F475102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 685 | 320 | 1370 | 890 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10070145|Ga0065704_10070145142 |
| Length | 1054 |
| Sequence | MTNRQTKEEIRLANPEFRRWGPYLGERQWATVREDYSHDGDAWSDFPFDHSQSRAYRWGEDGLAGVSDDKQLINFSMGLWNSKDDILKEKAFGVTNSQGNHGEDVKELYYYLDNTPSHSYMKYLYKYPQGKFPYKELIEENDRRSRLEQEFEITDTDLFKENKYFDVVFEMAKGDNDSEELLFRITAYNRSGEVAPLHILPHVVLRNTWAWGNENGAKKPKLKAVNDHTIEIDHEKFGKRNLIFAPAPGCSDDSPDVEPQLLFTENETNTQKLYNQPNKYKYVKDAFHNYIIDEEDEKVNPDQVGTKACAWFAFDENGGVQPGDYVTIRYKLSRKLEDIDEYEHDQIFSRRQDEADAFYWRVSPLPISDNLRQVQRQAFAGLLWTKQFYHFVHNNWSKGDPNTPQPPMNRANGRNKDWKHLYIDDVLSLPDKWEYPFFAAWDTAFHCIPLAMIDPEFAKNQIDLLLREWYQHPNGQIPAYEWNFSDVNPPVHAWSAYRIFKIEKKMYGREDIDFLERVFHKLLLNFSWWVNRKDQDGNNVFEGGFLGLDNIGVFNRSEDLPTGGNLEQADSTGWMAFFSLQMLNIALELAKTRPVYQDIASKFFEHFIIIAEAMSYRGADKDDVETTEESLWDEKDGFYYDAIRYGQGNTQSLPVRSLVGLIPLYASLTLEPEILDKFPAFKQRLEWFIEKRSGMAGRNIASMETRGVGERLLLALVNKDRLIAILDKMLNEDEFLSPYGIRSLSKFHKDNPFKMDVNGEKFVVEYLPGESDSGMFGGNSNWRGPIWFPVNFLLVEALQRFYLYYGPDLKVECPKGSGDFLNLAQCAQEIQHRLMHLFIPDEDGNRACNGDDELTNKDPLFKDYVPFYEYFDADTGRGLGASHQCGWTAVVAKWIHDNGVSCRLPKTPXXXRARGSSIFLHNSETPTDENDDVRQYFPKSGPFPGRLSRRKSGKSLLNLTVNSLDMDEEETENHSKLSAARKCTDMYDDTNVTHDMLQEDLQDLTPTLSRGSFDSNPAVDDDLLDQIKDAFKKYKLKGDEEDEVSGDEFETRKN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 116 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 203 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 204 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 215 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 289 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 290 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 300 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 304 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 305 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 308 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 309 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 310 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 311 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 312 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 313 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 314 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 315 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 316 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 317 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 318 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 319 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 320 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.96 |
| Metatranscriptomes | 0.15 |
| Isolates | 1.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.09 |
| Nodule | 0.15 |
| Rhizoplane | 2.63 |
| Rhizosphere | 86.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10070145 | 3300005289 | Eukaryota | 329528 |
| 2 | SwRhRL2b_contig_1480143 | 2162886007 | Eukaryota | 14209 |
| 3 | JGI24739J22299_10005528 | 3300001989 | Bacteria | 4793 |
| 4 | JGI24737J22298_10001133 | 3300001990 | Bacteria | 9381 |
| 5 | JGI24737J22298_10004156 | 3300001990 | Bacteria | 5059 |
| 6 | JGI24735J21928_10000002 | 3300002067 | Bacteria | 624895 |
| 7 | JGI25162J39368_1000024 | 3300002737 | Bacteria | 229507 |
| 8 | rootH2_10001891 | 3300003320 | Bacteria | 464318 |
| 9 | Ga0055536_1000004 | 3300003781 | Bacteria | 411108 |
| 10 | Ga0055530_10001262 | 3300003791 | Bacteria | 19164 |
| 11 | Ga0065165_1000037 | 3300005262 | Bacteria | 212166 |
| 12 | Ga0065703_1003925 | 3300005272 | Eukaryota | 3769 |
| 13 | Ga0065714_10004171 | 3300005288 | Bacteria | 5987 |
| 14 | Ga0065707_10082117 | 3300005295 | Eukaryota | 21431 |
| 15 | Ga0070658_10005434 | 3300005327 | Bacteria | 10338 |
| 16 | Ga0070676_10000160 | 3300005328 | Bacteria | 27029 |
| 17 | Ga0070676_10018176 | 3300005328 | Bacteria | 3893 |
| 18 | Ga0070683_100005599 | 3300005329 | Bacteria | 10492 |
| 19 | Ga0070683_100020924 | 3300005329 | Bacteria | 5833 |
| 20 | Ga0070690_100000702 | 3300005330 | Bacteria | 17165 |
| 21 | Ga0070690_100007338 | 3300005330 | Bacteria | 6308 |
| 22 | Ga0070690_100011943 | 3300005330 | Bacteria | 5097 |
| 23 | Ga0070690_100016864 | 3300005330 | Bacteria | 4385 |
| 24 | Ga0070670_100009602 | 3300005331 | Bacteria | 8257 |
| 25 | Ga0070670_100010551 | 3300005331 | Bacteria | 7888 |
| 26 | Ga0070670_100014933 | 3300005331 | Bacteria | 6664 |
| 27 | Ga0070670_100026904 | 3300005331 | Bacteria | 4948 |
| 28 | Ga0068869_100003675 | 3300005334 | Bacteria | 9429 |
| 29 | Ga0070666_10000854 | 3300005335 | Bacteria | 18462 |
| 30 | Ga0070666_10001111 | 3300005335 | Bacteria | 16438 |
| 31 | Ga0068868_100026670 | 3300005338 | Bacteria | 4406 |
| 32 | Ga0068868_100029360 | 3300005338 | Bacteria | 4210 |
| 33 | Ga0070660_100013779 | 3300005339 | Bacteria | 5816 |
| 34 | Ga0070689_100009825 | 3300005340 | Bacteria | 6801 |
| 35 | Ga0070661_100009103 | 3300005344 | Bacteria | 6866 |
| 36 | Ga0070668_100052062 | 3300005347 | Bacteria | 3156 |
| 37 | Ga0070669_100012476 | 3300005353 | Bacteria | 6029 |
| 38 | Ga0070669_100016039 | 3300005353 | Bacteria | 5345 |
| 39 | Ga0070669_100019301 | 3300005353 | Bacteria | 4869 |
| 40 | Ga0070675_100001610 | 3300005354 | Bacteria | 16638 |
| 41 | Ga0070675_100005707 | 3300005354 | Bacteria | 9525 |
| 42 | Ga0070671_100005720 | 3300005355 | Bacteria | 9900 |
| 43 | Ga0070674_100000862 | 3300005356 | Bacteria | 15764 |
| 44 | Ga0070673_100000282 | 3300005364 | Bacteria | 26333 |
| 45 | Ga0070673_100000903 | 3300005364 | Bacteria | 16778 |
| 46 | Ga0070673_100014179 | 3300005364 | Bacteria | 5539 |
| 47 | Ga0070659_100013242 | 3300005366 | Bacteria | 6133 |
| 48 | Ga0070667_100012467 | 3300005367 | Bacteria | 7033 |
| 49 | Ga0070714_100000274 | 3300005435 | Bacteria | 39436 |
| 50 | Ga0070713_100000293 | 3300005436 | Bacteria | 33052 |
| 51 | Ga0070713_100019246 | 3300005436 | Bacteria | 5207 |
| 52 | Ga0070694_100002857 | 3300005444 | Bacteria | 10255 |
| 53 | Ga0070663_100004792 | 3300005455 | Bacteria | 7979 |
| 54 | Ga0070678_100003462 | 3300005456 | Bacteria | 8799 |
| 55 | Ga0070678_100010911 | 3300005456 | Bacteria | 5575 |
| 56 | Ga0070662_100000019 | 3300005457 | Bacteria | 101983 |
| 57 | Ga0070681_10002224 | 3300005458 | Bacteria | 17676 |
| 58 | Ga0070681_10017958 | 3300005458 | Bacteria | 7070 |
| 59 | Ga0068867_100000157 | 3300005459 | Bacteria | 43891 |
| 60 | Ga0068867_100001826 | 3300005459 | Bacteria | 14834 |
| 61 | Ga0068867_100004091 | 3300005459 | Bacteria | 10255 |
| 62 | Ga0070685_10005598 | 3300005466 | Bacteria | 6373 |
| 63 | Ga0070685_10008680 | 3300005466 | Bacteria | 5233 |
| 64 | Ga0070706_100004648 | 3300005467 | Bacteria | 13181 |
| 65 | Ga0070706_100015645 | 3300005467 | Bacteria | 7008 |
| 66 | Ga0070706_100049068 | 3300005467 | Bacteria | 3896 |
| 67 | Ga0070707_100012674 | 3300005468 | Bacteria | 7874 |
| 68 | Ga0070698_100001047 | 3300005471 | Bacteria | 30453 |
| 69 | Ga0070698_100021884 | 3300005471 | Bacteria | 6693 |
| 70 | Ga0070699_100000127 | 3300005518 | Bacteria | 70260 |
| 71 | Ga0070699_100001378 | 3300005518 | Bacteria | 22316 |
| 72 | Ga0070699_100023859 | 3300005518 | Bacteria | 5272 |
| 73 | Ga0070699_100025408 | 3300005518 | Bacteria | 5106 |
| 74 | Ga0070699_100063898 | 3300005518 | Bacteria | 3192 |
| 75 | Ga0070679_100015481 | 3300005530 | Bacteria | 7330 |
| 76 | Ga0070679_100024392 | 3300005530 | Bacteria | 5925 |
| 77 | Ga0070684_100023895 | 3300005535 | Bacteria | 5121 |
| 78 | Ga0070684_100024882 | 3300005535 | Bacteria | 5025 |
| 79 | Ga0070684_100054813 | 3300005535 | Bacteria | 3474 |
| 80 | Ga0070697_100000001 | 3300005536 | Bacteria | 662298 |
| 81 | Ga0068853_100003128 | 3300005539 | Bacteria | 12654 |
| 82 | Ga0068853_100005775 | 3300005539 | Bacteria | 9746 |
| 83 | Ga0068853_100005891 | 3300005539 | Bacteria | 9666 |
| 84 | Ga0068853_100013349 | 3300005539 | Bacteria | 6706 |
| 85 | Ga0068853_100016874 | 3300005539 | Bacteria | 6017 |
| 86 | Ga0068853_100045928 | 3300005539 | Bacteria | 3743 |
| 87 | Ga0070672_100000046 | 3300005543 | Bacteria | 52932 |
| 88 | Ga0070672_100001000 | 3300005543 | Bacteria | 17119 |
| 89 | Ga0070672_100026834 | 3300005543 | Bacteria | 4292 |
| 90 | Ga0070686_100001060 | 3300005544 | Bacteria | 15853 |
| 91 | Ga0070686_100003156 | 3300005544 | Bacteria | 9018 |
| 92 | Ga0070686_100003394 | 3300005544 | Bacteria | 8730 |
| 93 | Ga0070665_100000020 | 3300005548 | Bacteria | 389687 |
| 94 | Ga0070665_100000875 | 3300005548 | Bacteria | 38817 |
| 95 | Ga0070665_100098526 | 3300005548 | Bacteria | 2928 |
| 96 | Ga0070704_100010558 | 3300005549 | Bacteria | 5624 |
| 97 | Ga0068855_100000404 | 3300005563 | Bacteria | 53353 |
| 98 | Ga0068855_100051595 | 3300005563 | Bacteria | 4845 |
| 99 | Ga0070664_100000421 | 3300005564 | Bacteria | 31658 |
| 100 | Ga0070664_100005325 | 3300005564 | Bacteria | 10324 |
| 101 | Ga0068856_100006981 | 3300005614 | Bacteria | 11031 |
| 102 | Ga0068856_100021007 | 3300005614 | Bacteria | 6345 |
| 103 | Ga0068856_100025995 | 3300005614 | Bacteria | 5709 |
| 104 | Ga0068856_100039844 | 3300005614 | Bacteria | 4613 |
| 105 | Ga0068856_100060389 | 3300005614 | Bacteria | 3745 |
| 106 | Ga0068852_100000401 | 3300005616 | Bacteria | 29051 |
| 107 | Ga0068852_100006163 | 3300005616 | Bacteria | 8649 |
| 108 | Ga0068859_100009684 | 3300005617 | Bacteria | 9728 |
| 109 | Ga0068859_100024372 | 3300005617 | Bacteria | 6070 |
| 110 | Ga0068864_100013029 | 3300005618 | Bacteria | 6885 |
| 111 | Ga0068866_10015501 | 3300005718 | Bacteria | 3387 |
| 112 | Ga0068861_100000695 | 3300005719 | Bacteria | 20151 |
| 113 | Ga0068851_10008019 | 3300005834 | Bacteria | 4872 |
| 114 | Ga0068863_100009166 | 3300005841 | Bacteria | 9655 |
| 115 | Ga0068858_100014974 | 3300005842 | Bacteria | 7297 |
| 116 | Ga0068860_100002752 | 3300005843 | Bacteria | 18298 |
| 117 | Ga0068860_100069025 | 3300005843 | Bacteria | 3358 |
| 118 | Ga0081455_10000767 | 3300005937 | Bacteria | 41642 |
| 119 | Ga0081455_10004662 | 3300005937 | Bacteria | 15265 |
| 120 | Ga0081455_10007638 | 3300005937 | Bacteria | 11357 |
| 121 | Ga0081455_10008430 | 3300005937 | Bacteria | 10723 |
| 122 | Ga0081538_10000014 | 3300005981 | Bacteria | 151008 |
| 123 | Ga0081538_10001734 | 3300005981 | Bacteria | 22156 |
| 124 | Ga0081540_1003073 | 3300005983 | Bacteria | 13374 |
| 125 | Ga0081540_1006684 | 3300005983 | Bacteria | 8341 |
| 126 | Ga0081540_1008337 | 3300005983 | Bacteria | 7247 |
| 127 | Ga0081540_1012506 | 3300005983 | Bacteria | 5580 |
| 128 | Ga0081539_10004447 | 3300005985 | Bacteria | 15477 |
| 129 | Ga0081539_10010566 | 3300005985 | Bacteria | 7468 |
| 130 | Ga0070717_10001566 | 3300006028 | Bacteria | 15843 |
| 131 | Ga0070717_10013887 | 3300006028 | Bacteria | 6185 |
| 132 | Ga0075364_10004697 | 3300006051 | Bacteria | 7882 |
| 133 | Ga0075367_10000361 | 3300006178 | Bacteria | 16346 |
| 134 | Ga0075367_10002404 | 3300006178 | Bacteria | 8546 |
| 135 | Ga0075366_10001320 | 3300006195 | Bacteria | 12374 |
| 136 | Ga0075366_10001384 | 3300006195 | Bacteria | 12141 |
| 137 | Ga0075366_10008593 | 3300006195 | Bacteria | 5685 |
| 138 | Ga0097621_100000124 | 3300006237 | Bacteria | 44451 |
| 139 | Ga0097621_100002950 | 3300006237 | Bacteria | 11688 |
| 140 | Ga0097621_100005963 | 3300006237 | Bacteria | 8613 |
| 141 | Ga0097621_100017727 | 3300006237 | Bacteria | 5417 |
| 142 | Ga0097621_100023180 | 3300006237 | Bacteria | 4830 |
| 143 | Ga0068871_100000160 | 3300006358 | Bacteria | 44466 |
| 144 | Ga0068871_100002195 | 3300006358 | Bacteria | 13263 |
| 145 | Ga0068871_100006247 | 3300006358 | Bacteria | 8402 |
| 146 | Ga0075428_100002510 | 3300006844 | Bacteria | 19936 |
| 147 | Ga0075428_100017570 | 3300006844 | Bacteria | 7901 |
| 148 | Ga0075428_100019879 | 3300006844 | Bacteria | 7435 |
| 149 | Ga0075428_100034759 | 3300006844 | Bacteria | 5558 |
| 150 | Ga0075430_100002055 | 3300006846 | Bacteria | 16586 |
| 151 | Ga0075430_100006605 | 3300006846 | Bacteria | 9774 |
| 152 | Ga0075430_100031761 | 3300006846 | Bacteria | 4481 |
| 153 | Ga0075430_100038235 | 3300006846 | Bacteria | 4066 |
| 154 | Ga0075431_100000709 | 3300006847 | Bacteria | 28714 |
| 155 | Ga0075433_10000186 | 3300006852 | Bacteria | 34901 |
| 156 | Ga0075433_10002084 | 3300006852 | Bacteria | 15125 |
| 157 | Ga0075433_10029559 | 3300006852 | Bacteria | 4671 |
| 158 | Ga0075434_100000802 | 3300006871 | Bacteria | 24877 |
| 159 | Ga0075434_100004024 | 3300006871 | Bacteria | 13175 |
| 160 | Ga0075434_100005613 | 3300006871 | Bacteria | 11434 |
| 161 | Ga0075434_100009429 | 3300006871 | Bacteria | 9099 |
| 162 | Ga0075434_100029103 | 3300006871 | Bacteria | 5432 |
| 163 | Ga0075434_100050482 | 3300006871 | Bacteria | 4132 |
| 164 | Ga0075429_100001356 | 3300006880 | Bacteria | 20008 |
| 165 | Ga0075429_100002113 | 3300006880 | Bacteria | 16586 |
| 166 | Ga0075429_100003581 | 3300006880 | Bacteria | 13237 |
| 167 | Ga0075429_100056605 | 3300006880 | Bacteria | 3413 |
| 168 | Ga0068865_100001563 | 3300006881 | Bacteria | 13386 |
| 169 | Ga0068865_100012442 | 3300006881 | Bacteria | 5356 |
| 170 | Ga0075436_100000550 | 3300006914 | Bacteria | 24478 |
| 171 | Ga0075436_100005582 | 3300006914 | Bacteria | 8635 |
| 172 | Ga0097620_100009683 | 3300006931 | Bacteria | 9728 |
| 173 | Ga0097620_100024372 | 3300006931 | Bacteria | 6070 |
| 174 | Ga0075435_100004510 | 3300007076 | Bacteria | 9572 |
| 175 | Ga0075435_100020123 | 3300007076 | Bacteria | 5106 |
| 176 | Ga0075435_100035510 | 3300007076 | Bacteria | 3956 |
| 177 | Ga0105251_10014719 | 3300009011 | Bacteria | 4310 |
| 178 | Ga0105240_10000029 | 3300009093 | Bacteria | 325471 |
| 179 | Ga0105240_10001462 | 3300009093 | Bacteria | 40375 |
| 180 | Ga0105240_10013815 | 3300009093 | Bacteria | 11060 |
| 181 | Ga0105240_10027916 | 3300009093 | Bacteria | 7383 |
| 182 | Ga0105240_10089131 | 3300009093 | Bacteria | 3774 |
| 183 | Ga0105240_10111460 | 3300009093 | Bacteria | 3310 |
| 184 | Ga0111539_10000059 | 3300009094 | Bacteria | 113645 |
| 185 | Ga0111539_10000298 | 3300009094 | Bacteria | 60092 |
| 186 | Ga0111539_10000763 | 3300009094 | Bacteria | 41920 |
| 187 | Ga0111539_10001199 | 3300009094 | Bacteria | 34503 |
| 188 | Ga0111539_10004669 | 3300009094 | Bacteria | 17906 |
| 189 | Ga0111539_10022794 | 3300009094 | Bacteria | 7691 |
| 190 | Ga0111539_10022882 | 3300009094 | Bacteria | 7674 |
| 191 | Ga0105245_10003376 | 3300009098 | Bacteria | 14305 |
| 192 | Ga0105245_10004148 | 3300009098 | Bacteria | 12871 |
| 193 | Ga0105245_10058315 | 3300009098 | Bacteria | 3475 |
| 194 | Ga0114129_10002822 | 3300009147 | Bacteria | 24241 |
| 195 | Ga0114129_10005228 | 3300009147 | Bacteria | 18287 |
| 196 | Ga0114129_10023218 | 3300009147 | Bacteria | 8798 |
| 197 | Ga0114129_10025822 | 3300009147 | Bacteria | 8321 |
| 198 | Ga0114129_10038787 | 3300009147 | Bacteria | 6715 |
| 199 | Ga0114129_10043075 | 3300009147 | Bacteria | 6353 |
| 200 | Ga0114129_10114403 | 3300009147 | Bacteria | 3720 |
| 201 | Ga0105243_10027406 | 3300009148 | Bacteria | 4366 |
| 202 | Ga0105241_10000323 | 3300009174 | Bacteria | 36153 |
| 203 | Ga0105241_10001215 | 3300009174 | Bacteria | 19707 |
| 204 | Ga0105241_10021637 | 3300009174 | Bacteria | 4756 |
| 205 | Ga0105242_10019792 | 3300009176 | Bacteria | 5273 |
| 206 | Ga0105248_10004221 | 3300009177 | Bacteria | 15895 |
| 207 | Ga0105248_10012046 | 3300009177 | Bacteria | 9538 |
| 208 | Ga0105248_10016499 | 3300009177 | Bacteria | 8131 |
| 209 | Ga0105248_10030054 | 3300009177 | Bacteria | 6063 |
| 210 | Ga0105248_10049754 | 3300009177 | Bacteria | 4700 |
| 211 | Ga0105237_10000062 | 3300009545 | Bacteria | 144236 |
| 212 | Ga0105237_10000219 | 3300009545 | Bacteria | 80715 |
| 213 | Ga0105237_10002584 | 3300009545 | Bacteria | 22322 |
| 214 | Ga0105237_10002998 | 3300009545 | Bacteria | 20402 |
| 215 | Ga0105237_10005656 | 3300009545 | Bacteria | 14064 |
| 216 | Ga0105237_10005711 | 3300009545 | Bacteria | 13991 |
| 217 | Ga0105237_10015601 | 3300009545 | Bacteria | 7902 |
| 218 | Ga0105237_10021799 | 3300009545 | Eukaryota | 6580 |
| 219 | Ga0105237_10024243 | 3300009545 | Bacteria | 6208 |
| 220 | Ga0105238_10000714 | 3300009551 | Bacteria | 34756 |
| 221 | Ga0105238_10030659 | 3300009551 | Bacteria | 5473 |
| 222 | Ga0105238_10033754 | 3300009551 | Bacteria | 5207 |
| 223 | Ga0105238_10087738 | 3300009551 | Bacteria | 3098 |
| 224 | Ga0105239_10000062 | 3300010375 | Bacteria | 153782 |
| 225 | Ga0105239_10001911 | 3300010375 | Eukaryota | 27138 |
| 226 | Ga0105239_10009207 | 3300010375 | Bacteria | 11168 |
| 227 | Ga0157373_10004651 | 3300013100 | Bacteria | 10331 |
| 228 | Ga0157373_10025398 | 3300013100 | Bacteria | 4285 |
| 229 | Ga0157371_10000250 | 3300013102 | Bacteria | 75550 |
| 230 | Ga0157371_10008880 | 3300013102 | Bacteria | 7959 |
| 231 | Ga0157371_10019548 | 3300013102 | Bacteria | 4992 |
| 232 | Ga0157371_10025064 | 3300013102 | Bacteria | 4351 |
| 233 | Ga0157371_10034029 | 3300013102 | Bacteria | 3658 |
| 234 | Ga0157370_10015449 | 3300013104 | Bacteria | 7761 |
| 235 | Ga0157370_10015939 | 3300013104 | Bacteria | 7625 |
| 236 | Ga0157370_10030331 | 3300013104 | Bacteria | 5299 |
| 237 | Ga0157369_10001633 | 3300013105 | Bacteria | 27410 |
| 238 | Ga0157369_10025494 | 3300013105 | Bacteria | 6565 |
| 239 | Ga0157369_10045208 | 3300013105 | Bacteria | 4791 |
| 240 | Ga0157369_10046209 | 3300013105 | Bacteria | 4732 |
| 241 | Ga0157369_10071901 | 3300013105 | Bacteria | 3712 |
| 242 | Ga0157369_10085262 | 3300013105 | Bacteria | 3376 |
| 243 | Ga0157374_10000746 | 3300013296 | Bacteria | 28337 |
| 244 | Ga0157374_10001502 | 3300013296 | Bacteria | 19653 |
| 245 | Ga0157374_10027248 | 3300013296 | Bacteria | 5152 |
| 246 | Ga0157374_10041996 | 3300013296 | Bacteria | 4217 |
| 247 | Ga0157378_10000103 | 3300013297 | Bacteria | 80099 |
| 248 | Ga0157378_10000578 | 3300013297 | Bacteria | 34492 |
| 249 | Ga0157378_10001933 | 3300013297 | Bacteria | 18577 |
| 250 | Ga0157378_10002021 | 3300013297 | Bacteria | 18141 |
| 251 | Ga0157378_10012406 | 3300013297 | Bacteria | 7461 |
| 252 | Ga0157378_10012886 | 3300013297 | Bacteria | 7321 |
| 253 | Ga0157378_10014126 | 3300013297 | Bacteria | 6988 |
| 254 | Ga0163162_10000083 | 3300013306 | Bacteria | 86303 |
| 255 | Ga0163162_10013909 | 3300013306 | Bacteria | 7861 |
| 256 | Ga0163162_10026296 | 3300013306 | Bacteria | 5751 |
| 257 | Ga0163162_10067945 | 3300013306 | Bacteria | 3615 |
| 258 | Ga0157372_10002437 | 3300013307 | Bacteria | 20152 |
| 259 | Ga0157372_10003802 | 3300013307 | Bacteria | 16210 |
| 260 | Ga0157372_10028804 | 3300013307 | Bacteria | 6061 |
| 261 | Ga0157372_10082344 | 3300013307 | Bacteria | 3643 |
| 262 | Ga0157375_10002741 | 3300013308 | Bacteria | 15224 |
| 263 | Ga0163163_10000022 | 3300014325 | Bacteria | 187289 |
| 264 | Ga0163163_10022617 | 3300014325 | Bacteria | 5958 |
| 265 | Ga0163163_10065412 | 3300014325 | Bacteria | 3609 |
| 266 | Ga0157380_10001679 | 3300014326 | Bacteria | 14618 |
| 267 | Ga0157380_10020389 | 3300014326 | Bacteria | 4955 |
| 268 | Ga0157379_10014452 | 3300014968 | Bacteria | 6928 |
| 269 | Ga0157376_10004159 | 3300014969 | Bacteria | 10033 |
| 270 | Ga0157376_10019391 | 3300014969 | Bacteria | 5242 |
| 271 | Ga0163161_10003396 | 3300017792 | Bacteria | 11175 |
| 272 | Ga0163161_10013161 | 3300017792 | Bacteria | 5751 |
| 273 | Ga0213872_10010134 | 3300021361 | Bacteria | 4495 |
| 274 | Ga0213874_10000160 | 3300021377 | Bacteria | 11888 |
| 275 | Ga0213874_10001399 | 3300021377 | Bacteria | 4987 |
| 276 | Ga0213876_10000716 | 3300021384 | Bacteria | 23196 |
| 277 | Ga0213876_10017469 | 3300021384 | Bacteria | 3787 |
| 278 | Ga0213875_10000008 | 3300021388 | Bacteria | 533344 |
| 279 | Ga0213875_10000575 | 3300021388 | Bacteria | 29979 |
| 280 | Ga0213875_10004666 | 3300021388 | Bacteria | 7466 |
| 281 | Ga0213875_10016306 | 3300021388 | Bacteria | 3605 |
| 282 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 283 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 284 | Ga0209676_1001142 | 3300025292 | Bacteria | 29031 |
| 285 | Ga0209050_1000048 | 3300025298 | Bacteria | 371553 |
| 286 | Ga0207697_10001618 | 3300025315 | Bacteria | 12158 |
| 287 | Ga0207655_1000006 | 3300025728 | Bacteria | 861092 |
| 288 | Ga0207682_10000683 | 3300025893 | Bacteria | 15756 |
| 289 | Ga0207642_10004342 | 3300025899 | Bacteria | 4571 |
| 290 | Ga0207647_10001006 | 3300025904 | Bacteria | 21888 |
| 291 | Ga0207647_10005268 | 3300025904 | Bacteria | 9517 |
| 292 | Ga0207645_10001043 | 3300025907 | Bacteria | 22916 |
| 293 | Ga0207645_10001053 | 3300025907 | Bacteria | 22848 |
| 294 | Ga0207645_10005809 | 3300025907 | Bacteria | 8897 |
| 295 | Ga0207643_10004136 | 3300025908 | Bacteria | 7816 |
| 296 | Ga0207705_10008618 | 3300025909 | Bacteria | 7434 |
| 297 | Ga0207684_10013251 | 3300025910 | Bacteria | 7135 |
| 298 | Ga0207684_10034071 | 3300025910 | Bacteria | 4328 |
| 299 | Ga0207684_10042077 | 3300025910 | Bacteria | 3872 |
| 300 | Ga0207684_10048083 | 3300025910 | Bacteria | 3618 |
| 301 | Ga0207654_10000217 | 3300025911 | Bacteria | 35359 |
| 302 | Ga0207654_10019976 | 3300025911 | Bacteria | 3544 |
| 303 | Ga0207695_10000034 | 3300025913 | Bacteria | 496728 |
| 304 | Ga0207695_10001628 | 3300025913 | Bacteria | 36329 |
| 305 | Ga0207695_10013733 | 3300025913 | Bacteria | 9636 |
| 306 | Ga0207671_10000140 | 3300025914 | Bacteria | 111643 |
| 307 | Ga0207671_10000250 | 3300025914 | Bacteria | 80704 |
| 308 | Ga0207671_10000951 | 3300025914 | Bacteria | 35984 |
| 309 | Ga0207671_10001128 | 3300025914 | Bacteria | 32167 |
| 310 | Ga0207671_10005846 | 3300025914 | Bacteria | 11176 |
| 311 | Ga0207671_10013546 | 3300025914 | Eukaryota | 6492 |
| 312 | Ga0207671_10014302 | 3300025914 | Bacteria | 6278 |
| 313 | Ga0207693_10003151 | 3300025915 | Bacteria | 14182 |
| 314 | Ga0207663_10020792 | 3300025916 | Bacteria | 3724 |
| 315 | Ga0207662_10009849 | 3300025918 | Bacteria | 5273 |
| 316 | Ga0207657_10011844 | 3300025919 | Bacteria | 8634 |
| 317 | Ga0207657_10049712 | 3300025919 | Bacteria | 3651 |
| 318 | Ga0207652_10011392 | 3300025921 | Bacteria | 7167 |
| 319 | Ga0207646_10014010 | 3300025922 | Bacteria | 7633 |
| 320 | Ga0207694_10000201 | 3300025924 | Bacteria | 59771 |
| 321 | Ga0207694_10009343 | 3300025924 | Bacteria | 7397 |
| 322 | Ga0207694_10033150 | 3300025924 | Bacteria | 3956 |
| 323 | Ga0207650_10006006 | 3300025925 | Bacteria | 8284 |
| 324 | Ga0207650_10022164 | 3300025925 | Bacteria | 4496 |
| 325 | Ga0207659_10015019 | 3300025926 | Bacteria | 5007 |
| 326 | Ga0207659_10025073 | 3300025926 | Bacteria | 4003 |
| 327 | Ga0207687_10020397 | 3300025927 | Bacteria | 4396 |
| 328 | Ga0207700_10009430 | 3300025928 | Bacteria | 6096 |
| 329 | Ga0207644_10007547 | 3300025931 | Bacteria | 7091 |
| 330 | Ga0207644_10021060 | 3300025931 | Bacteria | 4439 |
| 331 | Ga0207644_10035215 | 3300025931 | Bacteria | 3506 |
| 332 | Ga0207706_10000058 | 3300025933 | Bacteria | 112367 |
| 333 | Ga0207706_10000968 | 3300025933 | Bacteria | 29344 |
| 334 | Ga0207706_10008173 | 3300025933 | Bacteria | 9653 |
| 335 | Ga0207706_10017962 | 3300025933 | Bacteria | 6366 |
| 336 | Ga0207709_10025704 | 3300025935 | Bacteria | 3373 |
| 337 | Ga0207704_10000135 | 3300025938 | Bacteria | 40033 |
| 338 | Ga0207691_10000274 | 3300025940 | Bacteria | 51054 |
| 339 | Ga0207711_10004963 | 3300025941 | Bacteria | 11292 |
| 340 | Ga0207711_10010971 | 3300025941 | Bacteria | 7526 |
| 341 | Ga0207711_10013816 | 3300025941 | Bacteria | 6703 |
| 342 | Ga0207689_10000460 | 3300025942 | Bacteria | 38128 |
| 343 | Ga0207689_10007207 | 3300025942 | Bacteria | 9768 |
| 344 | Ga0207661_10023531 | 3300025944 | Bacteria | 4656 |
| 345 | Ga0207661_10035690 | 3300025944 | Bacteria | 3877 |
| 346 | Ga0207679_10006255 | 3300025945 | Bacteria | 7513 |
| 347 | Ga0207667_10000474 | 3300025949 | Bacteria | 53654 |
| 348 | Ga0207667_10007872 | 3300025949 | Bacteria | 12727 |
| 349 | Ga0207667_10016629 | 3300025949 | Bacteria | 8305 |
| 350 | Ga0207667_10034268 | 3300025949 | Bacteria | 5453 |
| 351 | Ga0207667_10049699 | 3300025949 | Bacteria | 4427 |
| 352 | Ga0207667_10066274 | 3300025949 | Bacteria | 3764 |
| 353 | Ga0207651_10000435 | 3300025960 | Bacteria | 17629 |
| 354 | Ga0207651_10004269 | 3300025960 | Bacteria | 7170 |
| 355 | Ga0207640_10016744 | 3300025981 | Bacteria | 4272 |
| 356 | Ga0207658_10008617 | 3300025986 | Bacteria | 6937 |
| 357 | Ga0207677_10011615 | 3300026023 | Bacteria | 5027 |
| 358 | Ga0207703_10036818 | 3300026035 | Bacteria | 3896 |
| 359 | Ga0207639_10000059 | 3300026041 | Bacteria | 108373 |
| 360 | Ga0207639_10003795 | 3300026041 | Bacteria | 10170 |
| 361 | Ga0207639_10007316 | 3300026041 | Bacteria | 7520 |
| 362 | Ga0207639_10023757 | 3300026041 | Bacteria | 4428 |
| 363 | Ga0207678_10003949 | 3300026067 | Bacteria | 13344 |
| 364 | Ga0207708_10006550 | 3300026075 | Bacteria | 8616 |
| 365 | Ga0207708_10035161 | 3300026075 | Bacteria | 3813 |
| 366 | Ga0207702_10002237 | 3300026078 | Bacteria | 18564 |
| 367 | Ga0207702_10012718 | 3300026078 | Bacteria | 7003 |
| 368 | Ga0207702_10017513 | 3300026078 | Bacteria | 5927 |
| 369 | Ga0207641_10009835 | 3300026088 | Bacteria | 7875 |
| 370 | Ga0207641_10028103 | 3300026088 | Bacteria | 4645 |
| 371 | Ga0207648_10000275 | 3300026089 | Bacteria | 55875 |
| 372 | Ga0207648_10003356 | 3300026089 | Bacteria | 16833 |
| 373 | Ga0207648_10005143 | 3300026089 | Bacteria | 13243 |
| 374 | Ga0207648_10006458 | 3300026089 | Bacteria | 11646 |
| 375 | Ga0207676_10014130 | 3300026095 | Bacteria | 5735 |
| 376 | Ga0207674_10000413 | 3300026116 | Bacteria | 55635 |
| 377 | Ga0207674_10023660 | 3300026116 | Bacteria | 6576 |
| 378 | Ga0207675_100002914 | 3300026118 | Bacteria | 16825 |
| 379 | Ga0207683_10000078 | 3300026121 | Bacteria | 77219 |
| 380 | Ga0207698_10000202 | 3300026142 | Bacteria | 37470 |
| 381 | Ga0207698_10005206 | 3300026142 | Bacteria | 7998 |
| 382 | Ga0207428_10000066 | 3300027907 | Bacteria | 150622 |
| 383 | Ga0207428_10000253 | 3300027907 | Bacteria | 73122 |
| 384 | Ga0207428_10000753 | 3300027907 | Bacteria | 37020 |
| 385 | Ga0207428_10001158 | 3300027907 | Bacteria | 28488 |
| 386 | Ga0207428_10002348 | 3300027907 | Bacteria | 18901 |
| 387 | Ga0207428_10012489 | 3300027907 | Bacteria | 7460 |
| 388 | Ga0265356_1000878 | 3300028017 | Bacteria | 4923 |
| 389 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 390 | Ga0268266_10001104 | 3300028379 | Bacteria | 33828 |
| 391 | Ga0268266_10003557 | 3300028379 | Bacteria | 15449 |
| 392 | Ga0268265_10007215 | 3300028380 | Bacteria | 7511 |
| 393 | Ga0268264_10023900 | 3300028381 | Bacteria | 4985 |
| 394 | Ga0268264_10033961 | 3300028381 | Bacteria | 4193 |
| 395 | Ga0265319_1000568 | 3300028563 | Bacteria | 24914 |
| 396 | Ga0265319_1001513 | 3300028563 | Bacteria | 13799 |
| 397 | Ga0265334_10002734 | 3300028573 | Bacteria | 8155 |
| 398 | Ga0265318_10000177 | 3300028577 | Bacteria | 56517 |
| 399 | Ga0265318_10009320 | 3300028577 | Bacteria | 4320 |
| 400 | Ga0307517_10020409 | 3300028786 | Bacteria | 8440 |
| 401 | Ga0307515_10000432 | 3300028794 | Bacteria | 100348 |
| 402 | Ga0307515_10002380 | 3300028794 | Eukaryota | 41028 |
| 403 | Ga0307515_10009167 | 3300028794 | Bacteria | 19183 |
| 404 | Ga0265338_10000064 | 3300028800 | Bacteria | 190219 |
| 405 | Ga0265338_10001461 | 3300028800 | Bacteria | 38300 |
| 406 | Ga0265338_10007889 | 3300028800 | Bacteria | 13059 |
| 407 | Ga0265338_10018515 | 3300028800 | Bacteria | 7452 |
| 408 | Ga0265338_10031787 | 3300028800 | Bacteria | 5166 |
| 409 | Ga0265324_10000700 | 3300029957 | Bacteria | 22374 |
| 410 | Ga0265760_10000709 | 3300031090 | Bacteria | 9490 |
| 411 | Ga0265330_10000905 | 3300031235 | Bacteria | 18342 |
| 412 | Ga0265332_10000169 | 3300031238 | Bacteria | 53146 |
| 413 | Ga0265332_10000386 | 3300031238 | Bacteria | 32118 |
| 414 | Ga0265332_10005881 | 3300031238 | Bacteria | 5612 |
| 415 | Ga0265328_10007617 | 3300031239 | Bacteria | 4504 |
| 416 | Ga0265320_10001302 | 3300031240 | Bacteria | 18219 |
| 417 | Ga0265320_10016372 | 3300031240 | Bacteria | 4157 |
| 418 | Ga0265329_10000042 | 3300031242 | Bacteria | 53592 |
| 419 | Ga0265340_10003855 | 3300031247 | Bacteria | 8449 |
| 420 | Ga0265339_10001025 | 3300031249 | Bacteria | 21308 |
| 421 | Ga0265331_10000117 | 3300031250 | Bacteria | 104134 |
| 422 | Ga0265331_10001952 | 3300031250 | Bacteria | 14414 |
| 423 | Ga0265316_10000031 | 3300031344 | Bacteria | 161451 |
| 424 | Ga0265316_10003028 | 3300031344 | Bacteria | 17172 |
| 425 | Ga0265316_10049735 | 3300031344 | Bacteria | 3300 |
| 426 | Ga0307509_10012358 | 3300031507 | Bacteria | 10222 |
| 427 | Ga0307408_100004766 | 3300031548 | Bacteria | 9145 |
| 428 | Ga0265313_10001541 | 3300031595 | Bacteria | 21408 |
| 429 | Ga0265313_10002676 | 3300031595 | Bacteria | 15100 |
| 430 | Ga0265313_10013040 | 3300031595 | Bacteria | 5023 |
| 431 | Ga0265313_10020776 | 3300031595 | Bacteria | 3613 |
| 432 | Ga0307508_10003774 | 3300031616 | Bacteria | 15133 |
| 433 | Ga0316575_10002167 | 3300031665 | Bacteria | 6550 |
| 434 | Ga0265314_10000183 | 3300031711 | Bacteria | 92559 |
| 435 | Ga0265314_10003487 | 3300031711 | Bacteria | 15188 |
| 436 | Ga0265314_10004880 | 3300031711 | Bacteria | 12262 |
| 437 | Ga0265342_10000199 | 3300031712 | Bacteria | 67101 |
| 438 | Ga0265342_10000869 | 3300031712 | Bacteria | 30180 |
| 439 | Ga0316576_10006030 | 3300031727 | Bacteria | 7490 |
| 440 | Ga0316576_10043509 | 3300031727 | Bacteria | 3240 |
| 441 | Ga0316578_10007781 | 3300031728 | Bacteria | 5407 |
| 442 | Ga0307516_10006229 | 3300031730 | Bacteria | 14036 |
| 443 | Ga0307409_100027562 | 3300031995 | Bacteria | 4028 |
| 444 | Ga0307416_100021502 | 3300032002 | Bacteria | 4633 |
| 445 | Ga0316585_10006113 | 3300032137 | Bacteria | 3430 |
| 446 | Ga0307507_10001092 | 3300033179 | Bacteria | 60190 |
| 447 | Ga0307507_10002761 | 3300033179 | Eukaryota | 35894 |
| 448 | Ga0307510_10001317 | 3300033180 | Bacteria | 27057 |
| 449 | Ga0373926_0000012 | 3300035083 | Bacteria | 31305 |
| 450 | Ga0373926_0000044 | 3300035083 | Bacteria | 20723 |
| 451 | Ga0373926_0000807 | 3300035083 | Bacteria | 8852 |
| 452 | Ga0373949_0000055 | 3300035090 | Bacteria | 42961 |
| 453 | Ga0373943_0000147 | 3300035170 | Bacteria | 27190 |
| 454 | Ga0373943_0000950 | 3300035170 | Bacteria | 12834 |
| 455 | Ga0373955_0025808 | 3300035172 | Bacteria | 3021 |
| 456 | Ga0316574_0000052 | 3300035398 | Bacteria | 29685 |
| 457 | Ga0373935_0003782 | 3300035692 | Bacteria | 8837 |
| 458 | Ga0373927_0000302 | 3300035695 | Bacteria | 38848 |
| 459 | Ga0373927_0000357 | 3300035695 | Bacteria | 35562 |
| 460 | Ga0373927_0002350 | 3300035695 | Bacteria | 13792 |
| 461 | Ga0373947_0000283 | 3300035725 | Bacteria | 28730 |
| 462 | Ga0373947_0005503 | 3300035725 | Bacteria | 7389 |
| 463 | Ga0373937_0000117 | 3300036401 | Bacteria | 75969 |
| 464 | Ga0373937_0017949 | 3300036401 | Bacteria | 6312 |
| 465 | Ga0373937_0036587 | 3300036401 | Bacteria | 4474 |
| 466 | Ga0373937_0067782 | 3300036401 | Bacteria | 3289 |
| 467 | Ga0316582_0000166 | 3300036647 | Bacteria | 20311 |
| 468 | Ga0316584_0007826 | 3300036712 | Bacteria | 7331 |
| 469 | Ga0373925_0000225 | 3300037068 | Bacteria | 60424 |
| 470 | Ga0373925_0001747 | 3300037068 | Bacteria | 18178 |
| 471 | Ga0373925_0012787 | 3300037068 | Bacteria | 6079 |
| 472 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 473 | Ga0395899_0000232 | 3300037312 | Bacteria | 75259 |
| 474 | Ga0395899_0001442 | 3300037312 | Bacteria | 20302 |
| 475 | Ga0395900_0000517 | 3300037418 | Bacteria | 54614 |
| 476 | Ga0395900_0001891 | 3300037418 | Bacteria | 23809 |
| 477 | Ga0395900_0078499 | 3300037418 | Bacteria | 3392 |
| 478 | Ga0395898_0008170 | 3300037466 | Bacteria | 11078 |
| 479 | Ga0395905_0008935 | 3300037471 | Bacteria | 9838 |
| 480 | Ga0395905_0015572 | 3300037471 | Bacteria | 7226 |
| 481 | Ga0316581_0004132 | 3300037588 | Bacteria | 3673 |
| 482 | Ga0436364_0719353 | 3300037853 | Bacteria | 4009 |
| 483 | Ga0436364_0909399 | 3300037853 | Bacteria | 4447 |
| 484 | Ga0436364_1008502 | 3300037853 | Bacteria | 66010 |
| 485 | Ga0436364_1259742 | 3300037853 | Bacteria | 7800 |
| 486 | Ga0436364_1310913 | 3300037853 | Bacteria | 5425 |
| 487 | Ga0436364_1393295 | 3300037853 | Bacteria | 9285 |
| 488 | Ga0436364_1415525 | 3300037853 | Bacteria | 425173 |
| 489 | Ga0436364_1421630 | 3300037853 | Bacteria | 2993 |
| 490 | Ga0395901_0001035 | 3300038443 | Bacteria | 30039 |
| 491 | Ga0400488_59865 | 3300038741 | Bacteria | 3211 |
| 492 | Ga0436365_0042253 | 3300039437 | Bacteria | 6291 |
| 493 | Ga0436365_0292949 | 3300039437 | Bacteria | 9608 |
| 494 | Ga0436365_0886091 | 3300039437 | Bacteria | 43353 |
| 495 | Ga0436365_0957937 | 3300039437 | Bacteria | 2797 |
| 496 | Ga0436360_0213572 | 3300039438 | Bacteria | 12542 |
| 497 | Ga0436360_1078765 | 3300039438 | Bacteria | 3031 |
| 498 | Ga0436361_0046678 | 3300039447 | Bacteria | 18062 |
| 499 | Ga0436361_0403733 | 3300039447 | Bacteria | 6876 |
| 500 | Ga0436361_0738714 | 3300039447 | Bacteria | 102195 |
| 501 | Ga0436361_1164749 | 3300039447 | Bacteria | 25165 |
| 502 | Ga0436363_0172570 | 3300039450 | Bacteria | 47063 |
| 503 | Ga0436363_0507032 | 3300039450 | Bacteria | 7511 |
| 504 | Ga0436363_0573267 | 3300039450 | Bacteria | 6006 |
| 505 | Ga0436363_1495906 | 3300039450 | Bacteria | 5761 |
| 506 | Ga0436362_0555205 | 3300039453 | Bacteria | 4175 |
| 507 | Ga0436362_0688989 | 3300039453 | Bacteria | 6117 |
| 508 | Ga0451577_0000583 | 3300042876 | Bacteria | 58778 |
| 509 | Ga0451577_0003269 | 3300042876 | Bacteria | 18241 |
| 510 | Ga0451577_0033220 | 3300042876 | Bacteria | 4651 |
| 511 | Ga0453684_0000841 | 3300044712 | Bacteria | 103501 |
| 512 | Ga0453684_0002278 | 3300044712 | Bacteria | 47319 |
| 513 | Ga0453684_0009932 | 3300044712 | Bacteria | 16422 |
| 514 | Ga0453684_0075714 | 3300044712 | Bacteria | 4228 |
| 515 | Ga0451576_0000191 | 3300045051 | Bacteria | 154184 |
| 516 | Ga0451576_0003755 | 3300045051 | Bacteria | 20494 |
| 517 | Ga0451576_0005819 | 3300045051 | Bacteria | 15325 |
| 518 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 519 | Ga0495580_0003375 | 3300046472 | Bacteria | 13646 |
| 520 | Ga0495580_0026941 | 3300046472 | Bacteria | 4186 |
| 521 | Ga0495582_0004962 | 3300046473 | Bacteria | 7454 |
| 522 | Ga0495582_0029851 | 3300046473 | Bacteria | 2993 |
| 523 | Ga0495585_0000470 | 3300046492 | Bacteria | 38600 |
| 524 | Ga0495585_0001492 | 3300046492 | Bacteria | 18281 |
| 525 | Ga0495585_0013845 | 3300046492 | Bacteria | 4713 |
| 526 | Ga0495594_0002318 | 3300046499 | Bacteria | 9912 |
| 527 | Ga0495606_0002345 | 3300046507 | Bacteria | 22272 |
| 528 | Ga0495606_0018132 | 3300046507 | Bacteria | 5291 |
| 529 | Ga0495606_0052490 | 3300046507 | Bacteria | 2651 |
| 530 | Ga0495610_0002357 | 3300046512 | Bacteria | 15964 |
| 531 | Ga0495610_0002626 | 3300046512 | Bacteria | 14866 |
| 532 | Ga0495610_0003108 | 3300046512 | Bacteria | 13229 |
| 533 | Ga0495628_0025165 | 3300046516 | Bacteria | 4864 |
| 534 | Ga0495630_0000583 | 3300046517 | Bacteria | 26620 |
| 535 | Ga0495630_0002677 | 3300046517 | Bacteria | 12350 |
| 536 | Ga0495630_0028069 | 3300046517 | Bacteria | 4181 |
| 537 | Ga0495631_0007485 | 3300046518 | Bacteria | 5549 |
| 538 | Ga0495637_0018362 | 3300046520 | Bacteria | 3245 |
| 539 | Ga0495644_0000055 | 3300046523 | Bacteria | 55317 |
| 540 | Ga0495652_0049119 | 3300046529 | Bacteria | 3613 |
| 541 | Ga0495609_0012695 | 3300046538 | Bacteria | 3994 |
| 542 | Ga0495633_0000014 | 3300046558 | Bacteria | 261742 |
| 543 | Ga0495633_0004016 | 3300046558 | Bacteria | 9522 |
| 544 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 545 | Ga0495625_0000219 | 3300046660 | Bacteria | 90690 |
| 546 | Ga0495625_0000248 | 3300046660 | Bacteria | 84339 |
| 547 | Ga0495625_0004001 | 3300046660 | Bacteria | 14116 |
| 548 | Ga0495661_0001961 | 3300046665 | Bacteria | 16336 |
| 549 | Ga0495661_0035364 | 3300046665 | Bacteria | 3135 |
| 550 | Ga0495588_0000001 | 3300046674 | Eukaryota | 1451569 |
| 551 | Ga0495649_0000037 | 3300046694 | Bacteria | 133848 |
| 552 | Ga0495660_0007425 | 3300046810 | Bacteria | 6436 |
| 553 | Ga0495687_000942 | 3300047443 | Bacteria | 30043 |
| 554 | Ga0495687_018101 | 3300047443 | Bacteria | 3491 |
| 555 | Ga0495684_0001768 | 3300047471 | Bacteria | 17334 |
| 556 | Ga0495686_0000264 | 3300047472 | Bacteria | 93838 |
| 557 | Ga0495602_0007513 | 3300048088 | Bacteria | 11398 |
| 558 | Ga0496101_0016026 | 3300048904 | Bacteria | 5059 |
| 559 | Ga0496102_0004825 | 3300048905 | Bacteria | 11401 |
| 560 | Ga0496104_0002107 | 3300048907 | Bacteria | 17270 |
| 561 | Ga0496104_0004026 | 3300048907 | Bacteria | 12740 |
| 562 | Ga0496104_0009366 | 3300048907 | Bacteria | 8708 |
| 563 | Ga0496106_0025262 | 3300048909 | Bacteria | 4420 |
| 564 | Ga0496110_0065775 | 3300048913 | Bacteria | 3205 |
| 565 | Ga0496111_0002881 | 3300048914 | Bacteria | 10508 |
| 566 | Ga0496111_0005566 | 3300048914 | Bacteria | 8095 |
| 567 | Ga0496112_0049285 | 3300048915 | Bacteria | 4128 |
| 568 | Ga0496112_0096597 | 3300048915 | Bacteria | 2925 |
| 569 | Ga0496112_0119973 | 3300048915 | Bacteria | 2600 |
| 570 | Ga0496113_0001502 | 3300048916 | Bacteria | 13057 |
| 571 | Ga0496114_0002337 | 3300048917 | Bacteria | 14432 |
| 572 | Ga0496114_0018040 | 3300048917 | Bacteria | 5702 |
| 573 | Ga0496115_0011538 | 3300048918 | Bacteria | 6624 |
| 574 | Ga0496115_0022588 | 3300048918 | Bacteria | 4877 |
| 575 | Ga0501032_0039727 | 3300049569 | Bacteria | 3200 |
| 576 | Ga0501033_0025418 | 3300049570 | Bacteria | 4462 |
| 577 | Ga0501034_0007570 | 3300049571 | Bacteria | 11555 |
| 578 | Ga0501036_0000593 | 3300049572 | Bacteria | 26259 |
| 579 | Ga0501038_0002658 | 3300049574 | Bacteria | 16701 |
| 580 | Ga0501041_0006893 | 3300049577 | Bacteria | 6661 |
| 581 | Ga0501041_0010676 | 3300049577 | Bacteria | 5418 |
| 582 | Ga0501042_0003168 | 3300049578 | Bacteria | 10254 |
| 583 | Ga0501042_0005677 | 3300049578 | Bacteria | 8053 |
| 584 | Ga0501042_0034052 | 3300049578 | Bacteria | 3613 |
| 585 | Ga0501047_0013859 | 3300049581 | Bacteria | 7655 |
| 586 | Ga0501047_0017503 | 3300049581 | Bacteria | 6865 |
| 587 | Ga0501068_0005764 | 3300049584 | Bacteria | 6792 |
| 588 | Ga0501070_0007263 | 3300049586 | Bacteria | 9406 |
| 589 | Ga0501072_0000549 | 3300049588 | Bacteria | 26969 |
| 590 | Ga0501072_0008834 | 3300049588 | Bacteria | 7655 |
| 591 | Ga0501073_0021126 | 3300049589 | Bacteria | 4695 |
| 592 | Ga0501075_0000014 | 3300049591 | Bacteria | 77078 |
| 593 | Ga0501075_0000136 | 3300049591 | Bacteria | 36442 |
| 594 | Ga0501075_0026732 | 3300049591 | Bacteria | 4250 |
| 595 | Ga0501076_0000016 | 3300049592 | Bacteria | 94865 |
| 596 | Ga0501076_0000072 | 3300049592 | Bacteria | 50636 |
| 597 | Ga0501076_0013423 | 3300049592 | Bacteria | 6143 |
| 598 | Ga0501079_0001520 | 3300049741 | Bacteria | 16418 |
| 599 | Ga0501079_0005299 | 3300049741 | Bacteria | 9594 |
| 600 | Ga0501080_0006644 | 3300049742 | Bacteria | 10404 |
| 601 | Ga0501080_0020084 | 3300049742 | Bacteria | 6183 |
| 602 | Ga0501080_0025090 | 3300049742 | Bacteria | 5532 |
| 603 | Ga0501081_0026494 | 3300049743 | Bacteria | 3910 |
| 604 | Ga0501083_0001033 | 3300049744 | Bacteria | 18569 |
| 605 | Ga0501083_0029764 | 3300049744 | Bacteria | 3753 |
| 606 | Ga0501044_0000235 | 3300049823 | Bacteria | 69800 |
| 607 | Ga0501044_0002405 | 3300049823 | Bacteria | 21347 |
| 608 | Ga0501044_0022588 | 3300049823 | Bacteria | 6703 |
| 609 | nmdc:mga00v17_2275_c1 | 3300050491 | Bacteria | 9851 |
| 610 | nmdc:mga00v17_2693_c1 | 3300050491 | Bacteria | 9116 |
| 611 | nmdc:mga0k408_1228_c1 | 3300050493 | Bacteria | 14040 |
| 612 | nmdc:mga0k408_1402_c1 | 3300050493 | Bacteria | 13042 |
| 613 | nmdc:mga0k408_19032_c1 | 3300050493 | Bacteria | 3834 |
| 614 | nmdc:mga0k408_9140_c1 | 3300050493 | Bacteria | 4420 |
| 615 | nmdc:mga06z11_739_c1 | 3300050494 | Bacteria | 11950 |
| 616 | nmdc:mga06z11_7621_c1 | 3300050494 | Bacteria | 4468 |
| 617 | nmdc:mga05p37_19278_c1 | 3300050507 | Bacteria | 8251 |
| 618 | nmdc:mga05p37_27947_c1 | 3300050507 | Bacteria | 6872 |
| 619 | nmdc:mga05p37_2963_c1 | 3300050507 | Bacteria | 19704 |
| 620 | nmdc:mga05p37_29951_c1 | 3300050507 | Bacteria | 6643 |
| 621 | nmdc:mga05p37_3891_c1 | 3300050507 | Bacteria | 17465 |
| 622 | nmdc:mga05p37_46198_c1 | 3300050507 | Bacteria | 5355 |
| 623 | nmdc:mga05p37_8551_c1 | 3300050507 | Bacteria | 12099 |
| 624 | nmdc:mga05p37_99468_c1 | 3300050507 | Bacteria | 3582 |
| 625 | nmdc:mga09592_1969_c1 | 3300050508 | Bacteria | 16568 |
| 626 | nmdc:mga09592_37019_c1 | 3300050508 | Bacteria | 4090 |
| 627 | nmdc:mga09592_534_c2 | 3300050508 | Bacteria | 20140 |
| 628 | nmdc:mga09592_6313_c1 | 3300050508 | Bacteria | 9659 |
| 629 | nmdc:mga09592_6474_c1 | 3300050508 | Bacteria | 9538 |
| 630 | nmdc:mga09592_868_c1 | 3300050508 | Bacteria | 23666 |
| 631 | nmdc:mga0qj67_1220_c1 | 3300050509 | Bacteria | 17900 |
| 632 | nmdc:mga0qj67_15_c3 | 3300050509 | Bacteria | 20140 |
| 633 | nmdc:mga0qj67_20011_c1 | 3300050509 | Bacteria | 5121 |
| 634 | nmdc:mga0qj67_21054_c1 | 3300050509 | Bacteria | 4999 |
| 635 | nmdc:mga0qj67_531_c1 | 3300050509 | Bacteria | 25967 |
| 636 | nmdc:mga06r32_2168_c1 | 3300050510 | Bacteria | 17570 |
| 637 | nmdc:mga06r32_222_c1 | 3300050510 | Bacteria | 46046 |
| 638 | nmdc:mga06r32_447_c1 | 3300050510 | Bacteria | 28100 |
| 639 | nmdc:mga08y16_1066_c1 | 3300050511 | Bacteria | 26995 |
| 640 | nmdc:mga08y16_150_c1 | 3300050511 | Bacteria | 60170 |
| 641 | nmdc:mga08y16_252_c1 | 3300050511 | Bacteria | 48080 |
| 642 | nmdc:mga08y16_3079_c1 | 3300050511 | Bacteria | 17242 |
| 643 | nmdc:mga08y16_340_c1 | 3300050511 | Bacteria | 42385 |
| 644 | nmdc:mga08y16_4051_c1 | 3300050511 | Bacteria | 15292 |
| 645 | nmdc:mga0n895_11451_c1 | 3300050512 | Bacteria | 7914 |
| 646 | nmdc:mga0n895_54365_c1 | 3300050512 | Bacteria | 3938 |
| 647 | nmdc:mga0n895_783_c1 | 3300050512 | Bacteria | 22639 |
| 648 | nmdc:mga0rr50_320_c1 | 3300050513 | Bacteria | 26011 |
| 649 | nmdc:mga0rr50_3738_c1 | 3300050513 | Bacteria | 8818 |
| 650 | nmdc:mga0rr50_42643_c1 | 3300050513 | Bacteria | 3315 |
| 651 | nmdc:mga0rr50_6553_c1 | 3300050513 | Bacteria | 7105 |
| 652 | nmdc:mga08x19_2334_c1 | 3300050514 | Bacteria | 11514 |
| 653 | nmdc:mga08x19_516_c1 | 3300050514 | Bacteria | 25703 |
| 654 | nmdc:mga0a205_22694_c1 | 3300050515 | Bacteria | 5949 |
| 655 | nmdc:mga0a205_73076_c1 | 3300050515 | Bacteria | 3314 |
| 656 | nmdc:mga0a205_8671_c1 | 3300050515 | Bacteria | 9257 |
| 657 | Ga0500555_000008 | 3300053103 | Bacteria | 282333 |
| 658 | Ga0500595_000061 | 3300053119 | Bacteria | 78756 |
| 659 | Ga0500608_000370 | 3300053122 | Bacteria | 17462 |
| 660 | Ga0500618_000002 | 3300053125 | Bacteria | 370822 |
| 661 | Ga0500616_0006347 | 3300053153 | Bacteria | 7758 |
| 662 | Ga0500624_000418 | 3300053157 | Bacteria | 13022 |
| 663 | Ga0501084_0000930 | 3300054114 | Bacteria | 22664 |
| 664 | Ga0501084_0008554 | 3300054114 | Bacteria | 8464 |
| 665 | Ga0501084_0023579 | 3300054114 | Bacteria | 5132 |
| 666 | Ga0501082_0004179 | 3300060353 | Bacteria | 12621 |
| 667 | Ga0501082_0019166 | 3300060353 | Bacteria | 5895 |
| 668 | Ga0501082_0039599 | 3300060353 | Bacteria | 4066 |
| 669 | Ga0530510_0000153 | 3300061734 | Bacteria | 41115 |
| 670 | Ga0530510_0000214 | 3300061734 | Bacteria | 35923 |
| 671 | Ga0530510_0007034 | 3300061734 | Bacteria | 7835 |
| 672 | Ga0530510_0013872 | 3300061734 | Bacteria | 5674 |
| 673 | 2522550013 | 2522125168 | Bacteria | 7376607 |
| 674 | 2599103852 | 2597490356 | Bacteria | 7030811 |
| 675 | 2599478547 | 2599185184 | Bacteria | 6430550 |
| 676 | 2842336997 | 2842333319 | Bacteria | 8899485 |
| 677 | 2846957540 | 2846952575 | Bacteria | 6587527 |
| 678 | 2895430460 | 2895427314 | Bacteria | 13147766 |
| 679 | 2911140936 | 2911138879 | Bacteria | 5811561 |
| 680 | 2919441241 | 2919437846 | Bacteria | 6199444 |
| 681 | 2928080399 | 2928078545 | Bacteria | 6534839 |
| 682 | 2928149428 | 2928147474 | Bacteria | 6512076 |
| 683 | 2932083258 | 2932082852 | Bacteria | 6563563 |
| 684 | 2989395000 | 2989392574 | Bacteria | 4554005 |
| 685 | 3003671422 | 3003665799 | Bacteria | 7279786 |
| 686 | Ga0065704_10070145 | |||
| 687 | SwRhRL2b_contig_1480143 | |||
| 688 | JGI24739J22299_10005528 | |||
| 689 | JGI24737J22298_10001133 | |||
| 690 | JGI24737J22298_10004156 | |||
| 691 | JGI24735J21928_10000002 | |||
| 692 | JGI25162J39368_1000024 | |||
| 693 | rootH2_10001891 | |||
| 694 | Ga0055536_1000004 | |||
| 695 | Ga0055530_10001262 | |||
| 696 | Ga0065165_1000037 | |||
| 697 | Ga0065703_1003925 | |||
| 698 | Ga0065714_10004171 | |||
| 699 | Ga0065707_10082117 | |||
| 700 | Ga0070658_10005434 | |||
| 701 | Ga0070676_10000160 | |||
| 702 | Ga0070676_10018176 | |||
| 703 | Ga0070683_100005599 | |||
| 704 | Ga0070683_100020924 | |||
| 705 | Ga0070690_100000702 | |||
| 706 | Ga0070690_100007338 | |||
| 707 | Ga0070690_100011943 | |||
| 708 | Ga0070690_100016864 | |||
| 709 | Ga0070670_100009602 | |||
| 710 | Ga0070670_100010551 | |||
| 711 | Ga0070670_100014933 | |||
| 712 | Ga0070670_100026904 | |||
| 713 | Ga0068869_100003675 | |||
| 714 | Ga0070666_10000854 | |||
| 715 | Ga0070666_10001111 | |||
| 716 | Ga0068868_100026670 | |||
| 717 | Ga0068868_100029360 | |||
| 718 | Ga0070660_100013779 | |||
| 719 | Ga0070689_100009825 | |||
| 720 | Ga0070661_100009103 | |||
| 721 | Ga0070668_100052062 | |||
| 722 | Ga0070669_100012476 | |||
| 723 | Ga0070669_100016039 | |||
| 724 | Ga0070669_100019301 | |||
| 725 | Ga0070675_100001610 | |||
| 726 | Ga0070675_100005707 | |||
| 727 | Ga0070671_100005720 | |||
| 728 | Ga0070674_100000862 | |||
| 729 | Ga0070673_100000282 | |||
| 730 | Ga0070673_100000903 | |||
| 731 | Ga0070673_100014179 | |||
| 732 | Ga0070659_100013242 | |||
| 733 | Ga0070667_100012467 | |||
| 734 | Ga0070714_100000274 | |||
| 735 | Ga0070713_100000293 | |||
| 736 | Ga0070713_100019246 | |||
| 737 | Ga0070694_100002857 | |||
| 738 | Ga0070663_100004792 | |||
| 739 | Ga0070678_100003462 | |||
| 740 | Ga0070678_100010911 | |||
| 741 | Ga0070662_100000019 | |||
| 742 | Ga0070681_10002224 | |||
| 743 | Ga0070681_10017958 | |||
| 744 | Ga0068867_100000157 | |||
| 745 | Ga0068867_100001826 | |||
| 746 | Ga0068867_100004091 | |||
| 747 | Ga0070685_10005598 | |||
| 748 | Ga0070685_10008680 | |||
| 749 | Ga0070706_100004648 | |||
| 750 | Ga0070706_100015645 | |||
| 751 | Ga0070706_100049068 | |||
| 752 | Ga0070707_100012674 | |||
| 753 | Ga0070698_100001047 | |||
| 754 | Ga0070698_100021884 | |||
| 755 | Ga0070699_100000127 | |||
| 756 | Ga0070699_100001378 | |||
| 757 | Ga0070699_100023859 | |||
| 758 | Ga0070699_100025408 | |||
| 759 | Ga0070699_100063898 | |||
| 760 | Ga0070679_100015481 | |||
| 761 | Ga0070679_100024392 | |||
| 762 | Ga0070684_100023895 | |||
| 763 | Ga0070684_100024882 | |||
| 764 | Ga0070684_100054813 | |||
| 765 | Ga0070697_100000001 | |||
| 766 | Ga0068853_100003128 | |||
| 767 | Ga0068853_100005775 | |||
| 768 | Ga0068853_100005891 | |||
| 769 | Ga0068853_100013349 | |||
| 770 | Ga0068853_100016874 | |||
| 771 | Ga0068853_100045928 | |||
| 772 | Ga0070672_100000046 | |||
| 773 | Ga0070672_100001000 | |||
| 774 | Ga0070672_100026834 | |||
| 775 | Ga0070686_100001060 | |||
| 776 | Ga0070686_100003156 | |||
| 777 | Ga0070686_100003394 | |||
| 778 | Ga0070665_100000020 | |||
| 779 | Ga0070665_100000875 | |||
| 780 | Ga0070665_100098526 | |||
| 781 | Ga0070704_100010558 | |||
| 782 | Ga0068855_100000404 | |||
| 783 | Ga0068855_100051595 | |||
| 784 | Ga0070664_100000421 | |||
| 785 | Ga0070664_100005325 | |||
| 786 | Ga0068856_100006981 | |||
| 787 | Ga0068856_100021007 | |||
| 788 | Ga0068856_100025995 | |||
| 789 | Ga0068856_100039844 | |||
| 790 | Ga0068856_100060389 | |||
| 791 | Ga0068852_100000401 | |||
| 792 | Ga0068852_100006163 | |||
| 793 | Ga0068859_100009684 | |||
| 794 | Ga0068859_100024372 | |||
| 795 | Ga0068864_100013029 | |||
| 796 | Ga0068866_10015501 | |||
| 797 | Ga0068861_100000695 | |||
| 798 | Ga0068851_10008019 | |||
| 799 | Ga0068863_100009166 | |||
| 800 | Ga0068858_100014974 | |||
| 801 | Ga0068860_100002752 | |||
| 802 | Ga0068860_100069025 | |||
| 803 | Ga0081455_10000767 | |||
| 804 | Ga0081455_10004662 | |||
| 805 | Ga0081455_10007638 | |||
| 806 | Ga0081455_10008430 | |||
| 807 | Ga0081538_10000014 | |||
| 808 | Ga0081538_10001734 | |||
| 809 | Ga0081540_1003073 | |||
| 810 | Ga0081540_1006684 | |||
| 811 | Ga0081540_1008337 | |||
| 812 | Ga0081540_1012506 | |||
| 813 | Ga0081539_10004447 | |||
| 814 | Ga0081539_10010566 | |||
| 815 | Ga0070717_10001566 | |||
| 816 | Ga0070717_10013887 | |||
| 817 | Ga0075364_10004697 | |||
| 818 | Ga0075367_10000361 | |||
| 819 | Ga0075367_10002404 | |||
| 820 | Ga0075366_10001320 | |||
| 821 | Ga0075366_10001384 | |||
| 822 | Ga0075366_10008593 | |||
| 823 | Ga0097621_100000124 | |||
| 824 | Ga0097621_100002950 | |||
| 825 | Ga0097621_100005963 | |||
| 826 | Ga0097621_100017727 | |||
| 827 | Ga0097621_100023180 | |||
| 828 | Ga0068871_100000160 | |||
| 829 | Ga0068871_100002195 | |||
| 830 | Ga0068871_100006247 | |||
| 831 | Ga0075428_100002510 | |||
| 832 | Ga0075428_100017570 | |||
| 833 | Ga0075428_100019879 | |||
| 834 | Ga0075428_100034759 | |||
| 835 | Ga0075430_100002055 | |||
| 836 | Ga0075430_100006605 | |||
| 837 | Ga0075430_100031761 | |||
| 838 | Ga0075430_100038235 | |||
| 839 | Ga0075431_100000709 | |||
| 840 | Ga0075433_10000186 | |||
| 841 | Ga0075433_10002084 | |||
| 842 | Ga0075433_10029559 | |||
| 843 | Ga0075434_100000802 | |||
| 844 | Ga0075434_100004024 | |||
| 845 | Ga0075434_100005613 | |||
| 846 | Ga0075434_100009429 | |||
| 847 | Ga0075434_100029103 | |||
| 848 | Ga0075434_100050482 | |||
| 849 | Ga0075429_100001356 | |||
| 850 | Ga0075429_100002113 | |||
| 851 | Ga0075429_100003581 | |||
| 852 | Ga0075429_100056605 | |||
| 853 | Ga0068865_100001563 | |||
| 854 | Ga0068865_100012442 | |||
| 855 | Ga0075436_100000550 | |||
| 856 | Ga0075436_100005582 | |||
| 857 | Ga0097620_100009683 | |||
| 858 | Ga0097620_100024372 | |||
| 859 | Ga0075435_100004510 | |||
| 860 | Ga0075435_100020123 | |||
| 861 | Ga0075435_100035510 | |||
| 862 | Ga0105251_10014719 | |||
| 863 | Ga0105240_10000029 | |||
| 864 | Ga0105240_10001462 | |||
| 865 | Ga0105240_10013815 | |||
| 866 | Ga0105240_10027916 | |||
| 867 | Ga0105240_10089131 | |||
| 868 | Ga0105240_10111460 | |||
| 869 | Ga0111539_10000059 | |||
| 870 | Ga0111539_10000298 | |||
| 871 | Ga0111539_10000763 | |||
| 872 | Ga0111539_10001199 | |||
| 873 | Ga0111539_10004669 | |||
| 874 | Ga0111539_10022794 | |||
| 875 | Ga0111539_10022882 | |||
| 876 | Ga0105245_10003376 | |||
| 877 | Ga0105245_10004148 | |||
| 878 | Ga0105245_10058315 | |||
| 879 | Ga0114129_10002822 | |||
| 880 | Ga0114129_10005228 | |||
| 881 | Ga0114129_10023218 | |||
| 882 | Ga0114129_10025822 | |||
| 883 | Ga0114129_10038787 | |||
| 884 | Ga0114129_10043075 | |||
| 885 | Ga0114129_10114403 | |||
| 886 | Ga0105243_10027406 | |||
| 887 | Ga0105241_10000323 | |||
| 888 | Ga0105241_10001215 | |||
| 889 | Ga0105241_10021637 | |||
| 890 | Ga0105242_10019792 | |||
| 891 | Ga0105248_10004221 | |||
| 892 | Ga0105248_10012046 | |||
| 893 | Ga0105248_10016499 | |||
| 894 | Ga0105248_10030054 | |||
| 895 | Ga0105248_10049754 | |||
| 896 | Ga0105237_10000062 | |||
| 897 | Ga0105237_10000219 | |||
| 898 | Ga0105237_10002584 | |||
| 899 | Ga0105237_10002998 | |||
| 900 | Ga0105237_10005656 | |||
| 901 | Ga0105237_10005711 | |||
| 902 | Ga0105237_10015601 | |||
| 903 | Ga0105237_10021799 | |||
| 904 | Ga0105237_10024243 | |||
| 905 | Ga0105238_10000714 | |||
| 906 | Ga0105238_10030659 | |||
| 907 | Ga0105238_10033754 | |||
| 908 | Ga0105238_10087738 | |||
| 909 | Ga0105239_10000062 | |||
| 910 | Ga0105239_10001911 | |||
| 911 | Ga0105239_10009207 | |||
| 912 | Ga0157373_10004651 | |||
| 913 | Ga0157373_10025398 | |||
| 914 | Ga0157371_10000250 | |||
| 915 | Ga0157371_10008880 | |||
| 916 | Ga0157371_10019548 | |||
| 917 | Ga0157371_10025064 | |||
| 918 | Ga0157371_10034029 | |||
| 919 | Ga0157370_10015449 | |||
| 920 | Ga0157370_10015939 | |||
| 921 | Ga0157370_10030331 | |||
| 922 | Ga0157369_10001633 | |||
| 923 | Ga0157369_10025494 | |||
| 924 | Ga0157369_10045208 | |||
| 925 | Ga0157369_10046209 | |||
| 926 | Ga0157369_10071901 | |||
| 927 | Ga0157369_10085262 | |||
| 928 | Ga0157374_10000746 | |||
| 929 | Ga0157374_10001502 | |||
| 930 | Ga0157374_10027248 | |||
| 931 | Ga0157374_10041996 | |||
| 932 | Ga0157378_10000103 | |||
| 933 | Ga0157378_10000578 | |||
| 934 | Ga0157378_10001933 | |||
| 935 | Ga0157378_10002021 | |||
| 936 | Ga0157378_10012406 | |||
| 937 | Ga0157378_10012886 | |||
| 938 | Ga0157378_10014126 | |||
| 939 | Ga0163162_10000083 | |||
| 940 | Ga0163162_10013909 | |||
| 941 | Ga0163162_10026296 | |||
| 942 | Ga0163162_10067945 | |||
| 943 | Ga0157372_10002437 | |||
| 944 | Ga0157372_10003802 | |||
| 945 | Ga0157372_10028804 | |||
| 946 | Ga0157372_10082344 | |||
| 947 | Ga0157375_10002741 | |||
| 948 | Ga0163163_10000022 | |||
| 949 | Ga0163163_10022617 | |||
| 950 | Ga0163163_10065412 | |||
| 951 | Ga0157380_10001679 | |||
| 952 | Ga0157380_10020389 | |||
| 953 | Ga0157379_10014452 | |||
| 954 | Ga0157376_10004159 | |||
| 955 | Ga0157376_10019391 | |||
| 956 | Ga0163161_10003396 | |||
| 957 | Ga0163161_10013161 | |||
| 958 | Ga0213872_10010134 | |||
| 959 | Ga0213874_10000160 | |||
| 960 | Ga0213874_10001399 | |||
| 961 | Ga0213876_10000716 | |||
| 962 | Ga0213876_10017469 | |||
| 963 | Ga0213875_10000008 | |||
| 964 | Ga0213875_10000575 | |||
| 965 | Ga0213875_10004666 | |||
| 966 | Ga0213875_10016306 | |||
| 967 | Ga0209437_100017 | |||
| 968 | Ga0209676_1000009 | |||
| 969 | Ga0209676_1001142 | |||
| 970 | Ga0209050_1000048 | |||
| 971 | Ga0207697_10001618 | |||
| 972 | Ga0207655_1000006 | |||
| 973 | Ga0207682_10000683 | |||
| 974 | Ga0207642_10004342 | |||
| 975 | Ga0207647_10001006 | |||
| 976 | Ga0207647_10005268 | |||
| 977 | Ga0207645_10001043 | |||
| 978 | Ga0207645_10001053 | |||
| 979 | Ga0207645_10005809 | |||
| 980 | Ga0207643_10004136 | |||
| 981 | Ga0207705_10008618 | |||
| 982 | Ga0207684_10013251 | |||
| 983 | Ga0207684_10034071 | |||
| 984 | Ga0207684_10042077 | |||
| 985 | Ga0207684_10048083 | |||
| 986 | Ga0207654_10000217 | |||
| 987 | Ga0207654_10019976 | |||
| 988 | Ga0207695_10000034 | |||
| 989 | Ga0207695_10001628 | |||
| 990 | Ga0207695_10013733 | |||
| 991 | Ga0207671_10000140 | |||
| 992 | Ga0207671_10000250 | |||
| 993 | Ga0207671_10000951 | |||
| 994 | Ga0207671_10001128 | |||
| 995 | Ga0207671_10005846 | |||
| 996 | Ga0207671_10013546 | |||
| 997 | Ga0207671_10014302 | |||
| 998 | Ga0207693_10003151 | |||
| 999 | Ga0207663_10020792 | |||
| 1000 | Ga0207662_10009849 | |||
| 1001 | Ga0207657_10011844 | |||
| 1002 | Ga0207657_10049712 | |||
| 1003 | Ga0207652_10011392 | |||
| 1004 | Ga0207646_10014010 | |||
| 1005 | Ga0207694_10000201 | |||
| 1006 | Ga0207694_10009343 | |||
| 1007 | Ga0207694_10033150 | |||
| 1008 | Ga0207650_10006006 | |||
| 1009 | Ga0207650_10022164 | |||
| 1010 | Ga0207659_10015019 | |||
| 1011 | Ga0207659_10025073 | |||
| 1012 | Ga0207687_10020397 | |||
| 1013 | Ga0207700_10009430 | |||
| 1014 | Ga0207644_10007547 | |||
| 1015 | Ga0207644_10021060 | |||
| 1016 | Ga0207644_10035215 | |||
| 1017 | Ga0207706_10000058 | |||
| 1018 | Ga0207706_10000968 | |||
| 1019 | Ga0207706_10008173 | |||
| 1020 | Ga0207706_10017962 | |||
| 1021 | Ga0207709_10025704 | |||
| 1022 | Ga0207704_10000135 | |||
| 1023 | Ga0207691_10000274 | |||
| 1024 | Ga0207711_10004963 | |||
| 1025 | Ga0207711_10010971 | |||
| 1026 | Ga0207711_10013816 | |||
| 1027 | Ga0207689_10000460 | |||
| 1028 | Ga0207689_10007207 | |||
| 1029 | Ga0207661_10023531 | |||
| 1030 | Ga0207661_10035690 | |||
| 1031 | Ga0207679_10006255 | |||
| 1032 | Ga0207667_10000474 | |||
| 1033 | Ga0207667_10007872 | |||
| 1034 | Ga0207667_10016629 | |||
| 1035 | Ga0207667_10034268 | |||
| 1036 | Ga0207667_10049699 | |||
| 1037 | Ga0207667_10066274 | |||
| 1038 | Ga0207651_10000435 | |||
| 1039 | Ga0207651_10004269 | |||
| 1040 | Ga0207640_10016744 | |||
| 1041 | Ga0207658_10008617 | |||
| 1042 | Ga0207677_10011615 | |||
| 1043 | Ga0207703_10036818 | |||
| 1044 | Ga0207639_10000059 | |||
| 1045 | Ga0207639_10003795 | |||
| 1046 | Ga0207639_10007316 | |||
| 1047 | Ga0207639_10023757 | |||
| 1048 | Ga0207678_10003949 | |||
| 1049 | Ga0207708_10006550 | |||
| 1050 | Ga0207708_10035161 | |||
| 1051 | Ga0207702_10002237 | |||
| 1052 | Ga0207702_10012718 | |||
| 1053 | Ga0207702_10017513 | |||
| 1054 | Ga0207641_10009835 | |||
| 1055 | Ga0207641_10028103 | |||
| 1056 | Ga0207648_10000275 | |||
| 1057 | Ga0207648_10003356 | |||
| 1058 | Ga0207648_10005143 | |||
| 1059 | Ga0207648_10006458 | |||
| 1060 | Ga0207676_10014130 | |||
| 1061 | Ga0207674_10000413 | |||
| 1062 | Ga0207674_10023660 | |||
| 1063 | Ga0207675_100002914 | |||
| 1064 | Ga0207683_10000078 | |||
| 1065 | Ga0207698_10000202 | |||
| 1066 | Ga0207698_10005206 | |||
| 1067 | Ga0207428_10000066 | |||
| 1068 | Ga0207428_10000253 | |||
| 1069 | Ga0207428_10000753 | |||
| 1070 | Ga0207428_10001158 | |||
| 1071 | Ga0207428_10002348 | |||
| 1072 | Ga0207428_10012489 | |||
| 1073 | Ga0265356_1000878 | |||
| 1074 | Ga0268266_10000018 | |||
| 1075 | Ga0268266_10001104 | |||
| 1076 | Ga0268266_10003557 | |||
| 1077 | Ga0268265_10007215 | |||
| 1078 | Ga0268264_10023900 | |||
| 1079 | Ga0268264_10033961 | |||
| 1080 | Ga0265319_1000568 | |||
| 1081 | Ga0265319_1001513 | |||
| 1082 | Ga0265334_10002734 | |||
| 1083 | Ga0265318_10000177 | |||
| 1084 | Ga0265318_10009320 | |||
| 1085 | Ga0307517_10020409 | |||
| 1086 | Ga0307515_10000432 | |||
| 1087 | Ga0307515_10002380 | |||
| 1088 | Ga0307515_10009167 | |||
| 1089 | Ga0265338_10000064 | |||
| 1090 | Ga0265338_10001461 | |||
| 1091 | Ga0265338_10007889 | |||
| 1092 | Ga0265338_10018515 | |||
| 1093 | Ga0265338_10031787 | |||
| 1094 | Ga0265324_10000700 | |||
| 1095 | Ga0265760_10000709 | |||
| 1096 | Ga0265330_10000905 | |||
| 1097 | Ga0265332_10000169 | |||
| 1098 | Ga0265332_10000386 | |||
| 1099 | Ga0265332_10005881 | |||
| 1100 | Ga0265328_10007617 | |||
| 1101 | Ga0265320_10001302 | |||
| 1102 | Ga0265320_10016372 | |||
| 1103 | Ga0265329_10000042 | |||
| 1104 | Ga0265340_10003855 | |||
| 1105 | Ga0265339_10001025 | |||
| 1106 | Ga0265331_10000117 | |||
| 1107 | Ga0265331_10001952 | |||
| 1108 | Ga0265316_10000031 | |||
| 1109 | Ga0265316_10003028 | |||
| 1110 | Ga0265316_10049735 | |||
| 1111 | Ga0307509_10012358 | |||
| 1112 | Ga0307408_100004766 | |||
| 1113 | Ga0265313_10001541 | |||
| 1114 | Ga0265313_10002676 | |||
| 1115 | Ga0265313_10013040 | |||
| 1116 | Ga0265313_10020776 | |||
| 1117 | Ga0307508_10003774 | |||
| 1118 | Ga0316575_10002167 | |||
| 1119 | Ga0265314_10000183 | |||
| 1120 | Ga0265314_10003487 | |||
| 1121 | Ga0265314_10004880 | |||
| 1122 | Ga0265342_10000199 | |||
| 1123 | Ga0265342_10000869 | |||
| 1124 | Ga0316576_10006030 | |||
| 1125 | Ga0316576_10043509 | |||
| 1126 | Ga0316578_10007781 | |||
| 1127 | Ga0307516_10006229 | |||
| 1128 | Ga0307409_100027562 | |||
| 1129 | Ga0307416_100021502 | |||
| 1130 | Ga0316585_10006113 | |||
| 1131 | Ga0307507_10001092 | |||
| 1132 | Ga0307507_10002761 | |||
| 1133 | Ga0307510_10001317 | |||
| 1134 | Ga0373926_0000012 | |||
| 1135 | Ga0373926_0000044 | |||
| 1136 | Ga0373926_0000807 | |||
| 1137 | Ga0373949_0000055 | |||
| 1138 | Ga0373943_0000147 | |||
| 1139 | Ga0373943_0000950 | |||
| 1140 | Ga0373955_0025808 | |||
| 1141 | Ga0316574_0000052 | |||
| 1142 | Ga0373935_0003782 | |||
| 1143 | Ga0373927_0000302 | |||
| 1144 | Ga0373927_0000357 | |||
| 1145 | Ga0373927_0002350 | |||
| 1146 | Ga0373947_0000283 | |||
| 1147 | Ga0373947_0005503 | |||
| 1148 | Ga0373937_0000117 | |||
| 1149 | Ga0373937_0017949 | |||
| 1150 | Ga0373937_0036587 | |||
| 1151 | Ga0373937_0067782 | |||
| 1152 | Ga0316582_0000166 | |||
| 1153 | Ga0316584_0007826 | |||
| 1154 | Ga0373925_0000225 | |||
| 1155 | Ga0373925_0001747 | |||
| 1156 | Ga0373925_0012787 | |||
| 1157 | Ga0395899_0000001 | |||
| 1158 | Ga0395899_0000232 | |||
| 1159 | Ga0395899_0001442 | |||
| 1160 | Ga0395900_0000517 | |||
| 1161 | Ga0395900_0001891 | |||
| 1162 | Ga0395900_0078499 | |||
| 1163 | Ga0395898_0008170 | |||
| 1164 | Ga0395905_0008935 | |||
| 1165 | Ga0395905_0015572 | |||
| 1166 | Ga0316581_0004132 | |||
| 1167 | Ga0436364_0719353 | |||
| 1168 | Ga0436364_0909399 | |||
| 1169 | Ga0436364_1008502 | |||
| 1170 | Ga0436364_1259742 | |||
| 1171 | Ga0436364_1310913 | |||
| 1172 | Ga0436364_1393295 | |||
| 1173 | Ga0436364_1415525 | |||
| 1174 | Ga0436364_1421630 | |||
| 1175 | Ga0395901_0001035 | |||
| 1176 | Ga0400488_59865 | |||
| 1177 | Ga0436365_0042253 | |||
| 1178 | Ga0436365_0292949 | |||
| 1179 | Ga0436365_0886091 | |||
| 1180 | Ga0436365_0957937 | |||
| 1181 | Ga0436360_0213572 | |||
| 1182 | Ga0436360_1078765 | |||
| 1183 | Ga0436361_0046678 | |||
| 1184 | Ga0436361_0403733 | |||
| 1185 | Ga0436361_0738714 | |||
| 1186 | Ga0436361_1164749 | |||
| 1187 | Ga0436363_0172570 | |||
| 1188 | Ga0436363_0507032 | |||
| 1189 | Ga0436363_0573267 | |||
| 1190 | Ga0436363_1495906 | |||
| 1191 | Ga0436362_0555205 | |||
| 1192 | Ga0436362_0688989 | |||
| 1193 | Ga0451577_0000583 | |||
| 1194 | Ga0451577_0003269 | |||
| 1195 | Ga0451577_0033220 | |||
| 1196 | Ga0453684_0000841 | |||
| 1197 | Ga0453684_0002278 | |||
| 1198 | Ga0453684_0009932 | |||
| 1199 | Ga0453684_0075714 | |||
| 1200 | Ga0451576_0000191 | |||
| 1201 | Ga0451576_0003755 | |||
| 1202 | Ga0451576_0005819 | |||
| 1203 | Ga0495650_0000003 | |||
| 1204 | Ga0495580_0003375 | |||
| 1205 | Ga0495580_0026941 | |||
| 1206 | Ga0495582_0004962 | |||
| 1207 | Ga0495582_0029851 | |||
| 1208 | Ga0495585_0000470 | |||
| 1209 | Ga0495585_0001492 | |||
| 1210 | Ga0495585_0013845 | |||
| 1211 | Ga0495594_0002318 | |||
| 1212 | Ga0495606_0002345 | |||
| 1213 | Ga0495606_0018132 | |||
| 1214 | Ga0495606_0052490 | |||
| 1215 | Ga0495610_0002357 | |||
| 1216 | Ga0495610_0002626 | |||
| 1217 | Ga0495610_0003108 | |||
| 1218 | Ga0495628_0025165 | |||
| 1219 | Ga0495630_0000583 | |||
| 1220 | Ga0495630_0002677 | |||
| 1221 | Ga0495630_0028069 | |||
| 1222 | Ga0495631_0007485 | |||
| 1223 | Ga0495637_0018362 | |||
| 1224 | Ga0495644_0000055 | |||
| 1225 | Ga0495652_0049119 | |||
| 1226 | Ga0495609_0012695 | |||
| 1227 | Ga0495633_0000014 | |||
| 1228 | Ga0495633_0004016 | |||
| 1229 | Ga0495668_0000003 | |||
| 1230 | Ga0495625_0000219 | |||
| 1231 | Ga0495625_0000248 | |||
| 1232 | Ga0495625_0004001 | |||
| 1233 | Ga0495661_0001961 | |||
| 1234 | Ga0495661_0035364 | |||
| 1235 | Ga0495588_0000001 | |||
| 1236 | Ga0495649_0000037 | |||
| 1237 | Ga0495660_0007425 | |||
| 1238 | Ga0495687_000942 | |||
| 1239 | Ga0495687_018101 | |||
| 1240 | Ga0495684_0001768 | |||
| 1241 | Ga0495686_0000264 | |||
| 1242 | Ga0495602_0007513 | |||
| 1243 | Ga0496101_0016026 | |||
| 1244 | Ga0496102_0004825 | |||
| 1245 | Ga0496104_0002107 | |||
| 1246 | Ga0496104_0004026 | |||
| 1247 | Ga0496104_0009366 | |||
| 1248 | Ga0496106_0025262 | |||
| 1249 | Ga0496110_0065775 | |||
| 1250 | Ga0496111_0002881 | |||
| 1251 | Ga0496111_0005566 | |||
| 1252 | Ga0496112_0049285 | |||
| 1253 | Ga0496112_0096597 | |||
| 1254 | Ga0496112_0119973 | |||
| 1255 | Ga0496113_0001502 | |||
| 1256 | Ga0496114_0002337 | |||
| 1257 | Ga0496114_0018040 | |||
| 1258 | Ga0496115_0011538 | |||
| 1259 | Ga0496115_0022588 | |||
| 1260 | Ga0501032_0039727 | |||
| 1261 | Ga0501033_0025418 | |||
| 1262 | Ga0501034_0007570 | |||
| 1263 | Ga0501036_0000593 | |||
| 1264 | Ga0501038_0002658 | |||
| 1265 | Ga0501041_0006893 | |||
| 1266 | Ga0501041_0010676 | |||
| 1267 | Ga0501042_0003168 | |||
| 1268 | Ga0501042_0005677 | |||
| 1269 | Ga0501042_0034052 | |||
| 1270 | Ga0501047_0013859 | |||
| 1271 | Ga0501047_0017503 | |||
| 1272 | Ga0501068_0005764 | |||
| 1273 | Ga0501070_0007263 | |||
| 1274 | Ga0501072_0000549 | |||
| 1275 | Ga0501072_0008834 | |||
| 1276 | Ga0501073_0021126 | |||
| 1277 | Ga0501075_0000014 | |||
| 1278 | Ga0501075_0000136 | |||
| 1279 | Ga0501075_0026732 | |||
| 1280 | Ga0501076_0000016 | |||
| 1281 | Ga0501076_0000072 | |||
| 1282 | Ga0501076_0013423 | |||
| 1283 | Ga0501079_0001520 | |||
| 1284 | Ga0501079_0005299 | |||
| 1285 | Ga0501080_0006644 | |||
| 1286 | Ga0501080_0020084 | |||
| 1287 | Ga0501080_0025090 | |||
| 1288 | Ga0501081_0026494 | |||
| 1289 | Ga0501083_0001033 | |||
| 1290 | Ga0501083_0029764 | |||
| 1291 | Ga0501044_0000235 | |||
| 1292 | Ga0501044_0002405 | |||
| 1293 | Ga0501044_0022588 | |||
| 1294 | nmdc:mga00v17_2275_c1 | |||
| 1295 | nmdc:mga00v17_2693_c1 | |||
| 1296 | nmdc:mga0k408_1228_c1 | |||
| 1297 | nmdc:mga0k408_1402_c1 | |||
| 1298 | nmdc:mga0k408_19032_c1 | |||
| 1299 | nmdc:mga0k408_9140_c1 | |||
| 1300 | nmdc:mga06z11_739_c1 | |||
| 1301 | nmdc:mga06z11_7621_c1 | |||
| 1302 | nmdc:mga05p37_19278_c1 | |||
| 1303 | nmdc:mga05p37_27947_c1 | |||
| 1304 | nmdc:mga05p37_2963_c1 | |||
| 1305 | nmdc:mga05p37_29951_c1 | |||
| 1306 | nmdc:mga05p37_3891_c1 | |||
| 1307 | nmdc:mga05p37_46198_c1 | |||
| 1308 | nmdc:mga05p37_8551_c1 | |||
| 1309 | nmdc:mga05p37_99468_c1 | |||
| 1310 | nmdc:mga09592_1969_c1 | |||
| 1311 | nmdc:mga09592_37019_c1 | |||
| 1312 | nmdc:mga09592_534_c2 | |||
| 1313 | nmdc:mga09592_6313_c1 | |||
| 1314 | nmdc:mga09592_6474_c1 | |||
| 1315 | nmdc:mga09592_868_c1 | |||
| 1316 | nmdc:mga0qj67_1220_c1 | |||
| 1317 | nmdc:mga0qj67_15_c3 | |||
| 1318 | nmdc:mga0qj67_20011_c1 | |||
| 1319 | nmdc:mga0qj67_21054_c1 | |||
| 1320 | nmdc:mga0qj67_531_c1 | |||
| 1321 | nmdc:mga06r32_2168_c1 | |||
| 1322 | nmdc:mga06r32_222_c1 | |||
| 1323 | nmdc:mga06r32_447_c1 | |||
| 1324 | nmdc:mga08y16_1066_c1 | |||
| 1325 | nmdc:mga08y16_150_c1 | |||
| 1326 | nmdc:mga08y16_252_c1 | |||
| 1327 | nmdc:mga08y16_3079_c1 | |||
| 1328 | nmdc:mga08y16_340_c1 | |||
| 1329 | nmdc:mga08y16_4051_c1 | |||
| 1330 | nmdc:mga0n895_11451_c1 | |||
| 1331 | nmdc:mga0n895_54365_c1 | |||
| 1332 | nmdc:mga0n895_783_c1 | |||
| 1333 | nmdc:mga0rr50_320_c1 | |||
| 1334 | nmdc:mga0rr50_3738_c1 | |||
| 1335 | nmdc:mga0rr50_42643_c1 | |||
| 1336 | nmdc:mga0rr50_6553_c1 | |||
| 1337 | nmdc:mga08x19_2334_c1 | |||
| 1338 | nmdc:mga08x19_516_c1 | |||
| 1339 | nmdc:mga0a205_22694_c1 | |||
| 1340 | nmdc:mga0a205_73076_c1 | |||
| 1341 | nmdc:mga0a205_8671_c1 | |||
| 1342 | Ga0500555_000008 | |||
| 1343 | Ga0500595_000061 | |||
| 1344 | Ga0500608_000370 | |||
| 1345 | Ga0500618_000002 | |||
| 1346 | Ga0500616_0006347 | |||
| 1347 | Ga0500624_000418 | |||
| 1348 | Ga0501084_0000930 | |||
| 1349 | Ga0501084_0008554 | |||
| 1350 | Ga0501084_0023579 | |||
| 1351 | Ga0501082_0004179 | |||
| 1352 | Ga0501082_0019166 | |||
| 1353 | Ga0501082_0039599 | |||
| 1354 | Ga0530510_0000153 | |||
| 1355 | Ga0530510_0000214 | |||
| 1356 | Ga0530510_0007034 | |||
| 1357 | Ga0530510_0013872 | |||
| 1358 | 2522550013 | |||
| 1359 | 2599103852 | |||
| 1360 | 2599478547 | |||
| 1361 | 2842336997 | |||
| 1362 | 2846957540 | |||
| 1363 | 2895430460 | |||
| 1364 | 2911140936 | |||
| 1365 | 2919441241 | |||
| 1366 | 2928080399 | |||
| 1367 | 2928149428 | |||
| 1368 | 2932083258 | |||
| 1369 | 2989395000 | |||
| 1370 | 3003671422 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ekn-assembly2.cif.gz_B | co-crystal structure of chaetomium glucosidase with compound 15 | 0.6583 | 9 | 896 |
| 8ehp-assembly2.cif.gz_B | co-crystal structure of chaetomium glucosidase with compound 13 | 0.6546 | 9 | 896 |
| 8egv-assembly1.cif.gz_A | co-crystal structure of chaetomium glucosidase with compound 12 | 0.6545 | 9 | 896 |
| 8ekn-assembly2.cif.gz_B | co-crystal structure of chaetomium glucosidase with compound 15 | 0.6511 | 9 | 896 |
| 8egv-assembly1.cif.gz_A | co-crystal structure of chaetomium glucosidase with compound 12 | 0.649 | 9 | 896 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5AED0_9_368_2.70.98.40 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Glycoside hydrolase, family 65, N-terminal domain | 0.9898 | 9 | 369 | 2.70.98.40 |
| af_Q5AED0_9_368_2.70.98.40 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Glycoside hydrolase, family 65, N-terminal domain | 0.9844 | 9 | 369 | 2.70.98.40 |
| af_Q5AED0_433_891_1.50.10.10 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.969 | 434 | 894 | 1.50.10.10 |
| af_Q5AED0_433_891_1.50.10.10 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.9669 | 434 | 894 | 1.50.10.10 |
| af_Q04336_455_722_1.50.10.10 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.9338 | 415 | 678 | 1.50.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G1K036-F1-model_v4 | Glycoside hydrolase family 63 protein | 0.9933 | 385 | 504 |
GO:0004573
GO:0009311 |
| AF-A0A0U5FN31-F1-model_v4 | Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Glucosidase I) | 0.991 | 6 | 524 |
GO:0004573
GO:0005789 GO:0006487 GO:0009311 |
| AF-A0A7C1VH85-F1-model_v4 | Glucosidase | 0.9879 | 714 | 897 |
GO:0004573
GO:0009311 |
| AF-C5M322-F1-model_v4 | Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Glucosidase I) | 0.9861 | 8 | 540 |
GO:0004573
GO:0005789 GO:0006487 GO:0009311 |
| AF-A0A354BKL4-F1-model_v4 | Glucosidase | 0.9861 | 714 | 899 |
GO:0004573
GO:0009311 |