446 Ga0495613_0153921 3300046689 Bacteria 1638
447 Ga0495613_0293114 3300046689 Bacteria 1127
448 Ga0495624_0008468 3300046690 Bacteria 7168
449 Ga0495624_0015611 3300046690 Bacteria 5122
450 Ga0495624_0024827 3300046690 Bacteria 3942
451 Ga0495624_0078357 3300046690 Bacteria 2049
452 Ga0495670_0011098 3300046691 Bacteria 4428
453 Ga0495670_0017399 3300046691 Bacteria 3536
454 Ga0495670_0028091 3300046691 Bacteria 2788
455 Ga0495670_0031716 3300046691 Bacteria 2626
456 Ga0495670_0050293 3300046691 Bacteria 2086
457 Ga0495671_0002118 3300046692 Bacteria 12683
458 Ga0495671_0004037 3300046692 Bacteria 8864
459 Ga0495671_0028090 3300046692 Bacteria 2900
460 Ga0495671_0028128 3300046692 Bacteria 2898
461 Ga0495649_0007472 3300046694 Bacteria 6656
462 Ga0495649_0054568 3300046694 Bacteria 2161
463 Ga0495649_0082191 3300046694 Bacteria 1721
464 Ga0495649_0122157 3300046694 Bacteria 1377
465 Ga0495589_0000642 3300046794 Bacteria 22869
466 Ga0495589_0043342 3300046794 Bacteria 2240
467 Ga0495589_0047434 3300046794 Bacteria 2129
468 Ga0495589_0059727 3300046794 Bacteria 1873
469 Ga0495589_0064144 3300046794 Bacteria 1801
470 Ga0495589_0091833 3300046794 Bacteria 1474
471 Ga0495589_0120481 3300046794 Bacteria 1263
472 Ga0495660_0023034 3300046810 Bacteria 3553
473 Ga0495581_0002764 3300047315 Bacteria 9995
474 Ga0495581_0004999 3300047315 Bacteria 7680
475 Ga0495581_0031872 3300047315 Bacteria 3054
476 Ga0495604_0025046 3300047317 Bacteria 4756
477 Ga0495604_0029016 3300047317 Bacteria 4402
478 Ga0495604_0077861 3300047317 Bacteria 2490
479 Ga0495604_0103364 3300047317 Bacteria 2090
480 Ga0495674_0009837 3300047319 Bacteria 9075
481 Ga0495674_0027537 3300047319 Bacteria 5192
482 Ga0495674_0028689 3300047319 Bacteria 5069
483 Ga0495674_0076415 3300047319 Bacteria 2881
484 Ga0495674_0152353 3300047319 Bacteria 1938
485 Ga0495674_0246101 3300047319 Bacteria 1472
486 Ga0495672_0000074 3300047320 Bacteria 179013
487 Ga0495672_0002998 3300047320 Bacteria 14847
488 Ga0495672_0003849 3300047320 Bacteria 12621
489 Ga0495676_0000030 3300047321 Bacteria 133637
490 Ga0495676_0106738 3300047321 Bacteria 2063
491 Ga0495676_0315886 3300047321 Bacteria 1050
492 Ga0495680_0020921 3300047322 Bacteria 5488
493 Ga0495680_0052052 3300047322 Bacteria 3193
494 Ga0495680_0273369 3300047322 Bacteria 1192
495 Ga0495683_0007615 3300047323 Bacteria 5832
496 Ga0495683_0009735 3300047323 Bacteria 5110
497 Ga0495683_0011299 3300047323 Bacteria 4700
498 Ga0495683_0020963 3300047323 Bacteria 3369
499 Ga0495683_0021710 3300047323 Bacteria 3306
500 Ga0495683_0042411 3300047323 Bacteria 2294
501 Ga0495683_0075908 3300047323 Bacteria 1645
502 Ga0495683_0127331 3300047323 Bacteria 1204
503 Ga0495687_000002 3300047443 Bacteria 1085770
504 Ga0495687_000189 3300047443 Bacteria 89686
505 Ga0495687_001755 3300047443 Bacteria 19170
506 Ga0495687_013837 3300047443 Bacteria 4184
507 Ga0495687_017388 3300047443 Bacteria 3590
508 Ga0495687_045032 3300047443 Bacteria 1913
509 Ga0495687_058081 3300047443 Bacteria 1606
510 Ga0495675_0008197 3300047444 Bacteria 6466
511 Ga0495675_0018091 3300047444 Bacteria 4469
512 Ga0495675_0061982 3300047444 Bacteria 2368
513 Ga0495675_0096113 3300047444 Bacteria 1857
514 Ga0495675_0265776 3300047444 Bacteria 1026
515 Ga0495677_0002242 3300047445 Bacteria 7641
516 Ga0495677_0003600 3300047445 Bacteria 6009
517 Ga0495677_0025201 3300047445 Bacteria 2158
518 Ga0495679_000044 3300047446 Bacteria 138399
519 Ga0495679_002004 3300047446 Bacteria 10789
520 Ga0495679_002410 3300047446 Bacteria 9547
521 Ga0495679_007903 3300047446 Bacteria 4379
522 Ga0495679_051499 3300047446 Bacteria 1234
523 Ga0495679_068956 3300047446 Bacteria 1022
524 Ga0495685_000729 3300047447 Bacteria 10059
525 Ga0495673_0111173 3300047469 Bacteria 1095
526 Ga0495681_0000021 3300047470 Bacteria 166534
527 Ga0495681_0000105 3300047470 Bacteria 73364
528 Ga0495681_0017485 3300047470 Bacteria 3978
529 Ga0495681_0095069 3300047470 Bacteria 1310
530 Ga0495684_0024229 3300047471 Bacteria 4671
531 Ga0495684_0151220 3300047471 Bacteria 1735
532 Ga0495686_0057599 3300047472 Bacteria 2425
533 Ga0495686_0082414 3300047472 Bacteria 1963
534 Ga0495686_0106894 3300047472 Bacteria 1682
535 Ga0495593_0016311 3300047673 Bacteria 4191
536 Ga0495593_0064923 3300047673 Bacteria 1904
537 Ga0495593_0150455 3300047673 Bacteria 1177
538 Ga0495602_0016007 3300048088 Bacteria 7549
539 Ga0495602_0199980 3300048088 Bacteria 1525
540 Ga0495602_0202676 3300048088 Bacteria 1512
541 Ga0495614_0021995 3300048089 Bacteria 2753
542 Ga0495614_0106590 3300048089 Bacteria 1228
543 Ga0495626_0000004 3300048091 Bacteria 356599
544 Ga0495626_0003040 3300048091 Bacteria 11030
545 Ga0495626_0006157 3300048091 Bacteria 6864
546 Ga0495626_0007699 3300048091 Bacteria 5969
547 Ga0495626_0061497 3300048091 Bacteria 1707
548 Ga0495626_0119180 3300048091 Bacteria 1136
549 Ga0495626_0134444 3300048091 Bacteria 1053
550 Ga0496100_0042021 3300048903 Bacteria 2917
551 Ga0496100_0156382 3300048903 Bacteria 1630
552 Ga0496100_0314691 3300048903 Bacteria 1174
553 Ga0496101_0053366 3300048904 Bacteria 2916
554 Ga0496102_0000952 3300048905 Bacteria 27286
555 Ga0496102_0176351 3300048905 Bacteria 2013
556 Ga0496102_0457550 3300048905 Bacteria 1197
557 Ga0496102_0550471 3300048905 Bacteria 1076
558 Ga0496103_0023185 3300048906 Bacteria 3742
559 Ga0496103_0063218 3300048906 Bacteria 2305
560 Ga0496103_0135844 3300048906 Bacteria 1571
561 Ga0496103_0205543 3300048906 Bacteria 1266
562 Ga0496103_0312242 3300048906 Bacteria 1011
563 Ga0496104_0053613 3300048907 Bacteria 3811
564 Ga0496104_0529470 3300048907 Bacteria 1089
565 Ga0496105_0037896 3300048908 Bacteria 3971
566 Ga0496105_0054776 3300048908 Bacteria 3293
567 Ga0496105_0247700 3300048908 Bacteria 1444
568 Ga0496105_0265306 3300048908 Bacteria 1388
569 Ga0496106_0407164 3300048909 Bacteria 1093
570 Ga0496107_0093938 3300048910 Bacteria 2194
571 Ga0496107_0458664 3300048910 Bacteria 946
572 Ga0496110_0000016 3300048913 Bacteria 85281
573 Ga0496110_0006719 3300048913 Bacteria 9145
574 Ga0496111_0031134 3300048914 Bacteria 3799
575 Ga0496113_0040116 3300048916 Bacteria 3449
576 Ga0496113_0360159 3300048916 Bacteria 1167
577 Ga0496114_0018795 3300048917 Bacteria 5593
578 Ga0496114_0043333 3300048917 Bacteria 3731
579 Ga0496114_0241077 3300048917 Bacteria 1590
580 Ga0496115_0240087 3300048918 Bacteria 1493
581 Ga0496116_0023372 3300048919 Bacteria 4604
582 Ga0496117_0003285 3300048920 Bacteria 18966
583 Ga0496117_0007812 3300048920 Bacteria 10305
584 Ga0496117_0032372 3300048920 Bacteria 3973
585 Ga0496117_0071154 3300048920 Bacteria 2332
586 Ga0496117_0162111 3300048920 Bacteria 1308
587 Ga0496118_0007323 3300048921 Bacteria 11738
588 Ga0496118_0019911 3300048921 Bacteria 5974
589 Ga0496118_0020437 3300048921 Bacteria 5871
590 Ga0496118_0034960 3300048921 Bacteria 4090
591 Ga0496118_0045433 3300048921 Bacteria 3429
592 Ga0496118_0058090 3300048921 Bacteria 2894
593 Ga0496118_0116338 3300048921 Bacteria 1757
594 Ga0496121_0012745 3300048924 Bacteria 9110
595 Ga0496121_0025223 3300048924 Bacteria 5649
596 Ga0496121_0029343 3300048924 Bacteria 5090
597 Ga0496121_0093054 3300048924 Bacteria 2348
598 Ga0496121_0102682 3300048924 Bacteria 2202
599 Ga0496121_0251443 3300048924 Bacteria 1225
600 Ga0496121_0341106 3300048924 Bacteria 1001
601 Ga0496122_0000263 3300048925 Bacteria 117762
602 Ga0496123_0000156 3300048926 Bacteria 139362
603 Ga0496123_0177476 3300048926 Bacteria 1116
604 Ga0496124_0008002 3300048927 Bacteria 11123
605 Ga0496124_0029447 3300048927 Bacteria 4892
606 Ga0496125_0000669 3300048928 Bacteria 57185
607 Ga0496125_0253950 3300048928 Bacteria 1107
608 Ga0496126_0000061 3300048929 Bacteria 261515
609 Ga0496126_0001219 3300048929 Bacteria 41827
610 Ga0496126_0006224 3300048929 Bacteria 13342
611 Ga0496126_0015424 3300048929 Bacteria 7687
612 Ga0496126_0073998 3300048929 Bacteria 3026
613 Ga0496126_0098494 3300048929 Bacteria 2561
614 Ga0495678_000249 3300049459 Bacteria 60291
615 Ga0495678_001742 3300049459 Bacteria 16184
616 Ga0495678_044324 3300049459 Bacteria 1760
617 Ga0495678_051888 3300049459 Bacteria 1582
618 Ga0495682_0001054 3300049460 Bacteria 16260
619 Ga0495682_0035474 3300049460 Bacteria 1837
620 Ga0501038_0036944 3300049574 Bacteria 4285
621 Ga0501047_0036967 3300049581 Bacteria 4720
622 Ga0501035_0015653 3300049822 Bacteria 7000
623 Ga0501044_0004315 3300049823 Bacteria 15940
624 Ga0501044_0164176 3300049823 Bacteria 2196
625 nmdc:mga00v17_43434_c1 3300050491 Bacteria 2707
626 nmdc:mga0k408_24983_c1 3300050493 Bacteria 3380
627 nmdc:mga0k408_96857_c1 3300050493 Bacteria 1737
628 Ga0500618_024588 3300053125 Bacteria 1450
629 Ga0500618_027274 3300053125 Bacteria 1360
630 Ga0500559_0004268 3300053136 Bacteria 6837

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046794 Ga0495589_0059727 Ga0495589_0059727_1084_1842 243
2 3300031548 Ga0307408_100000126 Ga0307408_10000012681 245
3 3300044693 Ga0466961_0176980 Ga0466961_0176980_62_820 246
4 3300046474 Ga0495605_0069880 Ga0495605_0069880_878_1645 246
5 3300046513 Ga0495616_0070946 Ga0495616_0070946_908_1675 246
6 3300046616 Ga0495668_0001671 Ga0495668_0001671_17_784 246
7 3300046458 Ga0495591_007718 Ga0495591_007718_3498_4265 250
8 3300046459 Ga0495629_0094565 Ga0495629_0094565_591_1358 250
9 3300046463 Ga0495653_0176369 Ga0495653_0176369_25_792 250
10 3300046476 Ga0495662_0128911 Ga0495662_0128911_449_1216 250
11 3300046511 Ga0495608_0018322 Ga0495608_0018322_3997_4764 250
12 3300047315 Ga0495581_0031872 Ga0495581_0031872_299_1066 250
13 3300047446 Ga0495679_007903 Ga0495679_007903_810_1577 250
14 3300049823 Ga0501044_0164176 Ga0501044_0164176_145_987 251
15 3300005455 Ga0070663_100002763 Ga0070663_1000027633 266
16 3300026067 Ga0207678_10002539 Ga0207678_1000253914 266
17 3300046463 Ga0495653_0013668 Ga0495653_0013668_2432_3319 266
18 3300046472 Ga0495580_0200591 Ga0495580_0200591_462_1349 266
19 3300046690 Ga0495624_0008468 Ga0495624_0008468_21_908 266
20 3300047319 Ga0495674_0028689 Ga0495674_0028689_4157_5044 266
21 3300047673 Ga0495593_0016311 Ga0495593_0016311_3279_4166 266
22 3300046794 Ga0495589_0047434 Ga0495589_0047434_938_1786 267
23 iso_pu_bacteria 2643221554 2643790802 268
24 iso_pu_bacteria 2643221638 2644211723 268
25 3300003374 JGI25161J50226_1003685 JGI25161J50226_10036852 270
26 iso_pu_bacteria 2643221556 2643799955 270
27 iso_pu_bacteria 2643221664 2644357488 270
28 iso_pu_bacteria 2643221684 2644474956 270
29 iso_pu_bacteria 2919476304 2919478233 270
30 3300053125 Ga0500618_024588 Ga0500618_024588_240_1100 271
31 3300053136 Ga0500559_0004268 Ga0500559_0004268_5655_6515 271
32 3300002773 JGI25152J39213_1013483 JGI25152J39213_10134832 272
33 3300002987 JGI25159J45721_1000340 JGI25159J45721_10003402 272
34 3300003374 JGI25161J50226_1004633 JGI25161J50226_10046333 272
35 3300003771 Ga0055526_1000602 Ga0055526_100060230 272
36 3300003771 Ga0055526_1015001 Ga0055526_10150012 272
37 3300003773 Ga0055537_1010418 Ga0055537_10104182 272
38 3300003775 Ga0055524_1006395 Ga0055524_10063952 272
39 3300003775 Ga0055524_1006501 Ga0055524_10065015 272
40 3300003790 Ga0055528_1009739 Ga0055528_10097394 272
41 3300003791 Ga0055530_10013666 Ga0055530_100136662 272
42 3300003794 Ga0055531_10009510 Ga0055531_100095102 272
43 3300004625 Ga0055543_1000136 Ga0055543_100013648 272
44 3300005262 Ga0065165_1001278 Ga0065165_100127831 272
45 3300005444 Ga0070694_100472760 Ga0070694_1004727601 272
46 3300005458 Ga0070681_10037120 Ga0070681_100371207 272
47 3300005563 Ga0068855_100190876 Ga0068855_1001908761 272
48 3300005577 Ga0068857_100063667 Ga0068857_1000636672 272
49 3300006881 Ga0068865_100252598 Ga0068865_1002525981 272
50 3300009545 Ga0105237_10010747 Ga0105237_100107476 272
51 3300009551 Ga0105238_10084943 Ga0105238_100849432 272
52 3300010375 Ga0105239_10401285 Ga0105239_104012852 272
53 3300013105 Ga0157369_10635774 Ga0157369_106357742 272
54 3300025208 Ga0209436_100216 Ga0209436_1002164 272
55 3300025263 Ga0209565_1002806 Ga0209565_10028066 272
56 3300025284 Ga0209130_1001043 Ga0209130_10010438 272
57 3300025291 Ga0209675_1001665 Ga0209675_100166513 272
58 3300025295 Ga0209564_1000109 Ga0209564_1000109197 272
59 3300025298 Ga0209050_1000074 Ga0209050_1000074197 272
60 3300025299 Ga0209256_1002827 Ga0209256_100282713 272
61 3300025914 Ga0207671_10008421 Ga0207671_100084219 272
62 3300025917 Ga0207660_10174955 Ga0207660_101749551 272
63 3300026116 Ga0207674_10175689 Ga0207674_101756892 272
64 3300031548 Ga0307408_100043019 Ga0307408_1000430193 272
65 3300046453 Ga0495627_040644 Ga0495627_040644_387_1250 272
66 3300046459 Ga0495629_0027538 Ga0495629_0027538_2289_3152 272
67 3300046473 Ga0495582_0014905 Ga0495582_0014905_596_1459 272
68 3300046474 Ga0495605_0016733 Ga0495605_0016733_1454_2317 272
69 3300046491 Ga0495584_0090646 Ga0495584_0090646_658_1521 272
70 3300046492 Ga0495585_0004571 Ga0495585_0004571_3922_4785 272
71 3300046492 Ga0495585_0027845 Ga0495585_0027845_139_1014 272
72 3300046499 Ga0495594_0035600 Ga0495594_0035600_590_1453 272
73 3300046500 Ga0495596_0024718 Ga0495596_0024718_1548_2411 272
74 3300046501 Ga0495607_0015522 Ga0495607_0015522_3988_4851 272
75 3300046507 Ga0495606_0060527 Ga0495606_0060527_727_1590 272
76 3300046513 Ga0495616_0006755 Ga0495616_0006755_3674_4537 272
77 3300046518 Ga0495631_0001082 Ga0495631_0001082_3424_4287 272
78 3300046518 Ga0495631_0007568 Ga0495631_0007568_1083_1946 272
79 3300046523 Ga0495644_0025894 Ga0495644_0025894_596_1459 272
80 3300046528 Ga0495642_0008978 Ga0495642_0008978_2831_3694 272
81 3300046538 Ga0495609_0026819 Ga0495609_0026819_1284_2147 272
82 3300046557 Ga0495622_0005910 Ga0495622_0005910_881_1744 272
83 3300046557 Ga0495622_0014043 Ga0495622_0014043_837_1700 272
84 3300046558 Ga0495633_0010176 Ga0495633_0010176_1075_1938 272
85 3300046648 Ga0495611_0022925 Ga0495611_0022925_767_1630 272
86 3300046648 Ga0495611_0146222 Ga0495611_0146222_103_966 272
87 3300046665 Ga0495661_0000430 Ga0495661_0000430_22228_23091 272
88 3300046674 Ga0495588_0006444 Ga0495588_0006444_4339_5214 272
89 3300046674 Ga0495588_0034103 Ga0495588_0034103_37_900 272
90 3300046684 Ga0495669_0000053 Ga0495669_0000053_64911_65774 272
91 3300046689 Ga0495613_0013994 Ga0495613_0013994_2729_3592 272
92 3300046691 Ga0495670_0017399 Ga0495670_0017399_1041_1904 272
93 3300047315 Ga0495581_0002764 Ga0495581_0002764_3585_4448 272
94 3300047321 Ga0495676_0000030 Ga0495676_0000030_117739_118602 272
95 3300047443 Ga0495687_013837 Ga0495687_013837_3222_4070 272
96 3300047445 Ga0495677_0003600 Ga0495677_0003600_5124_5987 272
97 3300047445 Ga0495677_0025201 Ga0495677_0025201_1275_2138 272
98 3300047470 Ga0495681_0017485 Ga0495681_0017485_437_1300 272
99 iso_pu_bacteria 2510917013 2511085669 272
100 iso_pu_bacteria 2511231026 2511385171 272
101 iso_pu_bacteria 2513237166 2514047493 272
102 iso_pu_bacteria 2515154123 2515692288 272
103 iso_pu_bacteria 2562617112 2563059601 272
104 iso_pu_bacteria 2711768613 2713479453 272
105 iso_pu_bacteria 2765235838 2765569808 272
106 iso_pu_bacteria 2791355137 2792839497 272
107 iso_pu_bacteria 2839094727 2839097251 272
108 iso_pu_bacteria 2900634093 2900641889 272
109 iso_pu_bacteria 2900634093 2900643318 272
110 iso_pu_bacteria 2904615490 2904620569 272
111 iso_pu_bacteria 642555112 642592248 272
112 3300002773 JGI25152J39213_1000242 JGI25152J39213_10002423 273
113 3300002774 JGI25150J39212_1009142 JGI25150J39212_10091421 273
114 3300003187 JGI25151J46595_10000121 JGI25151J46595_1000012164 273
115 3300003215 JGI25153J46596_10001631 JGI25153J46596_100016312 273
116 3300003775 Ga0055524_1000223 Ga0055524_100022324 273
117 3300025245 Ga0207425_1000001 Ga0207425_10000011067 273
118 3300025245 Ga0207425_1000039 Ga0207425_1000039186 273
119 3300025258 Ga0209129_1000001 Ga0209129_1000001244 273
120 3300025258 Ga0209129_1001725 Ga0209129_100172511 273
121 3300025263 Ga0209565_1000901 Ga0209565_10009017 273
122 3300025263 Ga0209565_1005237 Ga0209565_10052373 273
123 3300025263 Ga0209565_1013447 Ga0209565_10134472 273
124 3300025273 Ga0209673_1017929 Ga0209673_10179293 273
125 3300025284 Ga0209130_1003615 Ga0209130_10036157 273
126 3300025291 Ga0209675_1002349 Ga0209675_10023492 273
127 3300025294 Ga0209025_1000019 Ga0209025_1000019128 273
128 3300025295 Ga0209564_1021824 Ga0209564_10218242 273
129 3300025297 Ga0209758_1000020 Ga0209758_1000020209 273
130 3300025298 Ga0209050_1007129 Ga0209050_10071299 273
131 3300025299 Ga0209256_1000028 Ga0209256_1000028182 273
132 3300025299 Ga0209256_1008481 Ga0209256_10084816 273
133 3300025302 Ga0207426_1002201 Ga0207426_10022018 273
134 3300025304 Ga0209257_1000003 Ga0209257_100000324 273
135 3300041406 Ga0439439_0047336 Ga0439439_0047336_23_883 273
136 3300042011 Ga0439454_016708 Ga0439454_016708_46_885 273
137 3300042139 Ga0450904_001126 Ga0450904_001126_3019_3858 273
138 3300046459 Ga0495629_0000120 Ga0495629_0000120_41930_42778 273
139 3300046471 Ga0495650_0008274 Ga0495650_0008274_5157_6005 273
140 3300046472 Ga0495580_0045978 Ga0495580_0045978_2068_2916 273
141 3300046474 Ga0495605_0113596 Ga0495605_0113596_362_1201 273
142 3300046475 Ga0495639_0103464 Ga0495639_0103464_168_1016 273
143 3300046476 Ga0495662_0148055 Ga0495662_0148055_203_1051 273
144 3300046500 Ga0495596_0084219 Ga0495596_0084219_224_1072 273
145 3300046506 Ga0495583_0002472 Ga0495583_0002472_12172_13011 273
146 3300046506 Ga0495583_0066207 Ga0495583_0066207_459_1307 273
147 3300046507 Ga0495606_0000123 Ga0495606_0000123_1025_1882 273
148 3300046507 Ga0495606_0007590 Ga0495606_0007590_4817_5665 273
149 3300046513 Ga0495616_0000445 Ga0495616_0000445_11655_12494 273
150 3300046522 Ga0495643_0000259 Ga0495643_0000259_22417_23256 273
151 3300046528 Ga0495642_0024206 Ga0495642_0024206_1326_2174 273
152 3300046530 Ga0495654_0021694 Ga0495654_0021694_2388_3236 273
153 3300046531 Ga0495665_0220162 Ga0495665_0220162_82_930 273
154 3300046543 Ga0495645_0129885 Ga0495645_0129885_745_1593 273
155 3300046559 Ga0495667_0035247 Ga0495667_0035247_2255_3103 273
156 3300046642 Ga0495634_0175704 Ga0495634_0175704_456_1304 273
157 3300046663 Ga0495635_0231001 Ga0495635_0231001_174_1022 273
158 3300046674 Ga0495588_0209815 Ga0495588_0209815_23_871 273
159 3300046680 Ga0495646_0231855 Ga0495646_0231855_136_984 273
160 3300046694 Ga0495649_0007472 Ga0495649_0007472_5083_5931 273
161 3300046694 Ga0495649_0082191 Ga0495649_0082191_89_934 273
162 3300046794 Ga0495589_0120481 Ga0495589_0120481_144_992 273
163 3300047323 Ga0495683_0009735 Ga0495683_0009735_3768_4616 273
164 3300047323 Ga0495683_0127331 Ga0495683_0127331_309_1157 273
165 3300047444 Ga0495675_0265776 Ga0495675_0265776_66_914 273
166 3300047446 Ga0495679_068956 Ga0495679_068956_94_942 273
167 3300047673 Ga0495593_0150455 Ga0495593_0150455_284_1132 273
168 3300048089 Ga0495614_0106590 Ga0495614_0106590_191_1039 273
169 3300048091 Ga0495626_0006157 Ga0495626_0006157_5352_6191 273
170 3300048905 Ga0496102_0457550 Ga0496102_0457550_157_1008 273
171 3300048910 Ga0496107_0093938 Ga0496107_0093938_192_1043 273
172 3300048913 Ga0496110_0006719 Ga0496110_0006719_6452_7303 273
173 3300048914 Ga0496111_0031134 Ga0496111_0031134_2489_3340 273
174 3300048917 Ga0496114_0043333 Ga0496114_0043333_2463_3311 273
175 3300048918 Ga0496115_0240087 Ga0496115_0240087_324_1172 273
176 iso_pu_bacteria 2881412998 2881415636 273
177 3300005262 Ga0065165_1023776 Ga0065165_10237762 274
178 3300005327 Ga0070658_10073628 Ga0070658_100736282 274
179 3300005334 Ga0068869_100174554 Ga0068869_1001745541 274
180 3300005339 Ga0070660_100324756 Ga0070660_1003247561 274
181 3300005455 Ga0070663_100332489 Ga0070663_1003324892 274
182 3300005457 Ga0070662_100267283 Ga0070662_1002672831 274
183 3300005459 Ga0068867_100372316 Ga0068867_1003723161 274
184 3300005563 Ga0068855_100225092 Ga0068855_1002250922 274
185 3300006051 Ga0075364_10058832 Ga0075364_100588322 274
186 3300006881 Ga0068865_100055022 Ga0068865_1000550223 274
187 3300009093 Ga0105240_10057081 Ga0105240_100570812 274
188 3300009148 Ga0105243_10182818 Ga0105243_101828182 274
189 3300009551 Ga0105238_10191917 Ga0105238_101919173 274
190 3300010375 Ga0105239_10416415 Ga0105239_104164152 274
191 3300013297 Ga0157378_10140308 Ga0157378_101403083 274
192 3300013306 Ga0163162_10004530 Ga0163162_100045308 274
193 3300013308 Ga0157375_10032281 Ga0157375_100322813 274
194 3300025254 Ga0209148_1002082 Ga0209148_10020828 274
195 3300025909 Ga0207705_10004186 Ga0207705_100041867 274
196 3300025909 Ga0207705_10471091 Ga0207705_104710911 274
197 3300025919 Ga0207657_10052565 Ga0207657_100525656 274
198 3300025933 Ga0207706_10030803 Ga0207706_100308033 274
199 3300025935 Ga0207709_10294564 Ga0207709_102945641 274
200 3300025941 Ga0207711_10054246 Ga0207711_100542464 274
201 3300025945 Ga0207679_10435947 Ga0207679_104359471 274
202 3300025972 Ga0207668_10026063 Ga0207668_100260633 274
203 3300025986 Ga0207658_10050557 Ga0207658_100505573 274
204 3300026121 Ga0207683_10054218 Ga0207683_100542181 274
205 3300026142 Ga0207698_10165042 Ga0207698_101650423 274
206 3300037312 Ga0395899_0002693 Ga0395899_0002693_7811_8653 274
207 3300037312 Ga0395899_0006087 Ga0395899_0006087_2893_3735 274
208 3300037312 Ga0395899_0074778 Ga0395899_0074778_1486_2328 274
209 3300037312 Ga0395899_0289310 Ga0395899_0289310_257_1099 274
210 3300037418 Ga0395900_0001653 Ga0395900_0001653_14302_15144 274
211 3300037418 Ga0395900_0215898 Ga0395900_0215898_750_1592 274
212 3300037466 Ga0395898_0005070 Ga0395898_0005070_4929_5771 274
213 3300037466 Ga0395898_0110321 Ga0395898_0110321_498_1340 274
214 3300037466 Ga0395898_0178786 Ga0395898_0178786_1110_1952 274
215 3300037466 Ga0395898_0183186 Ga0395898_0183186_479_1321 274
216 3300037466 Ga0395898_0552658 Ga0395898_0552658_100_942 274
217 3300037471 Ga0395905_0239070 Ga0395905_0239070_735_1577 274
218 3300038443 Ga0395901_0013746 Ga0395901_0013746_1214_2056 274
219 3300038443 Ga0395901_0069769 Ga0395901_0069769_2470_3312 274
220 3300042007 Ga0439449_0011088 Ga0439449_0011088_264_1106 274
221 3300042157 Ga0439458_0004961 Ga0439458_0004961_1735_2577 274
222 3300042532 Ga0450893_0034145 Ga0450893_0034145_29_871 274
223 3300044683 Ga0466965_0047204 Ga0466965_0047204_920_1774 274
224 3300044684 Ga0466966_0008269 Ga0466966_0008269_4889_5743 274
225 3300044694 Ga0466963_0030022 Ga0466963_0030022_2637_3479 274
226 3300044706 Ga0466964_0000688 Ga0466964_0000688_7648_8490 274
227 3300044706 Ga0466964_0097458 Ga0466964_0097458_10_852 274
228 3300044842 Ga0466957_0010852 Ga0466957_0010852_3712_4572 274
229 3300045049 Ga0466959_0062816 Ga0466959_0062816_1774_2628 274
230 3300045836 Ga0466958_0056458 Ga0466958_0056458_1525_2367 274
231 3300045976 Ga0466967_0038095 Ga0466967_0038095_1990_2832 274
232 3300046452 Ga0495617_000260 Ga0495617_000260_14260_15117 274
233 3300046453 Ga0495627_000610 Ga0495627_000610_13360_14217 274
234 3300046453 Ga0495627_013749 Ga0495627_013749_1101_1958 274
235 3300046457 Ga0495590_0001174 Ga0495590_0001174_6445_7344 274
236 3300046458 Ga0495591_031123 Ga0495591_031123_463_1320 274
237 3300046460 Ga0495638_0010584 Ga0495638_0010584_243_1091 274
238 3300046471 Ga0495650_0008207 Ga0495650_0008207_2600_3457 274
239 3300046474 Ga0495605_0000035 Ga0495605_0000035_84715_85572 274
240 3300046474 Ga0495605_0113498 Ga0495605_0113498_255_1103 274
241 3300046491 Ga0495584_0000720 Ga0495584_0000720_16103_16945 274
242 3300046491 Ga0495584_0144566 Ga0495584_0144566_313_1155 274
243 3300046492 Ga0495585_0007350 Ga0495585_0007350_1411_2268 274
244 3300046492 Ga0495585_0008113 Ga0495585_0008113_3759_4616 274
245 3300046492 Ga0495585_0073644 Ga0495585_0073644_655_1497 274
246 3300046499 Ga0495594_0003218 Ga0495594_0003218_269_1126 274
247 3300046500 Ga0495596_0000013 Ga0495596_0000013_69844_70686 274
248 3300046500 Ga0495596_0000690 Ga0495596_0000690_17621_18478 274
249 3300046500 Ga0495596_0002683 Ga0495596_0002683_5328_6185 274
250 3300046500 Ga0495596_0015854 Ga0495596_0015854_895_1752 274
251 3300046501 Ga0495607_0024290 Ga0495607_0024290_1495_2352 274
252 3300046501 Ga0495607_0055607 Ga0495607_0055607_34_876 274
253 3300046506 Ga0495583_0000388 Ga0495583_0000388_29130_29987 274
254 3300046506 Ga0495583_0005417 Ga0495583_0005417_1024_1881 274
255 3300046506 Ga0495583_0006367 Ga0495583_0006367_1736_2635 274
256 3300046506 Ga0495583_0025046 Ga0495583_0025046_1220_2077 274
257 3300046506 Ga0495583_0123775 Ga0495583_0123775_164_1021 274
258 3300046507 Ga0495606_0029268 Ga0495606_0029268_1841_2683 274
259 3300046507 Ga0495606_0044154 Ga0495606_0044154_518_1375 274
260 3300046513 Ga0495616_0005879 Ga0495616_0005879_3336_4193 274
261 3300046513 Ga0495616_0010838 Ga0495616_0010838_407_1264 274
262 3300046513 Ga0495616_0013674 Ga0495616_0013674_3056_3958 274
263 3300046513 Ga0495616_0015165 Ga0495616_0015165_3015_3872 274
264 3300046518 Ga0495631_0000474 Ga0495631_0000474_22163_23029 274
265 3300046518 Ga0495631_0001317 Ga0495631_0001317_10304_11161 274
266 3300046518 Ga0495631_0001563 Ga0495631_0001563_5885_6742 274
267 3300046518 Ga0495631_0005278 Ga0495631_0005278_4499_5356 274
268 3300046518 Ga0495631_0044341 Ga0495631_0044341_59_934 274
269 3300046518 Ga0495631_0055375 Ga0495631_0055375_46_888 274
270 3300046519 Ga0495632_0000034 Ga0495632_0000034_7273_8136 274
271 3300046519 Ga0495632_0001458 Ga0495632_0001458_15267_16124 274
272 3300046523 Ga0495644_0011392 Ga0495644_0011392_1072_1929 274
273 3300046523 Ga0495644_0019752 Ga0495644_0019752_1000_1857 274
274 3300046523 Ga0495644_0030773 Ga0495644_0030773_694_1536 274
275 3300046524 Ga0495648_0002868 Ga0495648_0002868_1429_2286 274
276 3300046524 Ga0495648_0060857 Ga0495648_0060857_345_1202 274
277 3300046526 Ga0495666_0042475 Ga0495666_0042475_857_1699 274
278 3300046528 Ga0495642_0000005 Ga0495642_0000005_46862_47719 274
279 3300046528 Ga0495642_0000267 Ga0495642_0000267_8577_9419 274
280 3300046528 Ga0495642_0010874 Ga0495642_0010874_2478_3335 274
281 3300046530 Ga0495654_0004267 Ga0495654_0004267_5411_6310 274
282 3300046530 Ga0495654_0005983 Ga0495654_0005983_1460_2335 274
283 3300046535 Ga0495586_0026601 Ga0495586_0026601_1169_2044 274
284 3300046538 Ga0495609_0000852 Ga0495609_0000852_655_1518 274
285 3300046538 Ga0495609_0041799 Ga0495609_0041799_547_1404 274
286 3300046538 Ga0495609_0061387 Ga0495609_0061387_358_1215 274
287 3300046542 Ga0495597_0000260 Ga0495597_0000260_14213_15070 274
288 3300046542 Ga0495597_0000736 Ga0495597_0000736_14840_15703 274
289 3300046542 Ga0495597_0006318 Ga0495597_0006318_2240_3115 274
290 3300046615 Ga0495656_0003365 Ga0495656_0003365_2884_3741 274
291 3300046616 Ga0495668_0000845 Ga0495668_0000845_17841_18698 274
292 3300046616 Ga0495668_0001020 Ga0495668_0001020_14839_15696 274
293 3300046616 Ga0495668_0001969 Ga0495668_0001969_10811_11686 274
294 3300046616 Ga0495668_0056500 Ga0495668_0056500_1006_1863 274
295 3300046648 Ga0495611_0007359 Ga0495611_0007359_3484_4341 274
296 3300046648 Ga0495611_0040857 Ga0495611_0040857_681_1538 274
297 3300046663 Ga0495635_0014195 Ga0495635_0014195_1181_2056 274
298 3300046665 Ga0495661_0001021 Ga0495661_0001021_11994_12851 274
299 3300046665 Ga0495661_0001062 Ga0495661_0001062_5237_6094 274
300 3300046665 Ga0495661_0013437 Ga0495661_0013437_4260_5117 274
301 3300046665 Ga0495661_0015841 Ga0495661_0015841_1453_2307 274
302 3300046665 Ga0495661_0037472 Ga0495661_0037472_777_1634 274
303 3300046665 Ga0495661_0043068 Ga0495661_0043068_201_1043 274
304 3300046665 Ga0495661_0050510 Ga0495661_0050510_1198_2055 274
305 3300046665 Ga0495661_0095308 Ga0495661_0095308_612_1454 274
306 3300046674 Ga0495588_0000055 Ga0495588_0000055_240035_240877 274
307 3300046680 Ga0495646_0056992 Ga0495646_0056992_347_1189 274
308 3300046684 Ga0495669_0003341 Ga0495669_0003341_15_857 274
309 3300046684 Ga0495669_0013211 Ga0495669_0013211_914_1771 274
310 3300046684 Ga0495669_0016595 Ga0495669_0016595_1441_2298 274
311 3300046684 Ga0495669_0018580 Ga0495669_0018580_458_1315 274
312 3300046691 Ga0495670_0011098 Ga0495670_0011098_785_1639 274
313 3300046691 Ga0495670_0031716 Ga0495670_0031716_1356_2213 274
314 3300046691 Ga0495670_0050293 Ga0495670_0050293_11_853 274
315 3300046692 Ga0495671_0002118 Ga0495671_0002118_1495_2352 274
316 3300046692 Ga0495671_0004037 Ga0495671_0004037_2297_3199 274
317 3300046692 Ga0495671_0028090 Ga0495671_0028090_879_1736 274
318 3300046692 Ga0495671_0028128 Ga0495671_0028128_1165_2022 274
319 3300046694 Ga0495649_0122157 Ga0495649_0122157_467_1315 274
320 3300046794 Ga0495589_0000642 Ga0495589_0000642_6975_7832 274
321 3300046794 Ga0495589_0043342 Ga0495589_0043342_526_1374 274
322 3300046810 Ga0495660_0023034 Ga0495660_0023034_2181_3038 274
323 3300047317 Ga0495604_0103364 Ga0495604_0103364_1179_2054 274
324 3300047320 Ga0495672_0000074 Ga0495672_0000074_160505_161368 274
325 3300047320 Ga0495672_0003849 Ga0495672_0003849_8265_9140 274
326 3300047322 Ga0495680_0020921 Ga0495680_0020921_313_1188 274
327 3300047323 Ga0495683_0011299 Ga0495683_0011299_297_1154 274
328 3300047443 Ga0495687_000002 Ga0495687_000002_682916_683773 274
329 3300047443 Ga0495687_000189 Ga0495687_000189_13938_14780 274
330 3300047443 Ga0495687_001755 Ga0495687_001755_7308_8165 274
331 3300047443 Ga0495687_058081 Ga0495687_058081_303_1157 274
332 3300047444 Ga0495675_0008197 Ga0495675_0008197_4094_4969 274
333 3300047444 Ga0495675_0018091 Ga0495675_0018091_473_1315 274
334 3300047445 Ga0495677_0002242 Ga0495677_0002242_4102_4959 274
335 3300047446 Ga0495679_002004 Ga0495679_002004_4124_4990 274
336 3300047447 Ga0495685_000729 Ga0495685_000729_4233_5135 274
337 3300047470 Ga0495681_0000021 Ga0495681_0000021_16451_17317 274
338 3300047470 Ga0495681_0000105 Ga0495681_0000105_51222_52079 274
339 3300047472 Ga0495686_0082414 Ga0495686_0082414_1086_1952 274
340 3300047673 Ga0495593_0064923 Ga0495593_0064923_534_1409 274
341 3300048089 Ga0495614_0021995 Ga0495614_0021995_699_1574 274
342 3300048091 Ga0495626_0000004 Ga0495626_0000004_72706_73560 274
343 3300048091 Ga0495626_0003040 Ga0495626_0003040_4738_5595 274
344 3300048091 Ga0495626_0061497 Ga0495626_0061497_692_1558 274
345 3300048091 Ga0495626_0134444 Ga0495626_0134444_93_968 274
346 3300048903 Ga0496100_0042021 Ga0496100_0042021_1570_2505 274
347 3300048905 Ga0496102_0000952 Ga0496102_0000952_11371_12228 274
348 3300048905 Ga0496102_0550471 Ga0496102_0550471_87_944 274
349 3300048906 Ga0496103_0135844 Ga0496103_0135844_642_1499 274
350 3300048906 Ga0496103_0312242 Ga0496103_0312242_151_993 274
351 3300048907 Ga0496104_0053613 Ga0496104_0053613_1180_2022 274
352 3300048908 Ga0496105_0054776 Ga0496105_0054776_821_1678 274
353 3300048908 Ga0496105_0265306 Ga0496105_0265306_188_1030 274
354 3300048910 Ga0496107_0458664 Ga0496107_0458664_62_904 274
355 3300048913 Ga0496110_0000016 Ga0496110_0000016_54864_55745 274
356 3300048916 Ga0496113_0040116 Ga0496113_0040116_2596_3438 274
357 3300048917 Ga0496114_0241077 Ga0496114_0241077_583_1425 274
358 3300048924 Ga0496121_0093054 Ga0496121_0093054_681_1523 274
359 3300048925 Ga0496122_0000263 Ga0496122_0000263_92219_93076 274
360 3300048926 Ga0496123_0000156 Ga0496123_0000156_50077_50934 274
361 3300048927 Ga0496124_0008002 Ga0496124_0008002_6436_7278 274
362 3300048927 Ga0496124_0029447 Ga0496124_0029447_1434_2291 274
363 3300048928 Ga0496125_0000669 Ga0496125_0000669_31416_32273 274
364 3300049459 Ga0495678_000249 Ga0495678_000249_57734_58591 274
365 3300049459 Ga0495678_001742 Ga0495678_001742_14372_15229 274
366 3300049460 Ga0495682_0001054 Ga0495682_0001054_3690_4547 274
367 3300049581 Ga0501047_0036967 Ga0501047_0036967_1425_2267 274
368 3300050491 nmdc:mga00v17_43434_c1 nmdc:mga00v17_43434_c1_658_1503 274
369 3300053125 Ga0500618_027274 Ga0500618_027274_317_1267 274
370 iso_pu_bacteria 2508501125 2509130236 274
371 iso_pu_bacteria 2510065045 2510252199 274
372 iso_pu_bacteria 2512047030 2512344878 274
373 iso_pu_bacteria 2513237151 2513963121 274
374 iso_pu_bacteria 2515154122 2515682652 274
375 iso_pu_bacteria 2526164713 2527077815 274
376 iso_pu_bacteria 2718217991 2719641294 274
377 iso_pu_bacteria 2744054900 2746088486 274
378 iso_pu_bacteria 2744054901 2746092525 274
379 iso_pu_bacteria 2818991450 2819621978 274
380 iso_pu_bacteria 2842324504 2842324745 274
381 iso_pu_bacteria 2842348783 2842349023 274
382 iso_pu_bacteria 2842454564 2842457196 274
383 iso_pu_bacteria 2885270888 2885274007 274
384 iso_pu_bacteria 2900634093 2900637485 274
385 iso_pu_bacteria 2900634093 2900643512 274
386 iso_pu_bacteria 2902682994 2902691060 274
387 iso_pu_bacteria 2904483920 2904487726 274
388 iso_pu_bacteria 2919527303 2919529031 274
389 iso_pu_bacteria 2928108538 2928111198 274
390 iso_pu_bacteria 2928135762 2928137265 274
391 iso_pu_bacteria 2928503688 2928506027 274
392 iso_pu_bacteria 642555113 642622825 274
393 iso_pu_bacteria 8055266321 8055267300 274
394 iso_pu_bacteria 8055301274 8055301398 274
395 3300002067 JGI24735J21928_10028235 JGI24735J21928_100282352 275
396 3300002705 JGI25156J39149_1001094 JGI25156J39149_10010946 275
397 3300003316 rootH1_10003596 rootH1_100035964 275
398 3300003322 rootL2_10018938 rootL2_100189382 275
399 3300003756 Ga0055533_1000381 Ga0055533_10003818 275
400 3300003775 Ga0055524_1000003 Ga0055524_1000003199 275
401 3300005327 Ga0070658_10003119 Ga0070658_100031196 275
402 3300005339 Ga0070660_100047662 Ga0070660_1000476623 275
403 3300005366 Ga0070659_100003989 Ga0070659_1000039893 275
404 3300005366 Ga0070659_100133148 Ga0070659_1001331482 275
405 3300005563 Ga0068855_100002603 Ga0068855_10000260311 275
406 3300005616 Ga0068852_100711535 Ga0068852_1007115351 275
407 3300006175 Ga0070712_100015033 Ga0070712_1000150332 275
408 3300006195 Ga0075366_10030683 Ga0075366_100306833 275
409 3300006948 Ga0099826_10000002 Ga0099826_10000002641 275
410 3300009011 Ga0105251_10036799 Ga0105251_100367992 275
411 3300009093 Ga0105240_10061556 Ga0105240_100615562 275
412 3300009093 Ga0105240_10186024 Ga0105240_101860242 275
413 3300009545 Ga0105237_10159421 Ga0105237_101594212 275
414 3300013104 Ga0157370_10001954 Ga0157370_100019545 275
415 3300013306 Ga0163162_10341198 Ga0163162_103411981 275
416 3300025226 Ga0209674_100013 Ga0209674_100013547 275
417 3300025230 Ga0209563_106070 Ga0209563_1060702 275
418 3300025250 Ga0209026_1004840 Ga0209026_10048402 275
419 3300025256 Ga0209759_1000132 Ga0209759_100013263 275
420 3300025291 Ga0209675_1017292 Ga0209675_10172922 275
421 3300025299 Ga0209256_1000007 Ga0209256_1000007167 275
422 3300025904 Ga0207647_10009486 Ga0207647_100094862 275
423 3300025909 Ga0207705_10002916 Ga0207705_100029165 275
424 3300025915 Ga0207693_10022515 Ga0207693_100225155 275
425 3300025919 Ga0207657_10060043 Ga0207657_100600433 275
426 3300025920 Ga0207649_10015872 Ga0207649_100158723 275
427 3300025932 Ga0207690_10010502 Ga0207690_100105026 275
428 3300025932 Ga0207690_10095998 Ga0207690_100959982 275
429 3300025945 Ga0207679_10003425 Ga0207679_100034255 275
430 3300025949 Ga0207667_10000751 Ga0207667_1000075133 275
431 3300027666 Ga0209282_1000001 Ga0209282_1000001513 275
432 3300038443 Ga0395901_0000002 Ga0395901_0000002_351389_352231 275
433 3300046454 Ga0495592_0009476 Ga0495592_0009476_3973_4824 275
434 3300046457 Ga0495590_0022965 Ga0495590_0022965_133_984 275
435 3300046462 Ga0495651_0120632 Ga0495651_0120632_931_1782 275
436 3300046463 Ga0495653_0276602 Ga0495653_0276602_187_1065 275
437 3300046471 Ga0495650_0000051 Ga0495650_0000051_268980_269840 275
438 3300046471 Ga0495650_0016809 Ga0495650_0016809_395_1246 275
439 3300046473 Ga0495582_0008117 Ga0495582_0008117_3074_3925 275
440 3300046507 Ga0495606_0026434 Ga0495606_0026434_162_1013 275
441 3300046511 Ga0495608_0004593 Ga0495608_0004593_5475_6326 275
442 3300046513 Ga0495616_0000148 Ga0495616_0000148_13647_14516 275
443 3300046514 Ga0495618_0000783 Ga0495618_0000783_2332_3183 275
444 3300046515 Ga0495620_0069794 Ga0495620_0069794_230_1081 275
445 3300046516 Ga0495628_0012519 Ga0495628_0012519_1237_2091 275
446 3300046516 Ga0495628_0398597 Ga0495628_0398597_57_908 275
447 3300046518 Ga0495631_0015778 Ga0495631_0015778_2072_2941 275
448 3300046519 Ga0495632_0000972 Ga0495632_0000972_10209_11078 275
449 3300046522 Ga0495643_0027451 Ga0495643_0027451_768_1619 275
450 3300046526 Ga0495666_0005557 Ga0495666_0005557_10_861 275
451 3300046528 Ga0495642_0000674 Ga0495642_0000674_11755_12624 275
452 3300046529 Ga0495652_0069592 Ga0495652_0069592_110_961 275
453 3300046530 Ga0495654_0023968 Ga0495654_0023968_513_1382 275
454 3300046533 Ga0495640_0024515 Ga0495640_0024515_1632_2483 275
455 3300046542 Ga0495597_0087232 Ga0495597_0087232_365_1216 275
456 3300046559 Ga0495667_0030677 Ga0495667_0030677_144_995 275
457 3300046663 Ga0495635_0014602 Ga0495635_0014602_4012_4863 275
458 3300046674 Ga0495588_0007023 Ga0495588_0007023_204_1073 275
459 3300046684 Ga0495669_0006203 Ga0495669_0006203_3542_4411 275
460 3300046691 Ga0495670_0028091 Ga0495670_0028091_1221_2090 275
461 3300046794 Ga0495589_0091833 Ga0495589_0091833_305_1159 275
462 3300047319 Ga0495674_0076415 Ga0495674_0076415_1166_2011 275
463 3300047320 Ga0495672_0002998 Ga0495672_0002998_13770_14699 275
464 3300047323 Ga0495683_0007615 Ga0495683_0007615_4162_5013 275
465 3300047323 Ga0495683_0042411 Ga0495683_0042411_726_1586 275
466 3300048091 Ga0495626_0119180 Ga0495626_0119180_164_1015 275
467 3300048917 Ga0496114_0018795 Ga0496114_0018795_2690_3541 275
468 3300048920 Ga0496117_0003285 Ga0496117_0003285_3488_4342 275
469 3300048929 Ga0496126_0000061 Ga0496126_0000061_174378_175232 275
470 3300049574 Ga0501038_0036944 Ga0501038_0036944_326_1198 275
471 3300049822 Ga0501035_0015653 Ga0501035_0015653_4672_5544 275
472 3300049823 Ga0501044_0004315 Ga0501044_0004315_6717_7589 275
473 3300050493 nmdc:mga0k408_24983_c1 nmdc:mga0k408_24983_c1_2505_3347 275
474 3300050493 nmdc:mga0k408_96857_c1 nmdc:mga0k408_96857_c1_603_1445 275
475 iso_pu_bacteria 2808606418 2809146691 275
476 3300005262 Ga0065165_1000340 Ga0065165_100034070 276
477 3300009093 Ga0105240_10257525 Ga0105240_102575252 276
478 3300009177 Ga0105248_10017065 Ga0105248_100170653 276
479 3300013105 Ga0157369_10016425 Ga0157369_100164256 276
480 3300016635 Ga0183361_10001 Ga0183361_1000124 276
481 3300017792 Ga0163161_10152355 Ga0163161_101523553 276
482 3300025284 Ga0209130_1006258 Ga0209130_10062583 276
483 3300025302 Ga0207426_1000007 Ga0207426_100000795 276
484 3300025913 Ga0207695_10199206 Ga0207695_101992062 276
485 3300025941 Ga0207711_10038979 Ga0207711_100389793 276
486 3300037471 Ga0395905_0000059 Ga0395905_0000059_11528_12373 276
487 3300044656 Ga0466969_0026683 Ga0466969_0026683_1401_2246 276
488 3300044693 Ga0466961_0043123 Ga0466961_0043123_1451_2296 276
489 3300044765 Ga0466970_0211715 Ga0466970_0211715_210_1055 276
490 3300046455 Ga0495603_0000668 Ga0495603_0000668_18304_19155 276
491 3300046457 Ga0495590_0003130 Ga0495590_0003130_2459_3304 276
492 3300046459 Ga0495629_0154420 Ga0495629_0154420_67_918 276
493 3300046463 Ga0495653_0080399 Ga0495653_0080399_112_963 276
494 3300046471 Ga0495650_0066530 Ga0495650_0066530_410_1258 276
495 3300046472 Ga0495580_0000028 Ga0495580_0000028_71379_72230 276
496 3300046473 Ga0495582_0034169 Ga0495582_0034169_246_1097 276
497 3300046474 Ga0495605_0013814 Ga0495605_0013814_900_1745 276
498 3300046476 Ga0495662_0147265 Ga0495662_0147265_136_987 276
499 3300046477 Ga0495664_0016766 Ga0495664_0016766_2964_3815 276
500 3300046506 Ga0495583_0060984 Ga0495583_0060984_425_1270 276
501 3300046514 Ga0495618_0128847 Ga0495618_0128847_194_1045 276
502 3300046516 Ga0495628_0002218 Ga0495628_0002218_2864_3715 276
503 3300046517 Ga0495630_0143641 Ga0495630_0143641_634_1485 276
504 3300046524 Ga0495648_0080577 Ga0495648_0080577_262_1113 276
505 3300046526 Ga0495666_0027811 Ga0495666_0027811_1399_2250 276
506 3300046531 Ga0495665_0089268 Ga0495665_0089268_522_1373 276
507 3300046533 Ga0495640_0128259 Ga0495640_0128259_493_1344 276
508 3300046535 Ga0495586_0126500 Ga0495586_0126500_332_1183 276
509 3300046536 Ga0495587_0113172 Ga0495587_0113172_318_1169 276
510 3300046543 Ga0495645_0025344 Ga0495645_0025344_619_1470 276
511 3300046642 Ga0495634_0019131 Ga0495634_0019131_3978_4829 276
512 3300046648 Ga0495611_0044735 Ga0495611_0044735_382_1233 276
513 3300046665 Ga0495661_0091596 Ga0495661_0091596_321_1172 276
514 3300046678 Ga0495599_0223061 Ga0495599_0223061_112_963 276
515 3300046680 Ga0495646_0096627 Ga0495646_0096627_577_1428 276
516 3300046689 Ga0495613_0041998 Ga0495613_0041998_57_908 276
517 3300046690 Ga0495624_0015611 Ga0495624_0015611_247_1098 276
518 3300046694 Ga0495649_0054568 Ga0495649_0054568_987_1832 276
519 3300047315 Ga0495581_0004999 Ga0495581_0004999_4017_4868 276
520 3300047317 Ga0495604_0077861 Ga0495604_0077861_194_1045 276
521 3300047319 Ga0495674_0009837 Ga0495674_0009837_557_1402 276
522 3300047319 Ga0495674_0027537 Ga0495674_0027537_4080_4931 276
523 3300047321 Ga0495676_0106738 Ga0495676_0106738_116_967 276
524 3300047321 Ga0495676_0315886 Ga0495676_0315886_67_918 276
525 3300047322 Ga0495680_0273369 Ga0495680_0273369_299_1150 276
526 3300047443 Ga0495687_045032 Ga0495687_045032_927_1772 276
527 3300047446 Ga0495679_002410 Ga0495679_002410_4117_4968 276
528 3300047469 Ga0495673_0111173 Ga0495673_0111173_161_1006 276
529 3300048088 Ga0495602_0202676 Ga0495602_0202676_247_1098 276
530 3300048903 Ga0496100_0156382 Ga0496100_0156382_50_895 276
531 3300048903 Ga0496100_0314691 Ga0496100_0314691_106_951 276
532 3300048904 Ga0496101_0053366 Ga0496101_0053366_1860_2705 276
533 3300048906 Ga0496103_0205543 Ga0496103_0205543_203_1048 276
534 3300048907 Ga0496104_0529470 Ga0496104_0529470_233_1078 276
535 3300048908 Ga0496105_0037896 Ga0496105_0037896_2981_3826 276
536 3300048908 Ga0496105_0247700 Ga0496105_0247700_421_1266 276
537 3300048909 Ga0496106_0407164 Ga0496106_0407164_12_857 276
538 3300048916 Ga0496113_0360159 Ga0496113_0360159_125_970 276
539 3300048920 Ga0496117_0032372 Ga0496117_0032372_2394_3239 276
540 3300048921 Ga0496118_0045433 Ga0496118_0045433_824_1669 276
541 3300048921 Ga0496118_0058090 Ga0496118_0058090_1873_2718 276
542 3300048921 Ga0496118_0116338 Ga0496118_0116338_730_1575 276
543 3300048924 Ga0496121_0025223 Ga0496121_0025223_4725_5570 276
544 3300048924 Ga0496121_0102682 Ga0496121_0102682_449_1294 276
545 3300048924 Ga0496121_0251443 Ga0496121_0251443_349_1194 276
546 3300048924 Ga0496121_0341106 Ga0496121_0341106_33_914 276
547 3300048926 Ga0496123_0177476 Ga0496123_0177476_19_864 276
548 3300048928 Ga0496125_0253950 Ga0496125_0253950_161_1006 276
549 3300048929 Ga0496126_0001219 Ga0496126_0001219_6624_7469 276
550 3300049459 Ga0495678_044324 Ga0495678_044324_168_1013 276
551 3300025904 Ga0207647_10007767 Ga0207647_100077677 277
552 3300046472 Ga0495580_0016658 Ga0495580_0016658_672_1529 277
553 3300048929 Ga0496126_0073998 Ga0496126_0073998_501_1373 277
554 3300048929 Ga0496126_0098494 Ga0496126_0098494_1117_1989 277
555 3300001989 JGI24739J22299_10010108 JGI24739J22299_100101083 278
556 3300002067 JGI24735J21928_10001177 JGI24735J21928_100011772 278
557 3300002705 JGI25156J39149_1000404 JGI25156J39149_10004044 278
558 3300002705 JGI25156J39149_1001662 JGI25156J39149_10016623 278
559 3300003214 JGI25165J46597_1002600 JGI25165J46597_10026004 278
560 3300003756 Ga0055533_1001333 Ga0055533_10013332 278
561 3300003758 Ga0055532_1000012 Ga0055532_1000012100 278
562 3300003760 Ga0055527_1000011 Ga0055527_1000011241 278
563 3300003761 Ga0055535_1000009 Ga0055535_1000009100 278
564 3300003762 Ga0055542_1000015 Ga0055542_1000015100 278
565 3300003763 Ga0055529_1000011 Ga0055529_1000011100 278
566 3300009011 Ga0105251_10000047 Ga0105251_1000004741 278
567 3300015262 Ga0182007_10000513 Ga0182007_1000051321 278
568 3300025226 Ga0209674_100276 Ga0209674_10027628 278
569 3300025228 Ga0209672_100010 Ga0209672_100010599 278
570 3300025229 Ga0209147_100006 Ga0209147_100006599 278
571 3300025231 Ga0207427_102617 Ga0207427_1026173 278
572 3300025242 Ga0209258_100010 Ga0209258_100010599 278
573 3300025254 Ga0209148_1000018 Ga0209148_1000018599 278
574 3300025256 Ga0209759_1000276 Ga0209759_100027642 278
575 3300025256 Ga0209759_1000971 Ga0209759_100097113 278
576 3300025261 Ga0209233_1000093 Ga0209233_1000093170 278
577 3300025272 Ga0209455_1000015 Ga0209455_1000015599 278
578 3300025735 Ga0207713_1000041 Ga0207713_1000041152 278
579 3300025904 Ga0207647_10007105 Ga0207647_100071056 278
580 3300031548 Ga0307408_100002340 Ga0307408_1000023402 278
581 3300031731 Ga0307405_10002999 Ga0307405_100029995 278
582 3300032002 Ga0307416_100003374 Ga0307416_1000033746 278
583 3300046454 Ga0495592_0177846 Ga0495592_0177846_269_1120 278
584 3300046457 Ga0495590_0017684 Ga0495590_0017684_687_1538 278
585 3300046459 Ga0495629_0001049 Ga0495629_0001049_20285_21136 278
586 3300046462 Ga0495651_0115456 Ga0495651_0115456_550_1401 278
587 3300046471 Ga0495650_0037064 Ga0495650_0037064_235_1086 278
588 3300046472 Ga0495580_0008072 Ga0495580_0008072_3199_4050 278
589 3300046472 Ga0495580_0166519 Ga0495580_0166519_547_1398 278
590 3300046472 Ga0495580_0294152 Ga0495580_0294152_26_877 278
591 3300046474 Ga0495605_0012279 Ga0495605_0012279_110_961 278
592 3300046500 Ga0495596_0004946 Ga0495596_0004946_1372_2223 278
593 3300046506 Ga0495583_0004126 Ga0495583_0004126_7202_8053 278
594 3300046507 Ga0495606_0016631 Ga0495606_0016631_4374_5225 278
595 3300046507 Ga0495606_0252576 Ga0495606_0252576_90_941 278
596 3300046514 Ga0495618_0168025 Ga0495618_0168025_429_1280 278
597 3300046515 Ga0495620_0062997 Ga0495620_0062997_301_1152 278
598 3300046516 Ga0495628_0030813 Ga0495628_0030813_658_1509 278
599 3300046517 Ga0495630_0108629 Ga0495630_0108629_286_1137 278
600 3300046524 Ga0495648_0102191 Ga0495648_0102191_160_1011 278
601 3300046524 Ga0495648_0162592 Ga0495648_0162592_104_955 278
602 3300046526 Ga0495666_0027001 Ga0495666_0027001_79_930 278
603 3300046526 Ga0495666_0112784 Ga0495666_0112784_50_901 278
604 3300046531 Ga0495665_0012149 Ga0495665_0012149_523_1374 278
605 3300046531 Ga0495665_0162270 Ga0495665_0162270_69_920 278
606 3300046533 Ga0495640_0069911 Ga0495640_0069911_1404_2255 278
607 3300046536 Ga0495587_0128295 Ga0495587_0128295_106_957 278
608 3300046557 Ga0495622_0000900 Ga0495622_0000900_8477_9331 278
609 3300046559 Ga0495667_0220532 Ga0495667_0220532_194_1045 278
610 3300046648 Ga0495611_0100557 Ga0495611_0100557_280_1131 278
611 3300046660 Ga0495625_0156463 Ga0495625_0156463_125_976 278
612 3300046675 Ga0495657_0148191 Ga0495657_0148191_325_1176 278
613 3300046678 Ga0495599_0007864 Ga0495599_0007864_4477_5328 278
614 3300046678 Ga0495599_0150340 Ga0495599_0150340_186_1037 278
615 3300046679 Ga0495623_0015721 Ga0495623_0015721_3906_4757 278
616 3300046679 Ga0495623_0112604 Ga0495623_0112604_330_1181 278
617 3300046680 Ga0495646_0014995 Ga0495646_0014995_340_1191 278
618 3300046680 Ga0495646_0037982 Ga0495646_0037982_194_1045 278
619 3300046684 Ga0495669_0150374 Ga0495669_0150374_139_990 278
620 3300046689 Ga0495613_0153921 Ga0495613_0153921_623_1474 278
621 3300046689 Ga0495613_0293114 Ga0495613_0293114_64_915 278
622 3300046690 Ga0495624_0024827 Ga0495624_0024827_1856_2707 278
623 3300046690 Ga0495624_0078357 Ga0495624_0078357_230_1081 278
624 3300046794 Ga0495589_0064144 Ga0495589_0064144_590_1441 278
625 3300047317 Ga0495604_0025046 Ga0495604_0025046_1449_2300 278
626 3300047317 Ga0495604_0029016 Ga0495604_0029016_585_1436 278
627 3300047319 Ga0495674_0152353 Ga0495674_0152353_71_922 278
628 3300047319 Ga0495674_0246101 Ga0495674_0246101_287_1138 278
629 3300047322 Ga0495680_0052052 Ga0495680_0052052_2045_2896 278
630 3300047323 Ga0495683_0020963 Ga0495683_0020963_754_1605 278
631 3300047323 Ga0495683_0021710 Ga0495683_0021710_1549_2400 278
632 3300047444 Ga0495675_0061982 Ga0495675_0061982_1077_1928 278
633 3300047444 Ga0495675_0096113 Ga0495675_0096113_321_1172 278
634 3300047446 Ga0495679_000044 Ga0495679_000044_89285_90136 278
635 3300047446 Ga0495679_051499 Ga0495679_051499_342_1193 278
636 3300047470 Ga0495681_0095069 Ga0495681_0095069_230_1081 278
637 3300047471 Ga0495684_0024229 Ga0495684_0024229_3578_4429 278
638 3300047471 Ga0495684_0151220 Ga0495684_0151220_492_1343 278
639 3300047472 Ga0495686_0057599 Ga0495686_0057599_577_1428 278
640 3300047472 Ga0495686_0106894 Ga0495686_0106894_554_1405 278
641 3300048088 Ga0495602_0016007 Ga0495602_0016007_6258_7109 278
642 3300048088 Ga0495602_0199980 Ga0495602_0199980_81_932 278
643 3300048905 Ga0496102_0176351 Ga0496102_0176351_1137_1988 278
644 3300048906 Ga0496103_0023185 Ga0496103_0023185_2662_3513 278
645 3300048906 Ga0496103_0063218 Ga0496103_0063218_340_1296 278
646 3300048919 Ga0496116_0023372 Ga0496116_0023372_3354_4205 278
647 3300048920 Ga0496117_0007812 Ga0496117_0007812_3788_4639 278
648 3300048920 Ga0496117_0071154 Ga0496117_0071154_1213_2169 278
649 3300048921 Ga0496118_0007323 Ga0496118_0007323_3858_4709 278
650 3300048921 Ga0496118_0019911 Ga0496118_0019911_2828_3679 278
651 3300048921 Ga0496118_0034960 Ga0496118_0034960_1271_2122 278
652 3300048924 Ga0496121_0012745 Ga0496121_0012745_2930_3781 278
653 3300048924 Ga0496121_0029343 Ga0496121_0029343_3663_4514 278
654 3300048929 Ga0496126_0006224 Ga0496126_0006224_5101_5952 278
655 3300048929 Ga0496126_0015424 Ga0496126_0015424_5191_6042 278
656 3300049459 Ga0495678_051888 Ga0495678_051888_287_1138 278
657 3300049460 Ga0495682_0035474 Ga0495682_0035474_775_1626 278
658 iso_pu_bacteria 2738541296 2738821810 279
659 iso_pu_bacteria 2738541298 2738834292 279
660 iso_pu_bacteria 2738541306 2738875496 279
661 iso_pu_bacteria 2738543002 2739187449 279
662 iso_pu_bacteria 2738543008 2739222094 279
663 iso_pu_bacteria 2945934425 2945937999 279
664 iso_pu_bacteria 2990703756 2990705285 279
665 iso_pu_bacteria 641736151 642424304 279
666 3300001979 JGI24740J21852_10013522 JGI24740J21852_100135222 283
667 3300001989 JGI24739J22299_10009746 JGI24739J22299_100097462 283
668 3300001990 JGI24737J22298_10046768 JGI24737J22298_100467682 283
669 3300005339 Ga0070660_100063105 Ga0070660_1000631052 283
670 3300005455 Ga0070663_100043236 Ga0070663_1000432361 283
671 3300009093 Ga0105240_10625804 Ga0105240_106258042 283
672 3300009551 Ga0105238_10121334 Ga0105238_101213342 283
673 3300013105 Ga0157369_10322990 Ga0157369_103229902 283
674 3300014497 Ga0182008_10029155 Ga0182008_100291552 283
675 3300025913 Ga0207695_10250281 Ga0207695_102502812 283
676 3300026067 Ga0207678_10049167 Ga0207678_100491674 283
677 3300031911 Ga0307412_10000016 Ga0307412_10000016258 283
678 3300046474 Ga0495605_0004281 Ga0495605_0004281_3413_4279 283
679 3300046512 Ga0495610_0040787 Ga0495610_0040787_924_1790 283
680 3300047323 Ga0495683_0075908 Ga0495683_0075908_76_942 283
681 3300047443 Ga0495687_017388 Ga0495687_017388_1393_2259 283
682 3300048091 Ga0495626_0007699 Ga0495626_0007699_1567_2433 283
683 3300048920 Ga0496117_0162111 Ga0496117_0162111_352_1218 283
684 3300048921 Ga0496118_0020437 Ga0496118_0020437_1357_2223 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

18

269

0.97

PF00326

Peptidase_S9

Prolyl oligopeptidase family

107

276

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yvt-assembly3.cif.gz_C s-formylglutathione hydrolase from variovorax sp. pamc 28711 0.9554 1 278
3fcx-assembly2.cif.gz_B crystal structure of human esterase d 0.9471 3 278
3s8y-assembly1.cif.gz_A bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica 0.947 1 278
6jzl-assembly1.cif.gz_A s-formylglutathione hydrolase homolog from a psychrophilic bacterium of shewanella frigidimarina 0.9452 3 278
3s8y-assembly1.cif.gz_A bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica 0.9403 1 278
ID Description Score Start End Superfamily
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9471 3 278 3.40.50.1820
af_A0A0G2JYG2_4_177_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.945 4 182 3.40.50.1820
3fcxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.937 3 278 3.40.50.1820
af_Q54RL8_4_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9301 3 280 3.40.50.1820
af_A0A0G2JYG2_4_177_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9293 4 182 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7C9BQ52-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9767 85 280 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A2P6ATA0-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.974 1 211 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A4Q3PQS9-F1-model_v4 deleted 0.9737 121 278
AF-A0A060CHH4-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9722 154 263 GO:0005829
GO:0018738
GO:0046294
GO:0052689
AF-A0A7S3ZHY8-F1-model_v4 S-formylglutathione hydrolase (EC 3.1.2.12) 0.9718 85 216 GO:0005829
GO:0018738
GO:0046294
GO:0052689

Feature Viewer

pLDDT pTM Quality
93.73 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map