F475108
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 685 | 268 | 685 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100334466|Ga0070708_1003344662 |
| Length | 228 |
| Sequence | LPVRPSAKRGRRPEGFARRNRVDECVRRYVVRDGGVKLIVGLGNPGIEYQFTPHNLGFLAIDRIAGDLGIEVRNRQCRALTARAEIENVPVLLAKPETYMNLSGLSVGELVRKHDLKPESDLIVIQDELDFPLGTLRIHTRRSSAGHNGIESIIGALGRKDFLRIRIGVAPERKVEDGERYLLSPLRKAQLKVVDGMLDTAEEAVKMILKEGPAAAMNRFNRKEESSQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 109 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 110 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 111 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 113 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 184 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 186 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.66 |
| Metatranscriptomes | 2.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.4 |
| Rhizosphere | 93.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000260 | 3300000546 | Bacteria | 9129 |
| 2 | JGI24752J21851_1003237 | 3300001976 | Bacteria | 2148 |
| 3 | JGI24737J22298_10112947 | 3300001990 | Bacteria | 803 |
| 4 | JGI24749J21850_1009599 | 3300002076 | Unclassified | 1352 |
| 5 | JGI24751J29686_10000764 | 3300002459 | Bacteria | 7574 |
| 6 | Ga0065712_10304804 | 3300005290 | Bacteria | 833 |
| 7 | Ga0065715_10134981 | 3300005293 | Bacteria | 1945 |
| 8 | Ga0065715_10158482 | 3300005293 | Bacteria | 1652 |
| 9 | Ga0070658_10754492 | 3300005327 | Unclassified | 845 |
| 10 | Ga0070676_10046894 | 3300005328 | Bacteria | 2521 |
| 11 | Ga0070683_100005649 | 3300005329 | Bacteria | 10448 |
| 12 | Ga0070683_100407720 | 3300005329 | Bacteria | 1296 |
| 13 | Ga0070690_100061327 | 3300005330 | Unclassified | 2422 |
| 14 | Ga0070690_100272973 | 3300005330 | Bacteria | 1203 |
| 15 | Ga0070670_100194552 | 3300005331 | Bacteria | 1762 |
| 16 | Ga0070670_100338078 | 3300005331 | Bacteria | 1321 |
| 17 | Ga0070670_100380499 | 3300005331 | Bacteria | 1243 |
| 18 | Ga0070677_10239818 | 3300005333 | Unclassified | 895 |
| 19 | Ga0068869_100074119 | 3300005334 | Bacteria | 2526 |
| 20 | Ga0068869_100624253 | 3300005334 | Bacteria | 912 |
| 21 | Ga0068869_100689783 | 3300005334 | Bacteria | 870 |
| 22 | Ga0070680_100506119 | 3300005336 | Unclassified | 1033 |
| 23 | Ga0068868_100004556 | 3300005338 | Bacteria | 9730 |
| 24 | Ga0068868_100096044 | 3300005338 | Bacteria | 2393 |
| 25 | Ga0068868_100355108 | 3300005338 | Bacteria | 1256 |
| 26 | Ga0068868_100743530 | 3300005338 | Unclassified | 881 |
| 27 | Ga0070660_100067840 | 3300005339 | Bacteria | 2779 |
| 28 | Ga0070660_100151726 | 3300005339 | Bacteria | 1863 |
| 29 | Ga0070689_100010090 | 3300005340 | Bacteria | 6724 |
| 30 | Ga0070689_100063235 | 3300005340 | Bacteria | 2880 |
| 31 | Ga0070687_100317222 | 3300005343 | Bacteria | 994 |
| 32 | Ga0070661_100012749 | 3300005344 | Bacteria | 5884 |
| 33 | Ga0070661_100057378 | 3300005344 | Bacteria | 2853 |
| 34 | Ga0070692_10472005 | 3300005345 | Unclassified | 807 |
| 35 | Ga0070668_100005025 | 3300005347 | Bacteria | 9796 |
| 36 | Ga0070668_100418056 | 3300005347 | Unclassified | 1147 |
| 37 | Ga0070669_100511106 | 3300005353 | Unclassified | 997 |
| 38 | Ga0070669_100651046 | 3300005353 | Bacteria | 886 |
| 39 | Ga0070675_100059776 | 3300005354 | Bacteria | 3145 |
| 40 | Ga0070675_100130904 | 3300005354 | Bacteria | 2138 |
| 41 | Ga0070675_100584183 | 3300005354 | Bacteria | 1012 |
| 42 | Ga0070675_100666770 | 3300005354 | Bacteria | 946 |
| 43 | Ga0070674_100220028 | 3300005356 | Bacteria | 1477 |
| 44 | Ga0070688_100187917 | 3300005365 | Bacteria | 1437 |
| 45 | Ga0070659_100004220 | 3300005366 | Bacteria | 10260 |
| 46 | Ga0070667_100011429 | 3300005367 | Bacteria | 7341 |
| 47 | Ga0070667_100073367 | 3300005367 | Bacteria | 2918 |
| 48 | Ga0070667_100730903 | 3300005367 | Unclassified | 917 |
| 49 | Ga0070709_10007118 | 3300005434 | Bacteria | 6122 |
| 50 | Ga0070709_10010494 | 3300005434 | Bacteria | 5133 |
| 51 | Ga0070709_10010869 | 3300005434 | Bacteria | 5054 |
| 52 | Ga0070709_10046772 | 3300005434 | Bacteria | 2692 |
| 53 | Ga0070709_10049158 | 3300005434 | Unclassified | 2635 |
| 54 | Ga0070709_10100077 | 3300005434 | Unclassified | 1930 |
| 55 | Ga0070709_10455055 | 3300005434 | Bacteria | 965 |
| 56 | Ga0070714_100000046 | 3300005435 | Bacteria | 113150 |
| 57 | Ga0070714_100002862 | 3300005435 | Bacteria | 12763 |
| 58 | Ga0070714_100010217 | 3300005435 | Bacteria | 7410 |
| 59 | Ga0070714_100059470 | 3300005435 | Unclassified | 3277 |
| 60 | Ga0070714_100746881 | 3300005435 | Bacteria | 946 |
| 61 | Ga0070713_100000057 | 3300005436 | Bacteria | 70266 |
| 62 | Ga0070713_100000583 | 3300005436 | Bacteria | 23153 |
| 63 | Ga0070713_100003196 | 3300005436 | Bacteria | 10785 |
| 64 | Ga0070713_100024512 | 3300005436 | Bacteria | 4700 |
| 65 | Ga0070713_100025850 | 3300005436 | Bacteria | 4598 |
| 66 | Ga0070713_100047430 | 3300005436 | Bacteria | 3531 |
| 67 | Ga0070713_100152369 | 3300005436 | Bacteria | 2058 |
| 68 | Ga0070713_100155028 | 3300005436 | Bacteria | 2041 |
| 69 | Ga0070713_100332154 | 3300005436 | Bacteria | 1406 |
| 70 | Ga0070713_100415804 | 3300005436 | Unclassified | 1258 |
| 71 | Ga0070713_100715086 | 3300005436 | Bacteria | 957 |
| 72 | Ga0070713_101351123 | 3300005436 | Unclassified | 691 |
| 73 | Ga0070713_101401111 | 3300005436 | Unclassified | 678 |
| 74 | Ga0070710_10004463 | 3300005437 | Bacteria | 6623 |
| 75 | Ga0070710_10033046 | 3300005437 | Unclassified | 2807 |
| 76 | Ga0070710_10209085 | 3300005437 | Bacteria | 1236 |
| 77 | Ga0070711_100007062 | 3300005439 | Bacteria | 6813 |
| 78 | Ga0070711_100021372 | 3300005439 | Bacteria | 4184 |
| 79 | Ga0070711_100203206 | 3300005439 | Bacteria | 1530 |
| 80 | Ga0070711_100273015 | 3300005439 | Unclassified | 1335 |
| 81 | Ga0070711_100449068 | 3300005439 | Bacteria | 1055 |
| 82 | Ga0070705_100125960 | 3300005440 | Bacteria | 1663 |
| 83 | Ga0070705_100287051 | 3300005440 | Unclassified | 1173 |
| 84 | Ga0070694_100091865 | 3300005444 | Bacteria | 2132 |
| 85 | Ga0070708_100000437 | 3300005445 | Bacteria | 31114 |
| 86 | Ga0070708_100015048 | 3300005445 | Bacteria | 6382 |
| 87 | Ga0070708_100018463 | 3300005445 | Bacteria | 5837 |
| 88 | Ga0070708_100033060 | 3300005445 | Bacteria | 4492 |
| 89 | Ga0070708_100055671 | 3300005445 | Bacteria | 3517 |
| 90 | Ga0070708_100062121 | 3300005445 | Bacteria | 3339 |
| 91 | Ga0070708_100070749 | 3300005445 | Bacteria | 3139 |
| 92 | Ga0070708_100162121 | 3300005445 | Bacteria | 2084 |
| 93 | Ga0070708_100174578 | 3300005445 | Unclassified | 2007 |
| 94 | Ga0070708_100333521 | 3300005445 | Bacteria | 1429 |
| 95 | Ga0070708_100334466 | 3300005445 | Unclassified | 1427 |
| 96 | Ga0070663_100021022 | 3300005455 | Bacteria | 4332 |
| 97 | Ga0070663_100257779 | 3300005455 | Unclassified | 1382 |
| 98 | Ga0070678_100074534 | 3300005456 | Bacteria | 2551 |
| 99 | Ga0070662_100128251 | 3300005457 | Bacteria | 1952 |
| 100 | Ga0070662_100130123 | 3300005457 | Bacteria | 1939 |
| 101 | Ga0070681_10006550 | 3300005458 | Bacteria | 11336 |
| 102 | Ga0070681_10369159 | 3300005458 | Bacteria | 1345 |
| 103 | Ga0068867_100053866 | 3300005459 | Unclassified | 2971 |
| 104 | Ga0070706_100000935 | 3300005467 | Bacteria | 31937 |
| 105 | Ga0070706_100003883 | 3300005467 | Bacteria | 14597 |
| 106 | Ga0070706_100006968 | 3300005467 | Bacteria | 10660 |
| 107 | Ga0070706_100064219 | 3300005467 | Unclassified | 3393 |
| 108 | Ga0070706_100261281 | 3300005467 | Bacteria | 1616 |
| 109 | Ga0070706_100577490 | 3300005467 | Bacteria | 1045 |
| 110 | Ga0070706_100701326 | 3300005467 | Unclassified | 939 |
| 111 | Ga0070706_101016775 | 3300005467 | Unclassified | 764 |
| 112 | Ga0070707_100001244 | 3300005468 | Bacteria | 25018 |
| 113 | Ga0070707_100002157 | 3300005468 | Bacteria | 18841 |
| 114 | Ga0070707_100003649 | 3300005468 | Bacteria | 14508 |
| 115 | Ga0070707_100030458 | 3300005468 | Bacteria | 5137 |
| 116 | Ga0070707_100220881 | 3300005468 | Bacteria | 1845 |
| 117 | Ga0070707_100395934 | 3300005468 | Bacteria | 1341 |
| 118 | Ga0070698_100001005 | 3300005471 | Bacteria | 31065 |
| 119 | Ga0070698_100002044 | 3300005471 | Bacteria | 22425 |
| 120 | Ga0070698_100126852 | 3300005471 | Bacteria | 2509 |
| 121 | Ga0070698_100159775 | 3300005471 | Bacteria | 2198 |
| 122 | Ga0070698_101022260 | 3300005471 | Unclassified | 774 |
| 123 | Ga0070699_100001100 | 3300005518 | Bacteria | 25172 |
| 124 | Ga0070699_100002908 | 3300005518 | Bacteria | 15244 |
| 125 | Ga0070699_100033580 | 3300005518 | Bacteria | 4432 |
| 126 | Ga0070699_100037176 | 3300005518 | Bacteria | 4213 |
| 127 | Ga0070699_100235755 | 3300005518 | Bacteria | 1632 |
| 128 | Ga0070684_100030673 | 3300005535 | Bacteria | 4570 |
| 129 | Ga0070684_100032221 | 3300005535 | Bacteria | 4466 |
| 130 | Ga0070697_100000266 | 3300005536 | Bacteria | 42492 |
| 131 | Ga0070697_100000701 | 3300005536 | Bacteria | 25059 |
| 132 | Ga0070697_100016981 | 3300005536 | Bacteria | 5722 |
| 133 | Ga0070697_100058991 | 3300005536 | Bacteria | 3123 |
| 134 | Ga0070697_100061663 | 3300005536 | Unclassified | 3059 |
| 135 | Ga0070697_100131111 | 3300005536 | Bacteria | 2102 |
| 136 | Ga0070697_100668358 | 3300005536 | Bacteria | 915 |
| 137 | Ga0068853_100341029 | 3300005539 | Bacteria | 1392 |
| 138 | Ga0070672_100661908 | 3300005543 | Bacteria | 912 |
| 139 | Ga0070686_100128055 | 3300005544 | Bacteria | 1752 |
| 140 | Ga0070686_100146117 | 3300005544 | Bacteria | 1651 |
| 141 | Ga0070695_100055008 | 3300005545 | Unclassified | 2564 |
| 142 | Ga0070695_100103496 | 3300005545 | Bacteria | 1921 |
| 143 | Ga0070695_100719205 | 3300005545 | Bacteria | 794 |
| 144 | Ga0070693_100099957 | 3300005547 | Bacteria | 1765 |
| 145 | Ga0070693_100192365 | 3300005547 | Unclassified | 1320 |
| 146 | Ga0070693_100293454 | 3300005547 | Unclassified | 1093 |
| 147 | Ga0070693_100777961 | 3300005547 | Unclassified | 707 |
| 148 | Ga0070665_100025297 | 3300005548 | Bacteria | 5981 |
| 149 | Ga0070665_100533677 | 3300005548 | Bacteria | 1185 |
| 150 | Ga0070704_100074126 | 3300005549 | Bacteria | 2482 |
| 151 | Ga0068855_100077184 | 3300005563 | Bacteria | 3864 |
| 152 | Ga0068855_100568963 | 3300005563 | Bacteria | 1225 |
| 153 | Ga0070664_100107745 | 3300005564 | Bacteria | 2429 |
| 154 | Ga0070664_100222428 | 3300005564 | Bacteria | 1689 |
| 155 | Ga0070664_100896424 | 3300005564 | Unclassified | 831 |
| 156 | Ga0068857_100002168 | 3300005577 | Bacteria | 15958 |
| 157 | Ga0068857_100044253 | 3300005577 | Bacteria | 3948 |
| 158 | Ga0068857_100099360 | 3300005577 | Bacteria | 2610 |
| 159 | Ga0068854_100093557 | 3300005578 | Bacteria | 2240 |
| 160 | Ga0068854_100302063 | 3300005578 | Unclassified | 1295 |
| 161 | Ga0068856_100018058 | 3300005614 | Bacteria | 6840 |
| 162 | Ga0068856_100021804 | 3300005614 | Bacteria | 6226 |
| 163 | Ga0068856_100044332 | 3300005614 | Bacteria | 4377 |
| 164 | Ga0068856_100064873 | 3300005614 | Bacteria | 3608 |
| 165 | Ga0068856_100104896 | 3300005614 | Bacteria | 2821 |
| 166 | Ga0068856_100211510 | 3300005614 | Bacteria | 1955 |
| 167 | Ga0068856_100256296 | 3300005614 | Bacteria | 1764 |
| 168 | Ga0068852_100011844 | 3300005616 | Bacteria | 6591 |
| 169 | Ga0068859_100021521 | 3300005617 | Bacteria | 6472 |
| 170 | Ga0068864_100073221 | 3300005618 | Bacteria | 2986 |
| 171 | Ga0068864_100163288 | 3300005618 | Bacteria | 2026 |
| 172 | Ga0068866_10020794 | 3300005718 | Unclassified | 3012 |
| 173 | Ga0068866_10109315 | 3300005718 | Unclassified | 1539 |
| 174 | Ga0068861_100042481 | 3300005719 | Bacteria | 3407 |
| 175 | Ga0068861_100428115 | 3300005719 | Bacteria | 1181 |
| 176 | Ga0068851_10007547 | 3300005834 | Bacteria | 4998 |
| 177 | Ga0068851_10311291 | 3300005834 | Unclassified | 907 |
| 178 | Ga0068870_10010814 | 3300005840 | Bacteria | 4207 |
| 179 | Ga0068863_100106501 | 3300005841 | Bacteria | 2668 |
| 180 | Ga0068863_100292337 | 3300005841 | Bacteria | 1579 |
| 181 | Ga0068858_100033597 | 3300005842 | Bacteria | 4758 |
| 182 | Ga0068858_100068255 | 3300005842 | Bacteria | 3294 |
| 183 | Ga0068858_101030596 | 3300005842 | Bacteria | 807 |
| 184 | Ga0068860_100051564 | 3300005843 | Bacteria | 3915 |
| 185 | Ga0068860_100098412 | 3300005843 | Bacteria | 2789 |
| 186 | Ga0068860_100192215 | 3300005843 | Bacteria | 1975 |
| 187 | Ga0068862_100010616 | 3300005844 | Bacteria | 7610 |
| 188 | Ga0068862_100237907 | 3300005844 | Bacteria | 1654 |
| 189 | Ga0070717_10001093 | 3300006028 | Bacteria | 18235 |
| 190 | Ga0070717_10001658 | 3300006028 | Bacteria | 15470 |
| 191 | Ga0070717_10012009 | 3300006028 | Bacteria | 6595 |
| 192 | Ga0070717_10031513 | 3300006028 | Bacteria | 4266 |
| 193 | Ga0070717_10046711 | 3300006028 | Bacteria | 3544 |
| 194 | Ga0070717_10051907 | 3300006028 | Bacteria | 3376 |
| 195 | Ga0070717_10054243 | 3300006028 | Bacteria | 3305 |
| 196 | Ga0070717_10072990 | 3300006028 | Bacteria | 2867 |
| 197 | Ga0070717_10155358 | 3300006028 | Bacteria | 1982 |
| 198 | Ga0070717_10303444 | 3300006028 | Bacteria | 1420 |
| 199 | Ga0070715_10026101 | 3300006163 | Bacteria | 2320 |
| 200 | Ga0070716_100012854 | 3300006173 | Bacteria | 4255 |
| 201 | Ga0070716_100029846 | 3300006173 | Bacteria | 2953 |
| 202 | Ga0070716_100043545 | 3300006173 | Bacteria | 2511 |
| 203 | Ga0070716_100060757 | 3300006173 | Bacteria | 2184 |
| 204 | Ga0070716_100096582 | 3300006173 | Bacteria | 1801 |
| 205 | Ga0070716_100123616 | 3300006173 | Bacteria | 1624 |
| 206 | Ga0070716_100125871 | 3300006173 | Bacteria | 1612 |
| 207 | Ga0070716_100240198 | 3300006173 | Unclassified | 1228 |
| 208 | Ga0070716_100428372 | 3300006173 | Bacteria | 959 |
| 209 | Ga0070712_100000130 | 3300006175 | Bacteria | 39526 |
| 210 | Ga0070712_100002208 | 3300006175 | Bacteria | 11974 |
| 211 | Ga0070712_100006015 | 3300006175 | Bacteria | 7508 |
| 212 | Ga0070712_100036544 | 3300006175 | Bacteria | 3343 |
| 213 | Ga0070712_100037951 | 3300006175 | Bacteria | 3287 |
| 214 | Ga0070712_100083096 | 3300006175 | Unclassified | 2324 |
| 215 | Ga0070712_100095851 | 3300006175 | Bacteria | 2184 |
| 216 | Ga0070712_100205780 | 3300006175 | Bacteria | 1549 |
| 217 | Ga0070712_100304398 | 3300006175 | Unclassified | 1291 |
| 218 | Ga0097621_100144143 | 3300006237 | Bacteria | 2038 |
| 219 | Ga0097621_100495087 | 3300006237 | Bacteria | 1106 |
| 220 | Ga0068871_100067623 | 3300006358 | Bacteria | 2932 |
| 221 | Ga0068871_100166672 | 3300006358 | Unclassified | 1886 |
| 222 | Ga0068871_100261319 | 3300006358 | Bacteria | 1510 |
| 223 | Ga0068871_100311734 | 3300006358 | Bacteria | 1383 |
| 224 | Ga0068871_100317771 | 3300006358 | Unclassified | 1370 |
| 225 | Ga0075433_10655289 | 3300006852 | Unclassified | 920 |
| 226 | Ga0068865_100115694 | 3300006881 | Bacteria | 1985 |
| 227 | Ga0075436_100001267 | 3300006914 | Bacteria | 17156 |
| 228 | Ga0097620_100021523 | 3300006931 | Bacteria | 6472 |
| 229 | Ga0075435_100010410 | 3300007076 | Bacteria | 6803 |
| 230 | Ga0099794_10011693 | 3300007265 | Bacteria | 3765 |
| 231 | Ga0099794_10302792 | 3300007265 | Unclassified | 828 |
| 232 | Ga0105250_10069541 | 3300009092 | Bacteria | 1421 |
| 233 | Ga0105240_10018684 | 3300009093 | Bacteria | 9288 |
| 234 | Ga0105240_10037791 | 3300009093 | Bacteria | 6202 |
| 235 | Ga0105240_10039687 | 3300009093 | Bacteria | 6026 |
| 236 | Ga0105240_10216890 | 3300009093 | Bacteria | 2232 |
| 237 | Ga0105240_10314497 | 3300009093 | Bacteria | 1787 |
| 238 | Ga0105240_10385045 | 3300009093 | Bacteria | 1583 |
| 239 | Ga0105240_10461079 | 3300009093 | Bacteria | 1420 |
| 240 | Ga0105245_10010421 | 3300009098 | Bacteria | 8095 |
| 241 | Ga0105245_10011580 | 3300009098 | Bacteria | 7685 |
| 242 | Ga0105245_10034309 | 3300009098 | Bacteria | 4500 |
| 243 | Ga0105245_10126039 | 3300009098 | Bacteria | 2397 |
| 244 | Ga0105245_10397236 | 3300009098 | Unclassified | 1377 |
| 245 | Ga0105245_10616474 | 3300009098 | Bacteria | 1113 |
| 246 | Ga0105247_10020036 | 3300009101 | Bacteria | 4021 |
| 247 | Ga0105247_10061130 | 3300009101 | Bacteria | 2335 |
| 248 | Ga0105247_10186684 | 3300009101 | Unclassified | 1386 |
| 249 | Ga0105241_10001638 | 3300009174 | Bacteria | 17067 |
| 250 | Ga0105241_10014378 | 3300009174 | Bacteria | 5796 |
| 251 | Ga0105241_10092985 | 3300009174 | Bacteria | 2382 |
| 252 | Ga0105241_10201452 | 3300009174 | Bacteria | 1663 |
| 253 | Ga0105242_10217703 | 3300009176 | Bacteria | 1705 |
| 254 | Ga0105248_10024998 | 3300009177 | Bacteria | 6639 |
| 255 | Ga0105248_10028234 | 3300009177 | Bacteria | 6250 |
| 256 | Ga0105248_10477857 | 3300009177 | Bacteria | 1405 |
| 257 | Ga0105237_10009832 | 3300009545 | Bacteria | 10228 |
| 258 | Ga0105237_10039971 | 3300009545 | Bacteria | 4732 |
| 259 | Ga0105237_10423771 | 3300009545 | Unclassified | 1336 |
| 260 | Ga0105237_10643054 | 3300009545 | Bacteria | 1067 |
| 261 | Ga0105238_10030176 | 3300009551 | Bacteria | 5518 |
| 262 | Ga0105238_10137889 | 3300009551 | Bacteria | 2417 |
| 263 | Ga0105238_10165197 | 3300009551 | Bacteria | 2189 |
| 264 | Ga0105238_11074347 | 3300009551 | Unclassified | 827 |
| 265 | Ga0105238_11329721 | 3300009551 | Unclassified | 745 |
| 266 | Ga0105249_10032205 | 3300009553 | Bacteria | 4742 |
| 267 | Ga0105249_10071939 | 3300009553 | Bacteria | 3196 |
| 268 | Ga0105249_10089823 | 3300009553 | Bacteria | 2871 |
| 269 | Ga0105246_10074648 | 3300011119 | Bacteria | 2398 |
| 270 | Ga0105246_10202787 | 3300011119 | Unclassified | 1543 |
| 271 | Ga0157373_10001299 | 3300013100 | Bacteria | 19063 |
| 272 | Ga0157373_10004687 | 3300013100 | Bacteria | 10283 |
| 273 | Ga0157373_10322939 | 3300013100 | Unclassified | 1098 |
| 274 | Ga0157373_10535255 | 3300013100 | Unclassified | 848 |
| 275 | Ga0157371_10008938 | 3300013102 | Bacteria | 7928 |
| 276 | Ga0157371_10014882 | 3300013102 | Bacteria | 5855 |
| 277 | Ga0157370_10016617 | 3300013104 | Bacteria | 7445 |
| 278 | Ga0157370_10314105 | 3300013104 | Bacteria | 1446 |
| 279 | Ga0157369_10031049 | 3300013105 | Bacteria | 5888 |
| 280 | Ga0157369_10046588 | 3300013105 | Bacteria | 4711 |
| 281 | Ga0157369_10060956 | 3300013105 | Bacteria | 4068 |
| 282 | Ga0157369_10201939 | 3300013105 | Unclassified | 2086 |
| 283 | Ga0157369_10323184 | 3300013105 | Unclassified | 1604 |
| 284 | Ga0157374_10013788 | 3300013296 | Bacteria | 7060 |
| 285 | Ga0157374_10030581 | 3300013296 | Bacteria | 4891 |
| 286 | Ga0157374_10038624 | 3300013296 | Bacteria | 4389 |
| 287 | Ga0157374_10062225 | 3300013296 | Bacteria | 3497 |
| 288 | Ga0157374_10291834 | 3300013296 | Bacteria | 1612 |
| 289 | Ga0157374_10403686 | 3300013296 | Bacteria | 1364 |
| 290 | Ga0157378_10435188 | 3300013297 | Bacteria | 1299 |
| 291 | Ga0157378_10983779 | 3300013297 | Bacteria | 877 |
| 292 | Ga0163162_10001531 | 3300013306 | Bacteria | 21558 |
| 293 | Ga0163162_10015654 | 3300013306 | Bacteria | 7412 |
| 294 | Ga0163162_10373372 | 3300013306 | Unclassified | 1559 |
| 295 | Ga0157372_10000825 | 3300013307 | Bacteria | 33540 |
| 296 | Ga0157372_10015799 | 3300013307 | Bacteria | 8098 |
| 297 | Ga0157372_10028645 | 3300013307 | Bacteria | 6081 |
| 298 | Ga0157372_10039702 | 3300013307 | Bacteria | 5196 |
| 299 | Ga0157372_10078707 | 3300013307 | Bacteria | 3726 |
| 300 | Ga0157375_10110076 | 3300013308 | Bacteria | 2851 |
| 301 | Ga0157375_10288099 | 3300013308 | Bacteria | 1805 |
| 302 | Ga0157375_12098690 | 3300013308 | Bacteria | 672 |
| 303 | Ga0163163_10010127 | 3300014325 | Bacteria | 8456 |
| 304 | Ga0163163_10040139 | 3300014325 | Bacteria | 4569 |
| 305 | Ga0163163_10112727 | 3300014325 | Bacteria | 2749 |
| 306 | Ga0163163_10116898 | 3300014325 | Unclassified | 2698 |
| 307 | Ga0163163_10152848 | 3300014325 | Bacteria | 2351 |
| 308 | Ga0163163_10300583 | 3300014325 | Bacteria | 1657 |
| 309 | Ga0163163_11031706 | 3300014325 | Bacteria | 886 |
| 310 | Ga0157377_10021473 | 3300014745 | Bacteria | 3396 |
| 311 | Ga0157379_10001261 | 3300014968 | Bacteria | 20577 |
| 312 | Ga0157379_10007858 | 3300014968 | Bacteria | 9240 |
| 313 | Ga0157379_10078446 | 3300014968 | Bacteria | 2958 |
| 314 | Ga0157379_10241143 | 3300014968 | Bacteria | 1640 |
| 315 | Ga0157376_10174796 | 3300014969 | Bacteria | 1958 |
| 316 | Ga0157376_10180233 | 3300014969 | Bacteria | 1930 |
| 317 | Ga0157376_10917042 | 3300014969 | Bacteria | 895 |
| 318 | Ga0157376_11717763 | 3300014969 | Unclassified | 663 |
| 319 | Ga0184601_104320 | 3300019183 | Bacteria | 848 |
| 320 | Ga0213874_10063999 | 3300021377 | Bacteria | 1158 |
| 321 | Ga0224570_100291 | 3300022730 | Bacteria | 3800 |
| 322 | Ga0224571_100317 | 3300022734 | Unclassified | 2520 |
| 323 | Ga0247553_100308 | 3300023672 | Bacteria | 1692 |
| 324 | Ga0224572_1000408 | 3300024225 | Bacteria | 4894 |
| 325 | Ga0224572_1004935 | 3300024225 | Bacteria | 2356 |
| 326 | Ga0228598_1000383 | 3300024227 | Bacteria | 8859 |
| 327 | Ga0228598_1002732 | 3300024227 | Bacteria | 3823 |
| 328 | Ga0228598_1020970 | 3300024227 | Unclassified | 1286 |
| 329 | Ga0207656_10024608 | 3300025321 | Bacteria | 2436 |
| 330 | Ga0207692_10006024 | 3300025898 | Bacteria | 4902 |
| 331 | Ga0207692_10025360 | 3300025898 | Unclassified | 2768 |
| 332 | Ga0207692_10037896 | 3300025898 | Bacteria | 2361 |
| 333 | Ga0207642_10030947 | 3300025899 | Bacteria | 2236 |
| 334 | Ga0207710_10101690 | 3300025900 | Bacteria | 1356 |
| 335 | Ga0207680_10324478 | 3300025903 | Unclassified | 1077 |
| 336 | Ga0207647_10015589 | 3300025904 | Bacteria | 5205 |
| 337 | Ga0207685_10069819 | 3300025905 | Bacteria | 1420 |
| 338 | Ga0207699_10000528 | 3300025906 | Bacteria | 18865 |
| 339 | Ga0207699_10003495 | 3300025906 | Bacteria | 7499 |
| 340 | Ga0207699_10004846 | 3300025906 | Bacteria | 6438 |
| 341 | Ga0207699_10012963 | 3300025906 | Bacteria | 4251 |
| 342 | Ga0207699_10170108 | 3300025906 | Unclassified | 1457 |
| 343 | Ga0207699_10246783 | 3300025906 | Bacteria | 1229 |
| 344 | Ga0207699_10301663 | 3300025906 | Bacteria | 1119 |
| 345 | Ga0207699_10452759 | 3300025906 | Bacteria | 921 |
| 346 | Ga0207699_10489048 | 3300025906 | Bacteria | 887 |
| 347 | Ga0207645_10004270 | 3300025907 | Bacteria | 10605 |
| 348 | Ga0207684_10000274 | 3300025910 | Bacteria | 76497 |
| 349 | Ga0207684_10003347 | 3300025910 | Bacteria | 15715 |
| 350 | Ga0207684_10019671 | 3300025910 | Bacteria | 5775 |
| 351 | Ga0207684_10096830 | 3300025910 | Bacteria | 2519 |
| 352 | Ga0207684_10145762 | 3300025910 | Unclassified | 2036 |
| 353 | Ga0207684_10207565 | 3300025910 | Bacteria | 1690 |
| 354 | Ga0207684_10517208 | 3300025910 | Bacteria | 1022 |
| 355 | Ga0207684_10723930 | 3300025910 | Unclassified | 844 |
| 356 | Ga0207654_10139287 | 3300025911 | Bacteria | 1545 |
| 357 | Ga0207654_10232786 | 3300025911 | Unclassified | 1228 |
| 358 | Ga0207707_10009709 | 3300025912 | Bacteria | 8348 |
| 359 | Ga0207707_10090077 | 3300025912 | Bacteria | 2681 |
| 360 | Ga0207707_10196174 | 3300025912 | Unclassified | 1761 |
| 361 | Ga0207695_10028405 | 3300025913 | Bacteria | 6204 |
| 362 | Ga0207695_10047537 | 3300025913 | Bacteria | 4540 |
| 363 | Ga0207695_10085345 | 3300025913 | Bacteria | 3186 |
| 364 | Ga0207695_10271179 | 3300025913 | Bacteria | 1592 |
| 365 | Ga0207671_10332065 | 3300025914 | Unclassified | 1204 |
| 366 | Ga0207671_10453384 | 3300025914 | Unclassified | 1022 |
| 367 | Ga0207693_10000013 | 3300025915 | Bacteria | 154365 |
| 368 | Ga0207693_10000143 | 3300025915 | Bacteria | 65412 |
| 369 | Ga0207693_10002309 | 3300025915 | Bacteria | 16587 |
| 370 | Ga0207693_10004457 | 3300025915 | Bacteria | 11831 |
| 371 | Ga0207693_10014717 | 3300025915 | Bacteria | 6285 |
| 372 | Ga0207693_10062201 | 3300025915 | Bacteria | 2925 |
| 373 | Ga0207693_10138156 | 3300025915 | Bacteria | 1916 |
| 374 | Ga0207693_10275187 | 3300025915 | Bacteria | 1319 |
| 375 | Ga0207693_10275488 | 3300025915 | Unclassified | 1318 |
| 376 | Ga0207663_10001881 | 3300025916 | Bacteria | 9929 |
| 377 | Ga0207663_10012032 | 3300025916 | Bacteria | 4665 |
| 378 | Ga0207663_10154117 | 3300025916 | Bacteria | 1615 |
| 379 | Ga0207663_10887446 | 3300025916 | Bacteria | 713 |
| 380 | Ga0207660_10639312 | 3300025917 | Unclassified | 867 |
| 381 | Ga0207657_10002502 | 3300025919 | Bacteria | 19880 |
| 382 | Ga0207649_10032077 | 3300025920 | Bacteria | 3128 |
| 383 | Ga0207652_10088156 | 3300025921 | Bacteria | 2722 |
| 384 | Ga0207646_10000240 | 3300025922 | Bacteria | 75609 |
| 385 | Ga0207646_10000341 | 3300025922 | Bacteria | 63056 |
| 386 | Ga0207646_10113350 | 3300025922 | Bacteria | 2434 |
| 387 | Ga0207646_10167820 | 3300025922 | Unclassified | 1982 |
| 388 | Ga0207646_10294921 | 3300025922 | Unclassified | 1465 |
| 389 | Ga0207646_10327932 | 3300025922 | Bacteria | 1383 |
| 390 | Ga0207646_10411798 | 3300025922 | Unclassified | 1221 |
| 391 | Ga0207646_10617367 | 3300025922 | Bacteria | 973 |
| 392 | Ga0207694_10088049 | 3300025924 | Bacteria | 2447 |
| 393 | Ga0207694_10391345 | 3300025924 | Unclassified | 1155 |
| 394 | Ga0207694_10576520 | 3300025924 | Unclassified | 945 |
| 395 | Ga0207650_10295167 | 3300025925 | Bacteria | 1322 |
| 396 | Ga0207687_10032008 | 3300025927 | Bacteria | 3559 |
| 397 | Ga0207687_10100734 | 3300025927 | Bacteria | 2125 |
| 398 | Ga0207700_10000337 | 3300025928 | Bacteria | 27629 |
| 399 | Ga0207700_10000346 | 3300025928 | Bacteria | 27177 |
| 400 | Ga0207700_10012848 | 3300025928 | Bacteria | 5418 |
| 401 | Ga0207700_10031073 | 3300025928 | Bacteria | 3790 |
| 402 | Ga0207700_10066360 | 3300025928 | Bacteria | 2758 |
| 403 | Ga0207700_10151549 | 3300025928 | Unclassified | 1916 |
| 404 | Ga0207700_10219183 | 3300025928 | Unclassified | 1612 |
| 405 | Ga0207700_10370578 | 3300025928 | Bacteria | 1250 |
| 406 | Ga0207700_10392450 | 3300025928 | Bacteria | 1215 |
| 407 | Ga0207700_10644168 | 3300025928 | Bacteria | 945 |
| 408 | Ga0207664_10000201 | 3300025929 | Bacteria | 44962 |
| 409 | Ga0207664_10013157 | 3300025929 | Bacteria | 5931 |
| 410 | Ga0207664_10082306 | 3300025929 | Bacteria | 2621 |
| 411 | Ga0207664_10089793 | 3300025929 | Bacteria | 2517 |
| 412 | Ga0207664_10305247 | 3300025929 | Bacteria | 1401 |
| 413 | Ga0207664_10373971 | 3300025929 | Bacteria | 1264 |
| 414 | Ga0207664_10392487 | 3300025929 | Bacteria | 1233 |
| 415 | Ga0207690_10080728 | 3300025932 | Bacteria | 2270 |
| 416 | Ga0207706_10001321 | 3300025933 | Bacteria | 24837 |
| 417 | Ga0207686_10770868 | 3300025934 | Bacteria | 769 |
| 418 | Ga0207709_10047224 | 3300025935 | Bacteria | 2616 |
| 419 | Ga0207669_10154973 | 3300025937 | Unclassified | 1610 |
| 420 | Ga0207665_10003598 | 3300025939 | Bacteria | 10348 |
| 421 | Ga0207665_10005780 | 3300025939 | Bacteria | 8227 |
| 422 | Ga0207665_10014974 | 3300025939 | Bacteria | 5094 |
| 423 | Ga0207665_10019820 | 3300025939 | Bacteria | 4420 |
| 424 | Ga0207665_10046599 | 3300025939 | Bacteria | 2904 |
| 425 | Ga0207665_10050393 | 3300025939 | Bacteria | 2800 |
| 426 | Ga0207665_10068696 | 3300025939 | Bacteria | 2415 |
| 427 | Ga0207665_10079100 | 3300025939 | Bacteria | 2260 |
| 428 | Ga0207665_10140700 | 3300025939 | Bacteria | 1720 |
| 429 | Ga0207665_10299628 | 3300025939 | Unclassified | 1201 |
| 430 | Ga0207711_10005468 | 3300025941 | Bacteria | 10741 |
| 431 | Ga0207711_10332417 | 3300025941 | Bacteria | 1405 |
| 432 | Ga0207689_10021360 | 3300025942 | Bacteria | 5444 |
| 433 | Ga0207689_10291861 | 3300025942 | Bacteria | 1351 |
| 434 | Ga0207689_10745622 | 3300025942 | Bacteria | 826 |
| 435 | Ga0207661_11523938 | 3300025944 | Bacteria | 612 |
| 436 | Ga0207679_10778907 | 3300025945 | Unclassified | 871 |
| 437 | Ga0207679_10822240 | 3300025945 | Unclassified | 848 |
| 438 | Ga0207667_10353783 | 3300025949 | Bacteria | 1498 |
| 439 | Ga0207667_10451906 | 3300025949 | Bacteria | 1305 |
| 440 | Ga0207640_10391143 | 3300025981 | Unclassified | 1129 |
| 441 | Ga0207640_11263669 | 3300025981 | Unclassified | 658 |
| 442 | Ga0207658_10169082 | 3300025986 | Unclassified | 1799 |
| 443 | Ga0207658_10625454 | 3300025986 | Unclassified | 969 |
| 444 | Ga0207677_10052606 | 3300026023 | Unclassified | 2767 |
| 445 | Ga0207677_10268477 | 3300026023 | Unclassified | 1394 |
| 446 | Ga0207639_10439738 | 3300026041 | Bacteria | 1182 |
| 447 | Ga0207678_10000277 | 3300026067 | Bacteria | 46368 |
| 448 | Ga0207702_10010133 | 3300026078 | Bacteria | 7892 |
| 449 | Ga0207702_10010742 | 3300026078 | Bacteria | 7646 |
| 450 | Ga0207702_10076477 | 3300026078 | Unclassified | 2894 |
| 451 | Ga0207702_10089073 | 3300026078 | Bacteria | 2698 |
| 452 | Ga0207702_10505245 | 3300026078 | Bacteria | 1179 |
| 453 | Ga0207641_10049231 | 3300026088 | Bacteria | 3560 |
| 454 | Ga0207641_10331212 | 3300026088 | Bacteria | 1446 |
| 455 | Ga0207641_10421987 | 3300026088 | Bacteria | 1284 |
| 456 | Ga0207648_10017311 | 3300026089 | Bacteria | 6563 |
| 457 | Ga0207676_10128670 | 3300026095 | Bacteria | 2149 |
| 458 | Ga0207674_10012162 | 3300026116 | Bacteria | 9635 |
| 459 | Ga0207674_10016566 | 3300026116 | Bacteria | 8062 |
| 460 | Ga0207674_10181249 | 3300026116 | Bacteria | 2058 |
| 461 | Ga0207675_100243973 | 3300026118 | Bacteria | 1736 |
| 462 | Ga0207683_10160969 | 3300026121 | Bacteria | 2029 |
| 463 | Ga0265356_1001162 | 3300028017 | Bacteria | 4045 |
| 464 | Ga0265356_1002472 | 3300028017 | Bacteria | 2477 |
| 465 | Ga0268266_10305898 | 3300028379 | Bacteria | 1484 |
| 466 | Ga0268265_10066561 | 3300028380 | Bacteria | 2785 |
| 467 | Ga0268264_10042134 | 3300028381 | Bacteria | 3778 |
| 468 | Ga0268264_10058821 | 3300028381 | Bacteria | 3219 |
| 469 | Ga0265326_10066592 | 3300028558 | Unclassified | 1018 |
| 470 | Ga0265338_10024720 | 3300028800 | Bacteria | 6126 |
| 471 | Ga0265338_10367482 | 3300028800 | Bacteria | 1031 |
| 472 | Ga0265762_1001174 | 3300030760 | Bacteria | 4743 |
| 473 | Ga0265767_100901 | 3300030836 | Unclassified | 1362 |
| 474 | Ga0265777_101754 | 3300030877 | Unclassified | 1198 |
| 475 | Ga0265765_1012605 | 3300030879 | Bacteria | 960 |
| 476 | Ga0265764_103767 | 3300030882 | Unclassified | 802 |
| 477 | Ga0265771_1011809 | 3300031010 | Unclassified | 659 |
| 478 | Ga0265760_10000817 | 3300031090 | Bacteria | 8977 |
| 479 | Ga0265760_10001979 | 3300031090 | Bacteria | 6017 |
| 480 | Ga0265760_10003825 | 3300031090 | Bacteria | 4364 |
| 481 | Ga0265760_10007880 | 3300031090 | Bacteria | 3043 |
| 482 | Ga0265760_10022950 | 3300031090 | Bacteria | 1810 |
| 483 | Ga0265760_10034347 | 3300031090 | Bacteria | 1500 |
| 484 | Ga0265330_10009005 | 3300031235 | Bacteria | 4764 |
| 485 | Ga0265340_10044209 | 3300031247 | Bacteria | 2180 |
| 486 | Ga0265340_10095583 | 3300031247 | Bacteria | 1385 |
| 487 | Ga0265339_10020315 | 3300031249 | Bacteria | 3883 |
| 488 | Ga0265339_10030436 | 3300031249 | Bacteria | 3056 |
| 489 | Ga0265339_10033158 | 3300031249 | Bacteria | 2910 |
| 490 | Ga0265339_10149990 | 3300031249 | Bacteria | 1180 |
| 491 | Ga0265316_10002054 | 3300031344 | Bacteria | 21202 |
| 492 | Ga0265316_10027901 | 3300031344 | Unclassified | 4667 |
| 493 | Ga0265316_10049817 | 3300031344 | Unclassified | 3297 |
| 494 | Ga0265314_10000348 | 3300031711 | Bacteria | 64175 |
| 495 | Ga0265314_10023827 | 3300031711 | Bacteria | 4655 |
| 496 | Ga0265314_10074163 | 3300031711 | Bacteria | 2267 |
| 497 | Ga0265314_10100093 | 3300031711 | Bacteria | 1865 |
| 498 | Ga0265342_10048686 | 3300031712 | Bacteria | 2540 |
| 499 | Ga0265342_10295034 | 3300031712 | Bacteria | 855 |
| 500 | Ga0316053_100216 | 3300032120 | Bacteria | 2278 |
| 501 | Ga0316212_1006664 | 3300033547 | Bacteria | 1671 |
| 502 | Ga0316212_1019356 | 3300033547 | Unclassified | 955 |
| 503 | Ga0373930_0047228 | 3300034816 | Unclassified | 931 |
| 504 | Ga0373926_0005377 | 3300035083 | Bacteria | 4218 |
| 505 | Ga0373926_0055670 | 3300035083 | Bacteria | 1434 |
| 506 | Ga0373926_0168743 | 3300035083 | Unclassified | 837 |
| 507 | Ga0373934_0038417 | 3300035086 | Bacteria | 1886 |
| 508 | Ga0373940_0014887 | 3300035088 | Bacteria | 1905 |
| 509 | Ga0373951_0025103 | 3300035091 | Unclassified | 1383 |
| 510 | Ga0373923_0008953 | 3300035111 | Bacteria | 3593 |
| 511 | Ga0373932_0015752 | 3300035112 | Bacteria | 1921 |
| 512 | Ga0373936_0000275 | 3300035113 | Bacteria | 17102 |
| 513 | Ga0373936_0018891 | 3300035113 | Bacteria | 2667 |
| 514 | Ga0373936_0032100 | 3300035113 | Bacteria | 2076 |
| 515 | Ga0373936_0107940 | 3300035113 | Bacteria | 1180 |
| 516 | Ga0373939_0004499 | 3300035114 | Bacteria | 3302 |
| 517 | Ga0373945_0053857 | 3300035116 | Unclassified | 1486 |
| 518 | Ga0373953_0057031 | 3300035117 | Bacteria | 1589 |
| 519 | Ga0373954_0029119 | 3300035118 | Bacteria | 2542 |
| 520 | Ga0373956_0035693 | 3300035119 | Bacteria | 2193 |
| 521 | Ga0373960_0007444 | 3300035121 | Unclassified | 2594 |
| 522 | Ga0373943_0000011 | 3300035170 | Bacteria | 64439 |
| 523 | Ga0373943_0018454 | 3300035170 | Unclassified | 3206 |
| 524 | Ga0373943_0052333 | 3300035170 | Bacteria | 2013 |
| 525 | Ga0373943_0135442 | 3300035170 | Bacteria | 1322 |
| 526 | Ga0373943_0136882 | 3300035170 | Bacteria | 1316 |
| 527 | Ga0373943_0237461 | 3300035170 | Bacteria | 1020 |
| 528 | Ga0373943_0274154 | 3300035170 | Bacteria | 952 |
| 529 | Ga0373946_0004868 | 3300035171 | Bacteria | 4834 |
| 530 | Ga0373955_0419814 | 3300035172 | Unclassified | 813 |
| 531 | Ga0373942_0077346 | 3300035207 | Bacteria | 982 |
| 532 | Ga0373924_0015151 | 3300035410 | Bacteria | 2925 |
| 533 | Ga0373924_0082057 | 3300035410 | Unclassified | 1372 |
| 534 | Ga0373924_0085550 | 3300035410 | Bacteria | 1345 |
| 535 | Ga0373931_0008821 | 3300035691 | Bacteria | 4798 |
| 536 | Ga0373931_0444078 | 3300035691 | Bacteria | 828 |
| 537 | Ga0373935_0001861 | 3300035692 | Bacteria | 11832 |
| 538 | Ga0373935_0002744 | 3300035692 | Bacteria | 10136 |
| 539 | Ga0373935_0064889 | 3300035692 | Bacteria | 2342 |
| 540 | Ga0373935_0438278 | 3300035692 | Bacteria | 942 |
| 541 | Ga0373927_0000604 | 3300035695 | Bacteria | 27351 |
| 542 | Ga0373927_0003800 | 3300035695 | Bacteria | 10715 |
| 543 | Ga0373927_0080802 | 3300035695 | Bacteria | 2106 |
| 544 | Ga0373927_0199084 | 3300035695 | Unclassified | 1315 |
| 545 | Ga0373927_0279037 | 3300035695 | Bacteria | 1099 |
| 546 | Ga0373933_0021828 | 3300035724 | Bacteria | 3642 |
| 547 | Ga0373933_0050277 | 3300035724 | Bacteria | 2488 |
| 548 | Ga0373933_0200177 | 3300035724 | Unclassified | 1278 |
| 549 | Ga0373947_0000784 | 3300035725 | Bacteria | 19102 |
| 550 | Ga0373947_0010631 | 3300035725 | Bacteria | 5280 |
| 551 | Ga0373947_0048835 | 3300035725 | Bacteria | 2540 |
| 552 | Ga0373937_0096584 | 3300036401 | Bacteria | 2741 |
| 553 | Ga0373937_0114777 | 3300036401 | Bacteria | 2507 |
| 554 | Ga0373937_0373907 | 3300036401 | Bacteria | 1351 |
| 555 | Ga0373937_0489643 | 3300036401 | Unclassified | 1168 |
| 556 | Ga0265778_004477 | 3300036457 | Unclassified | 1447 |
| 557 | Ga0373925_0001438 | 3300037068 | Bacteria | 20628 |
| 558 | Ga0373925_0006773 | 3300037068 | Bacteria | 8398 |
| 559 | Ga0373925_0009721 | 3300037068 | Bacteria | 6992 |
| 560 | Ga0373925_0010976 | 3300037068 | Bacteria | 6576 |
| 561 | Ga0373925_0012397 | 3300037068 | Bacteria | 6172 |
| 562 | Ga0373925_0026046 | 3300037068 | Bacteria | 4276 |
| 563 | Ga0373925_0081841 | 3300037068 | Unclassified | 2456 |
| 564 | Ga0373925_0305927 | 3300037068 | Unclassified | 1284 |
| 565 | Ga0373925_0328263 | 3300037068 | Bacteria | 1239 |
| 566 | Ga0373925_0358106 | 3300037068 | Unclassified | 1186 |
| 567 | Ga0395900_1237968 | 3300037418 | Unclassified | 661 |
| 568 | Ga0436360_0358964 | 3300039438 | Bacteria | 1147 |
| 569 | Ga0436363_0451864 | 3300039450 | Unclassified | 2065 |
| 570 | Ga0451839_1277567 | 3300041496 | Bacteria | 734 |
| 571 | Ga0451577_0000241 | 3300042876 | Bacteria | 108191 |
| 572 | Ga0451577_0677628 | 3300042876 | Bacteria | 935 |
| 573 | Ga0451577_0984051 | 3300042876 | Unclassified | 758 |
| 574 | Ga0466963_0085737 | 3300044694 | Unclassified | 2139 |
| 575 | Ga0466964_0033709 | 3300044706 | Bacteria | 2041 |
| 576 | Ga0453684_0000366 | 3300044712 | Bacteria | 186117 |
| 577 | Ga0453684_0738228 | 3300044712 | Bacteria | 1067 |
| 578 | Ga0453684_1510077 | 3300044712 | Bacteria | 693 |
| 579 | Ga0466959_0320400 | 3300045049 | Unclassified | 1060 |
| 580 | Ga0451576_0005686 | 3300045051 | Bacteria | 15558 |
| 581 | Ga0451576_0252655 | 3300045051 | Unclassified | 1843 |
| 582 | Ga0451576_0641173 | 3300045051 | Bacteria | 1116 |
| 583 | Ga0466967_0028583 | 3300045976 | Bacteria | 4657 |
| 584 | Ga0466967_0028774 | 3300045976 | Bacteria | 4644 |
| 585 | Ga0466967_0086055 | 3300045976 | Bacteria | 2847 |
| 586 | Ga0495590_0025074 | 3300046457 | Bacteria | 2098 |
| 587 | Ga0495653_0083918 | 3300046463 | Bacteria | 2348 |
| 588 | Ga0495580_0001182 | 3300046472 | Bacteria | 22952 |
| 589 | Ga0495580_0005708 | 3300046472 | Bacteria | 10237 |
| 590 | Ga0495580_0008969 | 3300046472 | Bacteria | 7902 |
| 591 | Ga0495580_0023555 | 3300046472 | Bacteria | 4519 |
| 592 | Ga0495580_0029919 | 3300046472 | Bacteria | 3948 |
| 593 | Ga0495580_0069661 | 3300046472 | Bacteria | 2457 |
| 594 | Ga0495580_0263134 | 3300046472 | Unclassified | 1179 |
| 595 | Ga0495580_0305002 | 3300046472 | Bacteria | 1084 |
| 596 | Ga0495582_0001573 | 3300046473 | Bacteria | 12875 |
| 597 | Ga0495582_0014062 | 3300046473 | Bacteria | 4405 |
| 598 | Ga0495582_0230587 | 3300046473 | Bacteria | 1060 |
| 599 | Ga0495582_0373567 | 3300046473 | Bacteria | 821 |
| 600 | Ga0495664_0081079 | 3300046477 | Bacteria | 1945 |
| 601 | Ga0495664_0220452 | 3300046477 | Bacteria | 1148 |
| 602 | Ga0495608_0268191 | 3300046511 | Bacteria | 1062 |
| 603 | Ga0495608_0494284 | 3300046511 | Bacteria | 741 |
| 604 | Ga0495630_0122804 | 3300046517 | Bacteria | 1970 |
| 605 | Ga0495630_0273204 | 3300046517 | Bacteria | 1291 |
| 606 | Ga0495666_0021858 | 3300046526 | Bacteria | 3167 |
| 607 | Ga0495666_0151103 | 3300046526 | Bacteria | 1080 |
| 608 | Ga0495665_0011363 | 3300046531 | Bacteria | 4819 |
| 609 | Ga0495665_0026731 | 3300046531 | Bacteria | 3099 |
| 610 | Ga0495665_0148579 | 3300046531 | Bacteria | 1224 |
| 611 | Ga0495665_0332171 | 3300046531 | Bacteria | 775 |
| 612 | Ga0495640_0064350 | 3300046533 | Bacteria | 2480 |
| 613 | Ga0495645_0264922 | 3300046543 | Unclassified | 1136 |
| 614 | Ga0495645_0405866 | 3300046543 | Unclassified | 867 |
| 615 | Ga0495667_0170990 | 3300046559 | Bacteria | 1396 |
| 616 | Ga0495635_0029277 | 3300046663 | Bacteria | 3829 |
| 617 | Ga0495657_0142812 | 3300046675 | Bacteria | 1491 |
| 618 | Ga0495657_0287746 | 3300046675 | Bacteria | 982 |
| 619 | Ga0495599_0184764 | 3300046678 | Bacteria | 1284 |
| 620 | Ga0495658_0069689 | 3300046683 | Bacteria | 2039 |
| 621 | Ga0495658_0303379 | 3300046683 | Bacteria | 1010 |
| 622 | Ga0495669_0002318 | 3300046684 | Bacteria | 7799 |
| 623 | Ga0495669_0029992 | 3300046684 | Bacteria | 2387 |
| 624 | Ga0495581_0023298 | 3300047315 | Unclassified | 3588 |
| 625 | Ga0495581_0088528 | 3300047315 | Bacteria | 1795 |
| 626 | Ga0495604_0178863 | 3300047317 | Bacteria | 1485 |
| 627 | Ga0495674_0010911 | 3300047319 | Bacteria | 8588 |
| 628 | Ga0495674_0020609 | 3300047319 | Bacteria | 6103 |
| 629 | Ga0495674_0196723 | 3300047319 | Bacteria | 1674 |
| 630 | Ga0495674_0234772 | 3300047319 | Bacteria | 1513 |
| 631 | Ga0495674_0343071 | 3300047319 | Unclassified | 1214 |
| 632 | Ga0495674_0680826 | 3300047319 | Unclassified | 809 |
| 633 | Ga0495680_0357459 | 3300047322 | Bacteria | 1016 |
| 634 | Ga0495675_0247434 | 3300047444 | Unclassified | 1072 |
| 635 | Ga0495677_0093393 | 3300047445 | Bacteria | 1135 |
| 636 | Ga0495593_0208859 | 3300047673 | Unclassified | 980 |
| 637 | Ga0495602_0156508 | 3300048088 | Bacteria | 1784 |
| 638 | Ga0495602_0175584 | 3300048088 | Bacteria | 1658 |
| 639 | Ga0495602_0213169 | 3300048088 | Bacteria | 1464 |
| 640 | Ga0495602_0270263 | 3300048088 | Unclassified | 1257 |
| 641 | Ga0495614_0315796 | 3300048089 | Unclassified | 724 |
| 642 | Ga0496100_0060824 | 3300048903 | Bacteria | 2487 |
| 643 | Ga0496101_0052231 | 3300048904 | Bacteria | 2947 |
| 644 | Ga0496101_0318450 | 3300048904 | Bacteria | 1220 |
| 645 | Ga0496102_0005937 | 3300048905 | Bacteria | 10396 |
| 646 | Ga0496102_0052945 | 3300048905 | Bacteria | 3699 |
| 647 | Ga0496102_0363101 | 3300048905 | Unclassified | 1363 |
| 648 | Ga0496103_0008297 | 3300048906 | Bacteria | 6168 |
| 649 | Ga0496104_0153745 | 3300048907 | Bacteria | 2208 |
| 650 | Ga0496104_0308672 | 3300048907 | Bacteria | 1495 |
| 651 | Ga0496105_0211209 | 3300048908 | Unclassified | 1582 |
| 652 | Ga0496105_0247897 | 3300048908 | Bacteria | 1443 |
| 653 | Ga0496105_0647316 | 3300048908 | Unclassified | 816 |
| 654 | Ga0496105_0649248 | 3300048908 | Bacteria | 814 |
| 655 | Ga0496106_0247080 | 3300048909 | Bacteria | 1426 |
| 656 | Ga0496106_0571434 | 3300048909 | Unclassified | 907 |
| 657 | Ga0496107_0042844 | 3300048910 | Bacteria | 3252 |
| 658 | Ga0496107_0361623 | 3300048910 | Bacteria | 1080 |
| 659 | Ga0496107_0599157 | 3300048910 | Bacteria | 814 |
| 660 | Ga0496108_0124534 | 3300048911 | Bacteria | 2212 |
| 661 | Ga0496108_0355645 | 3300048911 | Unclassified | 1278 |
| 662 | Ga0496108_0391978 | 3300048911 | Bacteria | 1213 |
| 663 | Ga0496109_0335280 | 3300048912 | Unclassified | 1428 |
| 664 | Ga0496110_0552566 | 3300048913 | Bacteria | 1046 |
| 665 | Ga0496110_1112353 | 3300048913 | Bacteria | 698 |
| 666 | Ga0496112_0011087 | 3300048915 | Bacteria | 8215 |
| 667 | Ga0496112_0058500 | 3300048915 | Bacteria | 3796 |
| 668 | Ga0496112_0089568 | 3300048915 | Bacteria | 3045 |
| 669 | Ga0496112_0094726 | 3300048915 | Bacteria | 2956 |
| 670 | Ga0496112_0437180 | 3300048915 | Bacteria | 1246 |
| 671 | Ga0496112_0619466 | 3300048915 | Unclassified | 1013 |
| 672 | Ga0496113_0015649 | 3300048916 | Bacteria | 5223 |
| 673 | Ga0496113_0504423 | 3300048916 | Unclassified | 971 |
| 674 | Ga0496114_0056576 | 3300048917 | Bacteria | 3274 |
| 675 | Ga0496114_0059045 | 3300048917 | Bacteria | 3204 |
| 676 | Ga0496115_0017969 | 3300048918 | Bacteria | 5418 |
| 677 | Ga0496115_0635984 | 3300048918 | Bacteria | 845 |
| 678 | Ga0496115_0968686 | 3300048918 | Bacteria | 652 |
| 679 | Ga0501083_0026123 | 3300049744 | Bacteria | 4040 |
| 680 | Ga0501083_0085897 | 3300049744 | Bacteria | 2081 |
| 681 | nmdc:mga0n895_224433_c1 | 3300050512 | Unclassified | 1907 |
| 682 | nmdc:mga0rr50_45157_c1 | 3300050513 | Bacteria | 3236 |
| 683 | nmdc:mga08x19_1063_c1 | 3300050514 | Bacteria | 17156 |
| 684 | nmdc:mga0a205_617208_c1 | 3300050515 | Unclassified | 937 |
| 685 | Ga0495601_0131310 | 3300053077 | Bacteria | 1631 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037068 | Ga0373925_0328263 | Ga0373925_0328263_90_653 | 184 |
| 2 | 3300046472 | Ga0495580_0001182 | Ga0495580_0001182_15722_16285 | 184 |
| 3 | 3300005435 | Ga0070714_100010217 | Ga0070714_1000102175 | 185 |
| 4 | 3300005435 | Ga0070714_100059470 | Ga0070714_1000594702 | 185 |
| 5 | 3300005436 | Ga0070713_100024512 | Ga0070713_1000245124 | 185 |
| 6 | 3300005436 | Ga0070713_100047430 | Ga0070713_1000474302 | 185 |
| 7 | 3300005467 | Ga0070706_100701326 | Ga0070706_1007013261 | 185 |
| 8 | 3300005468 | Ga0070707_100220881 | Ga0070707_1002208812 | 185 |
| 9 | 3300005614 | Ga0068856_100104896 | Ga0068856_1001048965 | 185 |
| 10 | 3300006028 | Ga0070717_10031513 | Ga0070717_100315135 | 185 |
| 11 | 3300006028 | Ga0070717_10046711 | Ga0070717_100467115 | 185 |
| 12 | 3300006028 | Ga0070717_10303444 | Ga0070717_103034442 | 185 |
| 13 | 3300006173 | Ga0070716_100096582 | Ga0070716_1000965823 | 185 |
| 14 | 3300006175 | Ga0070712_100083096 | Ga0070712_1000830962 | 185 |
| 15 | 3300006914 | Ga0075436_100001267 | Ga0075436_1000012676 | 185 |
| 16 | 3300007076 | Ga0075435_100010410 | Ga0075435_1000104107 | 185 |
| 17 | 3300009093 | Ga0105240_10018684 | Ga0105240_1001868410 | 185 |
| 18 | 3300013105 | Ga0157369_10046588 | Ga0157369_100465885 | 185 |
| 19 | 3300013307 | Ga0157372_10000825 | Ga0157372_1000082524 | 185 |
| 20 | 3300013307 | Ga0157372_10028645 | Ga0157372_100286452 | 185 |
| 21 | 3300025906 | Ga0207699_10004846 | Ga0207699_100048464 | 185 |
| 22 | 3300025906 | Ga0207699_10301663 | Ga0207699_103016632 | 185 |
| 23 | 3300025910 | Ga0207684_10723930 | Ga0207684_107239302 | 185 |
| 24 | 3300025913 | Ga0207695_10028405 | Ga0207695_100284055 | 185 |
| 25 | 3300025913 | Ga0207695_10085345 | Ga0207695_100853452 | 185 |
| 26 | 3300025915 | Ga0207693_10138156 | Ga0207693_101381563 | 185 |
| 27 | 3300025928 | Ga0207700_10031073 | Ga0207700_100310733 | 185 |
| 28 | 3300025928 | Ga0207700_10151549 | Ga0207700_101515491 | 185 |
| 29 | 3300025929 | Ga0207664_10089793 | Ga0207664_100897934 | 185 |
| 30 | 3300025929 | Ga0207664_10305247 | Ga0207664_103052472 | 185 |
| 31 | 3300025929 | Ga0207664_10373971 | Ga0207664_103739712 | 185 |
| 32 | 3300025939 | Ga0207665_10005780 | Ga0207665_100057802 | 185 |
| 33 | 3300026078 | Ga0207702_10076477 | Ga0207702_100764772 | 185 |
| 34 | 3300035083 | Ga0373926_0055670 | Ga0373926_0055670_585_1163 | 185 |
| 35 | 3300035113 | Ga0373936_0032100 | Ga0373936_0032100_150_719 | 185 |
| 36 | 3300035170 | Ga0373943_0018454 | Ga0373943_0018454_1609_2178 | 185 |
| 37 | 3300035170 | Ga0373943_0237461 | Ga0373943_0237461_189_767 | 185 |
| 38 | 3300035170 | Ga0373943_0274154 | Ga0373943_0274154_205_774 | 185 |
| 39 | 3300035692 | Ga0373935_0002744 | Ga0373935_0002744_9279_9848 | 185 |
| 40 | 3300035692 | Ga0373935_0064889 | Ga0373935_0064889_500_1078 | 185 |
| 41 | 3300035692 | Ga0373935_0438278 | Ga0373935_0438278_56_625 | 185 |
| 42 | 3300035695 | Ga0373927_0003800 | Ga0373927_0003800_3608_4186 | 185 |
| 43 | 3300035695 | Ga0373927_0080802 | Ga0373927_0080802_159_728 | 185 |
| 44 | 3300035725 | Ga0373947_0010631 | Ga0373947_0010631_2477_3046 | 185 |
| 45 | 3300035725 | Ga0373947_0048835 | Ga0373947_0048835_1641_2210 | 185 |
| 46 | 3300037068 | Ga0373925_0006773 | Ga0373925_0006773_4262_4831 | 185 |
| 47 | 3300037068 | Ga0373925_0009721 | Ga0373925_0009721_478_1056 | 185 |
| 48 | 3300039438 | Ga0436360_0358964 | Ga0436360_0358964_322_897 | 185 |
| 49 | 3300046472 | Ga0495580_0005708 | Ga0495580_0005708_4544_5113 | 185 |
| 50 | 3300046473 | Ga0495582_0001573 | Ga0495582_0001573_10800_11369 | 185 |
| 51 | 3300046526 | Ga0495666_0021858 | Ga0495666_0021858_592_1161 | 185 |
| 52 | 3300046531 | Ga0495665_0011363 | Ga0495665_0011363_1449_2018 | 185 |
| 53 | 3300046531 | Ga0495665_0026731 | Ga0495665_0026731_2456_3034 | 185 |
| 54 | 3300046683 | Ga0495658_0303379 | Ga0495658_0303379_129_698 | 185 |
| 55 | 3300047315 | Ga0495581_0023298 | Ga0495581_0023298_1544_2113 | 185 |
| 56 | 3300047317 | Ga0495604_0178863 | Ga0495604_0178863_172_750 | 185 |
| 57 | 3300047319 | Ga0495674_0196723 | Ga0495674_0196723_847_1416 | 185 |
| 58 | 3300048089 | Ga0495614_0315796 | Ga0495614_0315796_58_627 | 185 |
| 59 | 3300050513 | nmdc:mga0rr50_45157_c1 | nmdc:mga0rr50_45157_c1_2140_2709 | 185 |
| 60 | 3300050514 | nmdc:mga08x19_1063_c1 | nmdc:mga08x19_1063_c1_2584_3153 | 185 |
| 61 | 3300014969 | Ga0157376_11717763 | Ga0157376_117177631 | 189 |
| 62 | 3300025913 | Ga0207695_10271179 | Ga0207695_102711793 | 189 |
| 63 | 3300005434 | Ga0070709_10049158 | Ga0070709_100491583 | 190 |
| 64 | 3300005435 | Ga0070714_100746881 | Ga0070714_1007468812 | 190 |
| 65 | 3300005436 | Ga0070713_100715086 | Ga0070713_1007150861 | 190 |
| 66 | 3300005436 | Ga0070713_101351123 | Ga0070713_1013511231 | 190 |
| 67 | 3300005437 | Ga0070710_10004463 | Ga0070710_100044635 | 190 |
| 68 | 3300005439 | Ga0070711_100007062 | Ga0070711_1000070627 | 190 |
| 69 | 3300006163 | Ga0070715_10026101 | Ga0070715_100261014 | 190 |
| 70 | 3300006173 | Ga0070716_100012854 | Ga0070716_1000128545 | 190 |
| 71 | 3300006173 | Ga0070716_100060757 | Ga0070716_1000607572 | 190 |
| 72 | 3300006175 | Ga0070712_100002208 | Ga0070712_1000022086 | 190 |
| 73 | 3300025898 | Ga0207692_10006024 | Ga0207692_100060244 | 190 |
| 74 | 3300025905 | Ga0207685_10069819 | Ga0207685_100698192 | 190 |
| 75 | 3300025915 | Ga0207693_10000013 | Ga0207693_1000001365 | 190 |
| 76 | 3300025916 | Ga0207663_10001881 | Ga0207663_100018812 | 190 |
| 77 | 3300025928 | Ga0207700_10644168 | Ga0207700_106441682 | 190 |
| 78 | 3300025929 | Ga0207664_10082306 | Ga0207664_100823064 | 190 |
| 79 | 3300025939 | Ga0207665_10019820 | Ga0207665_100198206 | 190 |
| 80 | 3300025939 | Ga0207665_10079100 | Ga0207665_100791002 | 190 |
| 81 | 3300031090 | Ga0265760_10022950 | Ga0265760_100229502 | 190 |
| 82 | 3300035170 | Ga0373943_0135442 | Ga0373943_0135442_654_1238 | 190 |
| 83 | 3300037068 | Ga0373925_0010976 | Ga0373925_0010976_1419_2003 | 190 |
| 84 | 3300041496 | Ga0451839_1277567 | Ga0451839_1277567_90_665 | 190 |
| 85 | 3300044706 | Ga0466964_0033709 | Ga0466964_0033709_116_688 | 190 |
| 86 | 3300045049 | Ga0466959_0320400 | Ga0466959_0320400_379_954 | 190 |
| 87 | 3300045976 | Ga0466967_0028583 | Ga0466967_0028583_1396_1968 | 190 |
| 88 | 3300005290 | Ga0065712_10304804 | Ga0065712_103048041 | 191 |
| 89 | 3300005327 | Ga0070658_10754492 | Ga0070658_107544921 | 191 |
| 90 | 3300005328 | Ga0070676_10046894 | Ga0070676_100468941 | 191 |
| 91 | 3300005329 | Ga0070683_100005649 | Ga0070683_1000056493 | 191 |
| 92 | 3300005330 | Ga0070690_100061327 | Ga0070690_1000613272 | 191 |
| 93 | 3300005338 | Ga0068868_100004556 | Ga0068868_1000045567 | 191 |
| 94 | 3300005339 | Ga0070660_100067840 | Ga0070660_1000678403 | 191 |
| 95 | 3300005340 | Ga0070689_100063235 | Ga0070689_1000632355 | 191 |
| 96 | 3300005344 | Ga0070661_100057378 | Ga0070661_1000573782 | 191 |
| 97 | 3300005347 | Ga0070668_100005025 | Ga0070668_1000050259 | 191 |
| 98 | 3300005353 | Ga0070669_100651046 | Ga0070669_1006510461 | 191 |
| 99 | 3300005354 | Ga0070675_100130904 | Ga0070675_1001309043 | 191 |
| 100 | 3300005354 | Ga0070675_100584183 | Ga0070675_1005841832 | 191 |
| 101 | 3300005356 | Ga0070674_100220028 | Ga0070674_1002200282 | 191 |
| 102 | 3300005365 | Ga0070688_100187917 | Ga0070688_1001879172 | 191 |
| 103 | 3300005366 | Ga0070659_100004220 | Ga0070659_10000422010 | 191 |
| 104 | 3300005367 | Ga0070667_100011429 | Ga0070667_1000114298 | 191 |
| 105 | 3300005434 | Ga0070709_10007118 | Ga0070709_100071186 | 191 |
| 106 | 3300005435 | Ga0070714_100002862 | Ga0070714_10000286213 | 191 |
| 107 | 3300005436 | Ga0070713_100000057 | Ga0070713_10000005744 | 191 |
| 108 | 3300005439 | Ga0070711_100021372 | Ga0070711_1000213724 | 191 |
| 109 | 3300005440 | Ga0070705_100287051 | Ga0070705_1002870511 | 191 |
| 110 | 3300005444 | Ga0070694_100091865 | Ga0070694_1000918653 | 191 |
| 111 | 3300005445 | Ga0070708_100018463 | Ga0070708_1000184635 | 191 |
| 112 | 3300005455 | Ga0070663_100257779 | Ga0070663_1002577792 | 191 |
| 113 | 3300005457 | Ga0070662_100130123 | Ga0070662_1001301232 | 191 |
| 114 | 3300005458 | Ga0070681_10369159 | Ga0070681_103691591 | 191 |
| 115 | 3300005467 | Ga0070706_100261281 | Ga0070706_1002612812 | 191 |
| 116 | 3300005468 | Ga0070707_100030458 | Ga0070707_1000304585 | 191 |
| 117 | 3300005471 | Ga0070698_100126852 | Ga0070698_1001268523 | 191 |
| 118 | 3300005535 | Ga0070684_100032221 | Ga0070684_1000322212 | 191 |
| 119 | 3300005539 | Ga0068853_100341029 | Ga0068853_1003410292 | 191 |
| 120 | 3300005544 | Ga0070686_100146117 | Ga0070686_1001461172 | 191 |
| 121 | 3300005545 | Ga0070695_100055008 | Ga0070695_1000550082 | 191 |
| 122 | 3300005547 | Ga0070693_100777961 | Ga0070693_1007779611 | 191 |
| 123 | 3300005548 | Ga0070665_100025297 | Ga0070665_1000252975 | 191 |
| 124 | 3300005549 | Ga0070704_100074126 | Ga0070704_1000741263 | 191 |
| 125 | 3300005564 | Ga0070664_100107745 | Ga0070664_1001077453 | 191 |
| 126 | 3300005577 | Ga0068857_100099360 | Ga0068857_1000993603 | 191 |
| 127 | 3300005578 | Ga0068854_100093557 | Ga0068854_1000935571 | 191 |
| 128 | 3300005614 | Ga0068856_100044332 | Ga0068856_1000443325 | 191 |
| 129 | 3300005617 | Ga0068859_100021521 | Ga0068859_1000215215 | 191 |
| 130 | 3300005618 | Ga0068864_100163288 | Ga0068864_1001632882 | 191 |
| 131 | 3300005718 | Ga0068866_10109315 | Ga0068866_101093152 | 191 |
| 132 | 3300005719 | Ga0068861_100042481 | Ga0068861_1000424812 | 191 |
| 133 | 3300005834 | Ga0068851_10311291 | Ga0068851_103112912 | 191 |
| 134 | 3300005842 | Ga0068858_100068255 | Ga0068858_1000682551 | 191 |
| 135 | 3300005843 | Ga0068860_100098412 | Ga0068860_1000984122 | 191 |
| 136 | 3300005844 | Ga0068862_100010616 | Ga0068862_1000106167 | 191 |
| 137 | 3300006028 | Ga0070717_10001658 | Ga0070717_1000165814 | 191 |
| 138 | 3300006028 | Ga0070717_10012009 | Ga0070717_100120097 | 191 |
| 139 | 3300006175 | Ga0070712_100036544 | Ga0070712_1000365444 | 191 |
| 140 | 3300006175 | Ga0070712_100304398 | Ga0070712_1003043982 | 191 |
| 141 | 3300006237 | Ga0097621_100495087 | Ga0097621_1004950872 | 191 |
| 142 | 3300006358 | Ga0068871_100067623 | Ga0068871_1000676233 | 191 |
| 143 | 3300006852 | Ga0075433_10655289 | Ga0075433_106552892 | 191 |
| 144 | 3300006881 | Ga0068865_100115694 | Ga0068865_1001156942 | 191 |
| 145 | 3300006931 | Ga0097620_100021523 | Ga0097620_1000215235 | 191 |
| 146 | 3300009093 | Ga0105240_10039687 | Ga0105240_100396878 | 191 |
| 147 | 3300009093 | Ga0105240_10461079 | Ga0105240_104610791 | 191 |
| 148 | 3300009098 | Ga0105245_10034309 | Ga0105245_100343097 | 191 |
| 149 | 3300009101 | Ga0105247_10020036 | Ga0105247_100200363 | 191 |
| 150 | 3300009176 | Ga0105242_10217703 | Ga0105242_102177031 | 191 |
| 151 | 3300009177 | Ga0105248_10028234 | Ga0105248_100282346 | 191 |
| 152 | 3300009545 | Ga0105237_10643054 | Ga0105237_106430542 | 191 |
| 153 | 3300009551 | Ga0105238_10030176 | Ga0105238_100301767 | 191 |
| 154 | 3300009553 | Ga0105249_10089823 | Ga0105249_100898233 | 191 |
| 155 | 3300011119 | Ga0105246_10074648 | Ga0105246_100746482 | 191 |
| 156 | 3300013100 | Ga0157373_10322939 | Ga0157373_103229391 | 191 |
| 157 | 3300013102 | Ga0157371_10014882 | Ga0157371_100148825 | 191 |
| 158 | 3300013104 | Ga0157370_10314105 | Ga0157370_103141052 | 191 |
| 159 | 3300013105 | Ga0157369_10060956 | Ga0157369_100609564 | 191 |
| 160 | 3300013296 | Ga0157374_10030581 | Ga0157374_100305811 | 191 |
| 161 | 3300013297 | Ga0157378_10435188 | Ga0157378_104351882 | 191 |
| 162 | 3300013308 | Ga0157375_10110076 | Ga0157375_101100761 | 191 |
| 163 | 3300014325 | Ga0163163_10112727 | Ga0163163_101127273 | 191 |
| 164 | 3300014325 | Ga0163163_10152848 | Ga0163163_101528483 | 191 |
| 165 | 3300014969 | Ga0157376_10174796 | Ga0157376_101747963 | 191 |
| 166 | 3300014969 | Ga0157376_10180233 | Ga0157376_101802332 | 191 |
| 167 | 3300025321 | Ga0207656_10024608 | Ga0207656_100246083 | 191 |
| 168 | 3300025898 | Ga0207692_10037896 | Ga0207692_100378962 | 191 |
| 169 | 3300025899 | Ga0207642_10030947 | Ga0207642_100309473 | 191 |
| 170 | 3300025900 | Ga0207710_10101690 | Ga0207710_101016902 | 191 |
| 171 | 3300025903 | Ga0207680_10324478 | Ga0207680_103244782 | 191 |
| 172 | 3300025904 | Ga0207647_10015589 | Ga0207647_100155894 | 191 |
| 173 | 3300025906 | Ga0207699_10003495 | Ga0207699_100034956 | 191 |
| 174 | 3300025907 | Ga0207645_10004270 | Ga0207645_1000427010 | 191 |
| 175 | 3300025910 | Ga0207684_10207565 | Ga0207684_102075652 | 191 |
| 176 | 3300025912 | Ga0207707_10090077 | Ga0207707_100900773 | 191 |
| 177 | 3300025914 | Ga0207671_10453384 | Ga0207671_104533842 | 191 |
| 178 | 3300025915 | Ga0207693_10000143 | Ga0207693_100001434 | 191 |
| 179 | 3300025915 | Ga0207693_10275488 | Ga0207693_102754882 | 191 |
| 180 | 3300025916 | Ga0207663_10154117 | Ga0207663_101541172 | 191 |
| 181 | 3300025917 | Ga0207660_10639312 | Ga0207660_106393122 | 191 |
| 182 | 3300025919 | Ga0207657_10002502 | Ga0207657_100025027 | 191 |
| 183 | 3300025920 | Ga0207649_10032077 | Ga0207649_100320773 | 191 |
| 184 | 3300025921 | Ga0207652_10088156 | Ga0207652_100881563 | 191 |
| 185 | 3300025922 | Ga0207646_10167820 | Ga0207646_101678202 | 191 |
| 186 | 3300025924 | Ga0207694_10088049 | Ga0207694_100880494 | 191 |
| 187 | 3300025927 | Ga0207687_10032008 | Ga0207687_100320085 | 191 |
| 188 | 3300025928 | Ga0207700_10000337 | Ga0207700_100003377 | 191 |
| 189 | 3300025929 | Ga0207664_10013157 | Ga0207664_100131576 | 191 |
| 190 | 3300025932 | Ga0207690_10080728 | Ga0207690_100807281 | 191 |
| 191 | 3300025933 | Ga0207706_10001321 | Ga0207706_100013216 | 191 |
| 192 | 3300025934 | Ga0207686_10770868 | Ga0207686_107708681 | 191 |
| 193 | 3300025935 | Ga0207709_10047224 | Ga0207709_100472242 | 191 |
| 194 | 3300025937 | Ga0207669_10154973 | Ga0207669_101549733 | 191 |
| 195 | 3300025939 | Ga0207665_10046599 | Ga0207665_100465992 | 191 |
| 196 | 3300025941 | Ga0207711_10005468 | Ga0207711_100054688 | 191 |
| 197 | 3300025942 | Ga0207689_10021360 | Ga0207689_100213607 | 191 |
| 198 | 3300025944 | Ga0207661_11523938 | Ga0207661_115239381 | 191 |
| 199 | 3300025945 | Ga0207679_10778907 | Ga0207679_107789071 | 191 |
| 200 | 3300026041 | Ga0207639_10439738 | Ga0207639_104397382 | 191 |
| 201 | 3300026067 | Ga0207678_10000277 | Ga0207678_1000027711 | 191 |
| 202 | 3300026089 | Ga0207648_10017311 | Ga0207648_100173116 | 191 |
| 203 | 3300026095 | Ga0207676_10128670 | Ga0207676_101286703 | 191 |
| 204 | 3300026116 | Ga0207674_10012162 | Ga0207674_1001216210 | 191 |
| 205 | 3300026118 | Ga0207675_100243973 | Ga0207675_1002439731 | 191 |
| 206 | 3300028380 | Ga0268265_10066561 | Ga0268265_100665611 | 191 |
| 207 | 3300028381 | Ga0268264_10058821 | Ga0268264_100588213 | 191 |
| 208 | 3300030760 | Ga0265762_1001174 | Ga0265762_10011743 | 191 |
| 209 | 3300031344 | Ga0265316_10027901 | Ga0265316_100279016 | 191 |
| 210 | 3300034816 | Ga0373930_0047228 | Ga0373930_0047228_262_840 | 191 |
| 211 | 3300035088 | Ga0373940_0014887 | Ga0373940_0014887_191_769 | 191 |
| 212 | 3300035113 | Ga0373936_0107940 | Ga0373936_0107940_127_723 | 191 |
| 213 | 3300035114 | Ga0373939_0004499 | Ga0373939_0004499_2239_2817 | 191 |
| 214 | 3300035121 | Ga0373960_0007444 | Ga0373960_0007444_489_1067 | 191 |
| 215 | 3300035207 | Ga0373942_0077346 | Ga0373942_0077346_379_957 | 191 |
| 216 | 3300035691 | Ga0373931_0444078 | Ga0373931_0444078_167_745 | 191 |
| 217 | 3300036457 | Ga0265778_004477 | Ga0265778_004477_749_1324 | 191 |
| 218 | 3300037068 | Ga0373925_0358106 | Ga0373925_0358106_141_743 | 191 |
| 219 | 3300037418 | Ga0395900_1237968 | Ga0395900_1237968_19_597 | 191 |
| 220 | 3300042876 | Ga0451577_0984051 | Ga0451577_0984051_115_693 | 191 |
| 221 | 3300045051 | Ga0451576_0252655 | Ga0451576_0252655_635_1213 | 191 |
| 222 | 3300046472 | Ga0495580_0029919 | Ga0495580_0029919_2291_2869 | 191 |
| 223 | 3300046531 | Ga0495665_0148579 | Ga0495665_0148579_223_798 | 191 |
| 224 | 3300047319 | Ga0495674_0680826 | Ga0495674_0680826_58_645 | 191 |
| 225 | 3300048905 | Ga0496102_0052945 | Ga0496102_0052945_63_641 | 191 |
| 226 | 3300048907 | Ga0496104_0153745 | Ga0496104_0153745_1138_1734 | 191 |
| 227 | 3300048908 | Ga0496105_0647316 | Ga0496105_0647316_20_616 | 191 |
| 228 | 3300048909 | Ga0496106_0571434 | Ga0496106_0571434_83_661 | 191 |
| 229 | 3300048910 | Ga0496107_0599157 | Ga0496107_0599157_187_765 | 191 |
| 230 | 3300048913 | Ga0496110_1112353 | Ga0496110_1112353_33_611 | 191 |
| 231 | 3300048915 | Ga0496112_0011087 | Ga0496112_0011087_7346_7942 | 191 |
| 232 | 3300048915 | Ga0496112_0437180 | Ga0496112_0437180_651_1229 | 191 |
| 233 | 3300048916 | Ga0496113_0504423 | Ga0496113_0504423_360_956 | 191 |
| 234 | 3300048917 | Ga0496114_0056576 | Ga0496114_0056576_1992_2567 | 191 |
| 235 | 3300048918 | Ga0496115_0968686 | Ga0496115_0968686_16_594 | 191 |
| 236 | 3300050512 | nmdc:mga0n895_224433_c1 | nmdc:mga0n895_224433_c1_320_898 | 191 |
| 237 | 3300050515 | nmdc:mga0a205_617208_c1 | nmdc:mga0a205_617208_c1_268_858 | 191 |
| 238 | 3300001976 | JGI24752J21851_1003237 | JGI24752J21851_10032373 | 192 |
| 239 | 3300001990 | JGI24737J22298_10112947 | JGI24737J22298_101129472 | 192 |
| 240 | 3300002076 | JGI24749J21850_1009599 | JGI24749J21850_10095992 | 192 |
| 241 | 3300002459 | JGI24751J29686_10000764 | JGI24751J29686_100007642 | 192 |
| 242 | 3300005293 | Ga0065715_10134981 | Ga0065715_101349811 | 192 |
| 243 | 3300005293 | Ga0065715_10158482 | Ga0065715_101584821 | 192 |
| 244 | 3300005329 | Ga0070683_100407720 | Ga0070683_1004077201 | 192 |
| 245 | 3300005330 | Ga0070690_100272973 | Ga0070690_1002729732 | 192 |
| 246 | 3300005331 | Ga0070670_100194552 | Ga0070670_1001945523 | 192 |
| 247 | 3300005331 | Ga0070670_100338078 | Ga0070670_1003380781 | 192 |
| 248 | 3300005331 | Ga0070670_100380499 | Ga0070670_1003804991 | 192 |
| 249 | 3300005333 | Ga0070677_10239818 | Ga0070677_102398182 | 192 |
| 250 | 3300005334 | Ga0068869_100074119 | Ga0068869_1000741191 | 192 |
| 251 | 3300005334 | Ga0068869_100624253 | Ga0068869_1006242531 | 192 |
| 252 | 3300005336 | Ga0070680_100506119 | Ga0070680_1005061192 | 192 |
| 253 | 3300005338 | Ga0068868_100096044 | Ga0068868_1000960442 | 192 |
| 254 | 3300005339 | Ga0070660_100151726 | Ga0070660_1001517262 | 192 |
| 255 | 3300005340 | Ga0070689_100010090 | Ga0070689_1000100903 | 192 |
| 256 | 3300005343 | Ga0070687_100317222 | Ga0070687_1003172221 | 192 |
| 257 | 3300005344 | Ga0070661_100012749 | Ga0070661_1000127492 | 192 |
| 258 | 3300005345 | Ga0070692_10472005 | Ga0070692_104720051 | 192 |
| 259 | 3300005347 | Ga0070668_100418056 | Ga0070668_1004180562 | 192 |
| 260 | 3300005353 | Ga0070669_100511106 | Ga0070669_1005111062 | 192 |
| 261 | 3300005354 | Ga0070675_100059776 | Ga0070675_1000597764 | 192 |
| 262 | 3300005354 | Ga0070675_100666770 | Ga0070675_1006667702 | 192 |
| 263 | 3300005367 | Ga0070667_100073367 | Ga0070667_1000733673 | 192 |
| 264 | 3300005367 | Ga0070667_100730903 | Ga0070667_1007309032 | 192 |
| 265 | 3300005434 | Ga0070709_10010494 | Ga0070709_100104946 | 192 |
| 266 | 3300005434 | Ga0070709_10010869 | Ga0070709_100108699 | 192 |
| 267 | 3300005434 | Ga0070709_10046772 | Ga0070709_100467722 | 192 |
| 268 | 3300005434 | Ga0070709_10100077 | Ga0070709_101000771 | 192 |
| 269 | 3300005434 | Ga0070709_10455055 | Ga0070709_104550552 | 192 |
| 270 | 3300005435 | Ga0070714_100000046 | Ga0070714_10000004644 | 192 |
| 271 | 3300005436 | Ga0070713_100000583 | Ga0070713_1000005832 | 192 |
| 272 | 3300005436 | Ga0070713_100003196 | Ga0070713_1000031968 | 192 |
| 273 | 3300005436 | Ga0070713_100025850 | Ga0070713_1000258501 | 192 |
| 274 | 3300005436 | Ga0070713_100152369 | Ga0070713_1001523691 | 192 |
| 275 | 3300005436 | Ga0070713_100155028 | Ga0070713_1001550282 | 192 |
| 276 | 3300005436 | Ga0070713_100332154 | Ga0070713_1003321542 | 192 |
| 277 | 3300005436 | Ga0070713_100415804 | Ga0070713_1004158042 | 192 |
| 278 | 3300005436 | Ga0070713_101401111 | Ga0070713_1014011111 | 192 |
| 279 | 3300005437 | Ga0070710_10033046 | Ga0070710_100330463 | 192 |
| 280 | 3300005437 | Ga0070710_10209085 | Ga0070710_102090852 | 192 |
| 281 | 3300005439 | Ga0070711_100203206 | Ga0070711_1002032062 | 192 |
| 282 | 3300005439 | Ga0070711_100273015 | Ga0070711_1002730151 | 192 |
| 283 | 3300005439 | Ga0070711_100449068 | Ga0070711_1004490681 | 192 |
| 284 | 3300005440 | Ga0070705_100125960 | Ga0070705_1001259603 | 192 |
| 285 | 3300005445 | Ga0070708_100000437 | Ga0070708_10000043720 | 192 |
| 286 | 3300005445 | Ga0070708_100015048 | Ga0070708_1000150485 | 192 |
| 287 | 3300005445 | Ga0070708_100033060 | Ga0070708_1000330605 | 192 |
| 288 | 3300005445 | Ga0070708_100062121 | Ga0070708_1000621212 | 192 |
| 289 | 3300005445 | Ga0070708_100070749 | Ga0070708_1000707496 | 192 |
| 290 | 3300005445 | Ga0070708_100162121 | Ga0070708_1001621213 | 192 |
| 291 | 3300005445 | Ga0070708_100174578 | Ga0070708_1001745782 | 192 |
| 292 | 3300005445 | Ga0070708_100333521 | Ga0070708_1003335212 | 192 |
| 293 | 3300005455 | Ga0070663_100021022 | Ga0070663_1000210225 | 192 |
| 294 | 3300005456 | Ga0070678_100074534 | Ga0070678_1000745342 | 192 |
| 295 | 3300005457 | Ga0070662_100128251 | Ga0070662_1001282512 | 192 |
| 296 | 3300005458 | Ga0070681_10006550 | Ga0070681_100065503 | 192 |
| 297 | 3300005459 | Ga0068867_100053866 | Ga0068867_1000538662 | 192 |
| 298 | 3300005467 | Ga0070706_100000935 | Ga0070706_10000093528 | 192 |
| 299 | 3300005467 | Ga0070706_100003883 | Ga0070706_10000388311 | 192 |
| 300 | 3300005467 | Ga0070706_100006968 | Ga0070706_10000696812 | 192 |
| 301 | 3300005467 | Ga0070706_100064219 | Ga0070706_1000642192 | 192 |
| 302 | 3300005467 | Ga0070706_101016775 | Ga0070706_1010167751 | 192 |
| 303 | 3300005468 | Ga0070707_100001244 | Ga0070707_10000124420 | 192 |
| 304 | 3300005468 | Ga0070707_100002157 | Ga0070707_1000021577 | 192 |
| 305 | 3300005468 | Ga0070707_100003649 | Ga0070707_10000364911 | 192 |
| 306 | 3300005471 | Ga0070698_100001005 | Ga0070698_10000100520 | 192 |
| 307 | 3300005471 | Ga0070698_100002044 | Ga0070698_10000204417 | 192 |
| 308 | 3300005471 | Ga0070698_100159775 | Ga0070698_1001597752 | 192 |
| 309 | 3300005471 | Ga0070698_101022260 | Ga0070698_1010222601 | 192 |
| 310 | 3300005518 | Ga0070699_100001100 | Ga0070699_1000011008 | 192 |
| 311 | 3300005518 | Ga0070699_100002908 | Ga0070699_10000290818 | 192 |
| 312 | 3300005518 | Ga0070699_100235755 | Ga0070699_1002357552 | 192 |
| 313 | 3300005535 | Ga0070684_100030673 | Ga0070684_1000306736 | 192 |
| 314 | 3300005536 | Ga0070697_100000266 | Ga0070697_10000026621 | 192 |
| 315 | 3300005536 | Ga0070697_100000701 | Ga0070697_1000007015 | 192 |
| 316 | 3300005536 | Ga0070697_100016981 | Ga0070697_1000169816 | 192 |
| 317 | 3300005536 | Ga0070697_100058991 | Ga0070697_1000589912 | 192 |
| 318 | 3300005536 | Ga0070697_100061663 | Ga0070697_1000616635 | 192 |
| 319 | 3300005536 | Ga0070697_100131111 | Ga0070697_1001311111 | 192 |
| 320 | 3300005536 | Ga0070697_100668358 | Ga0070697_1006683581 | 192 |
| 321 | 3300005543 | Ga0070672_100661908 | Ga0070672_1006619081 | 192 |
| 322 | 3300005544 | Ga0070686_100128055 | Ga0070686_1001280552 | 192 |
| 323 | 3300005545 | Ga0070695_100103496 | Ga0070695_1001034962 | 192 |
| 324 | 3300005545 | Ga0070695_100719205 | Ga0070695_1007192051 | 192 |
| 325 | 3300005547 | Ga0070693_100099957 | Ga0070693_1000999572 | 192 |
| 326 | 3300005547 | Ga0070693_100192365 | Ga0070693_1001923651 | 192 |
| 327 | 3300005547 | Ga0070693_100293454 | Ga0070693_1002934541 | 192 |
| 328 | 3300005548 | Ga0070665_100533677 | Ga0070665_1005336772 | 192 |
| 329 | 3300005563 | Ga0068855_100077184 | Ga0068855_1000771843 | 192 |
| 330 | 3300005563 | Ga0068855_100568963 | Ga0068855_1005689632 | 192 |
| 331 | 3300005564 | Ga0070664_100222428 | Ga0070664_1002224281 | 192 |
| 332 | 3300005564 | Ga0070664_100896424 | Ga0070664_1008964241 | 192 |
| 333 | 3300005577 | Ga0068857_100002168 | Ga0068857_1000021687 | 192 |
| 334 | 3300005577 | Ga0068857_100044253 | Ga0068857_1000442534 | 192 |
| 335 | 3300005578 | Ga0068854_100302063 | Ga0068854_1003020633 | 192 |
| 336 | 3300005614 | Ga0068856_100018058 | Ga0068856_1000180587 | 192 |
| 337 | 3300005614 | Ga0068856_100021804 | Ga0068856_1000218043 | 192 |
| 338 | 3300005614 | Ga0068856_100211510 | Ga0068856_1002115101 | 192 |
| 339 | 3300005614 | Ga0068856_100256296 | Ga0068856_1002562963 | 192 |
| 340 | 3300005616 | Ga0068852_100011844 | Ga0068852_1000118448 | 192 |
| 341 | 3300005618 | Ga0068864_100073221 | Ga0068864_1000732213 | 192 |
| 342 | 3300005718 | Ga0068866_10020794 | Ga0068866_100207942 | 192 |
| 343 | 3300005719 | Ga0068861_100428115 | Ga0068861_1004281152 | 192 |
| 344 | 3300005834 | Ga0068851_10007547 | Ga0068851_100075477 | 192 |
| 345 | 3300005840 | Ga0068870_10010814 | Ga0068870_100108145 | 192 |
| 346 | 3300005841 | Ga0068863_100106501 | Ga0068863_1001065013 | 192 |
| 347 | 3300005841 | Ga0068863_100292337 | Ga0068863_1002923372 | 192 |
| 348 | 3300005842 | Ga0068858_100033597 | Ga0068858_1000335972 | 192 |
| 349 | 3300005842 | Ga0068858_101030596 | Ga0068858_1010305962 | 192 |
| 350 | 3300005843 | Ga0068860_100051564 | Ga0068860_1000515644 | 192 |
| 351 | 3300005843 | Ga0068860_100192215 | Ga0068860_1001922152 | 192 |
| 352 | 3300005844 | Ga0068862_100237907 | Ga0068862_1002379071 | 192 |
| 353 | 3300006028 | Ga0070717_10001093 | Ga0070717_100010935 | 192 |
| 354 | 3300006028 | Ga0070717_10051907 | Ga0070717_100519073 | 192 |
| 355 | 3300006028 | Ga0070717_10054243 | Ga0070717_100542433 | 192 |
| 356 | 3300006028 | Ga0070717_10072990 | Ga0070717_100729903 | 192 |
| 357 | 3300006028 | Ga0070717_10155358 | Ga0070717_101553582 | 192 |
| 358 | 3300006173 | Ga0070716_100029846 | Ga0070716_1000298463 | 192 |
| 359 | 3300006173 | Ga0070716_100043545 | Ga0070716_1000435452 | 192 |
| 360 | 3300006173 | Ga0070716_100123616 | Ga0070716_1001236162 | 192 |
| 361 | 3300006173 | Ga0070716_100125871 | Ga0070716_1001258712 | 192 |
| 362 | 3300006173 | Ga0070716_100240198 | Ga0070716_1002401982 | 192 |
| 363 | 3300006173 | Ga0070716_100428372 | Ga0070716_1004283722 | 192 |
| 364 | 3300006175 | Ga0070712_100000130 | Ga0070712_10000013034 | 192 |
| 365 | 3300006175 | Ga0070712_100006015 | Ga0070712_1000060157 | 192 |
| 366 | 3300006175 | Ga0070712_100037951 | Ga0070712_1000379513 | 192 |
| 367 | 3300006175 | Ga0070712_100095851 | Ga0070712_1000958513 | 192 |
| 368 | 3300006175 | Ga0070712_100205780 | Ga0070712_1002057801 | 192 |
| 369 | 3300006237 | Ga0097621_100144143 | Ga0097621_1001441433 | 192 |
| 370 | 3300006358 | Ga0068871_100166672 | Ga0068871_1001666723 | 192 |
| 371 | 3300006358 | Ga0068871_100261319 | Ga0068871_1002613192 | 192 |
| 372 | 3300006358 | Ga0068871_100311734 | Ga0068871_1003117342 | 192 |
| 373 | 3300006358 | Ga0068871_100317771 | Ga0068871_1003177712 | 192 |
| 374 | 3300007265 | Ga0099794_10302792 | Ga0099794_103027921 | 192 |
| 375 | 3300009092 | Ga0105250_10069541 | Ga0105250_100695413 | 192 |
| 376 | 3300009093 | Ga0105240_10037791 | Ga0105240_100377918 | 192 |
| 377 | 3300009093 | Ga0105240_10216890 | Ga0105240_102168903 | 192 |
| 378 | 3300009093 | Ga0105240_10314497 | Ga0105240_103144971 | 192 |
| 379 | 3300009093 | Ga0105240_10385045 | Ga0105240_103850452 | 192 |
| 380 | 3300009098 | Ga0105245_10010421 | Ga0105245_100104217 | 192 |
| 381 | 3300009098 | Ga0105245_10011580 | Ga0105245_100115802 | 192 |
| 382 | 3300009098 | Ga0105245_10126039 | Ga0105245_101260393 | 192 |
| 383 | 3300009098 | Ga0105245_10397236 | Ga0105245_103972362 | 192 |
| 384 | 3300009101 | Ga0105247_10061130 | Ga0105247_100611303 | 192 |
| 385 | 3300009101 | Ga0105247_10186684 | Ga0105247_101866843 | 192 |
| 386 | 3300009174 | Ga0105241_10001638 | Ga0105241_1000163811 | 192 |
| 387 | 3300009174 | Ga0105241_10014378 | Ga0105241_100143786 | 192 |
| 388 | 3300009174 | Ga0105241_10092985 | Ga0105241_100929854 | 192 |
| 389 | 3300009174 | Ga0105241_10201452 | Ga0105241_102014522 | 192 |
| 390 | 3300009177 | Ga0105248_10024998 | Ga0105248_100249987 | 192 |
| 391 | 3300009177 | Ga0105248_10477857 | Ga0105248_104778572 | 192 |
| 392 | 3300009545 | Ga0105237_10009832 | Ga0105237_100098323 | 192 |
| 393 | 3300009545 | Ga0105237_10039971 | Ga0105237_100399713 | 192 |
| 394 | 3300009545 | Ga0105237_10423771 | Ga0105237_104237712 | 192 |
| 395 | 3300009551 | Ga0105238_10137889 | Ga0105238_101378893 | 192 |
| 396 | 3300009551 | Ga0105238_10165197 | Ga0105238_101651971 | 192 |
| 397 | 3300009551 | Ga0105238_11074347 | Ga0105238_110743471 | 192 |
| 398 | 3300009551 | Ga0105238_11329721 | Ga0105238_113297211 | 192 |
| 399 | 3300009553 | Ga0105249_10032205 | Ga0105249_100322053 | 192 |
| 400 | 3300009553 | Ga0105249_10071939 | Ga0105249_100719392 | 192 |
| 401 | 3300011119 | Ga0105246_10202787 | Ga0105246_102027872 | 192 |
| 402 | 3300013100 | Ga0157373_10001299 | Ga0157373_1000129910 | 192 |
| 403 | 3300013100 | Ga0157373_10004687 | Ga0157373_100046876 | 192 |
| 404 | 3300013100 | Ga0157373_10535255 | Ga0157373_105352551 | 192 |
| 405 | 3300013102 | Ga0157371_10008938 | Ga0157371_100089387 | 192 |
| 406 | 3300013104 | Ga0157370_10016617 | Ga0157370_100166172 | 192 |
| 407 | 3300013105 | Ga0157369_10031049 | Ga0157369_100310499 | 192 |
| 408 | 3300013105 | Ga0157369_10201939 | Ga0157369_102019392 | 192 |
| 409 | 3300013105 | Ga0157369_10323184 | Ga0157369_103231842 | 192 |
| 410 | 3300013296 | Ga0157374_10013788 | Ga0157374_1001378810 | 192 |
| 411 | 3300013296 | Ga0157374_10038624 | Ga0157374_100386245 | 192 |
| 412 | 3300013296 | Ga0157374_10062225 | Ga0157374_100622252 | 192 |
| 413 | 3300013296 | Ga0157374_10291834 | Ga0157374_102918342 | 192 |
| 414 | 3300013296 | Ga0157374_10403686 | Ga0157374_104036862 | 192 |
| 415 | 3300013297 | Ga0157378_10983779 | Ga0157378_109837792 | 192 |
| 416 | 3300013306 | Ga0163162_10001531 | Ga0163162_100015318 | 192 |
| 417 | 3300013306 | Ga0163162_10015654 | Ga0163162_100156546 | 192 |
| 418 | 3300013306 | Ga0163162_10373372 | Ga0163162_103733722 | 192 |
| 419 | 3300013307 | Ga0157372_10015799 | Ga0157372_1001579910 | 192 |
| 420 | 3300013307 | Ga0157372_10039702 | Ga0157372_100397023 | 192 |
| 421 | 3300013307 | Ga0157372_10078707 | Ga0157372_100787071 | 192 |
| 422 | 3300013308 | Ga0157375_10288099 | Ga0157375_102880992 | 192 |
| 423 | 3300013308 | Ga0157375_12098690 | Ga0157375_120986901 | 192 |
| 424 | 3300014325 | Ga0163163_10010127 | Ga0163163_100101278 | 192 |
| 425 | 3300014325 | Ga0163163_10040139 | Ga0163163_100401394 | 192 |
| 426 | 3300014325 | Ga0163163_10116898 | Ga0163163_101168984 | 192 |
| 427 | 3300014325 | Ga0163163_10300583 | Ga0163163_103005831 | 192 |
| 428 | 3300014325 | Ga0163163_11031706 | Ga0163163_110317061 | 192 |
| 429 | 3300014745 | Ga0157377_10021473 | Ga0157377_100214734 | 192 |
| 430 | 3300014968 | Ga0157379_10001261 | Ga0157379_1000126121 | 192 |
| 431 | 3300014968 | Ga0157379_10007858 | Ga0157379_100078589 | 192 |
| 432 | 3300014968 | Ga0157379_10078446 | Ga0157379_100784461 | 192 |
| 433 | 3300014968 | Ga0157379_10241143 | Ga0157379_102411433 | 192 |
| 434 | 3300014969 | Ga0157376_10917042 | Ga0157376_109170422 | 192 |
| 435 | 3300019183 | Ga0184601_104320 | Ga0184601_1043201 | 192 |
| 436 | 3300021377 | Ga0213874_10063999 | Ga0213874_100639992 | 192 |
| 437 | 3300022730 | Ga0224570_100291 | Ga0224570_1002913 | 192 |
| 438 | 3300023672 | Ga0247553_100308 | Ga0247553_1003082 | 192 |
| 439 | 3300024225 | Ga0224572_1000408 | Ga0224572_10004083 | 192 |
| 440 | 3300024227 | Ga0228598_1002732 | Ga0228598_10027323 | 192 |
| 441 | 3300024227 | Ga0228598_1020970 | Ga0228598_10209702 | 192 |
| 442 | 3300025898 | Ga0207692_10025360 | Ga0207692_100253603 | 192 |
| 443 | 3300025906 | Ga0207699_10000528 | Ga0207699_100005285 | 192 |
| 444 | 3300025906 | Ga0207699_10012963 | Ga0207699_100129635 | 192 |
| 445 | 3300025906 | Ga0207699_10170108 | Ga0207699_101701081 | 192 |
| 446 | 3300025906 | Ga0207699_10246783 | Ga0207699_102467831 | 192 |
| 447 | 3300025906 | Ga0207699_10452759 | Ga0207699_104527591 | 192 |
| 448 | 3300025906 | Ga0207699_10489048 | Ga0207699_104890481 | 192 |
| 449 | 3300025910 | Ga0207684_10000274 | Ga0207684_1000027421 | 192 |
| 450 | 3300025910 | Ga0207684_10003347 | Ga0207684_1000334713 | 192 |
| 451 | 3300025910 | Ga0207684_10019671 | Ga0207684_100196715 | 192 |
| 452 | 3300025910 | Ga0207684_10096830 | Ga0207684_100968302 | 192 |
| 453 | 3300025910 | Ga0207684_10145762 | Ga0207684_101457624 | 192 |
| 454 | 3300025911 | Ga0207654_10139287 | Ga0207654_101392872 | 192 |
| 455 | 3300025911 | Ga0207654_10232786 | Ga0207654_102327862 | 192 |
| 456 | 3300025912 | Ga0207707_10009709 | Ga0207707_100097099 | 192 |
| 457 | 3300025912 | Ga0207707_10196174 | Ga0207707_101961741 | 192 |
| 458 | 3300025913 | Ga0207695_10047537 | Ga0207695_100475374 | 192 |
| 459 | 3300025914 | Ga0207671_10332065 | Ga0207671_103320652 | 192 |
| 460 | 3300025915 | Ga0207693_10002309 | Ga0207693_1000230911 | 192 |
| 461 | 3300025915 | Ga0207693_10004457 | Ga0207693_100044578 | 192 |
| 462 | 3300025915 | Ga0207693_10014717 | Ga0207693_100147178 | 192 |
| 463 | 3300025915 | Ga0207693_10062201 | Ga0207693_100622012 | 192 |
| 464 | 3300025915 | Ga0207693_10275187 | Ga0207693_102751872 | 192 |
| 465 | 3300025916 | Ga0207663_10012032 | Ga0207663_100120324 | 192 |
| 466 | 3300025916 | Ga0207663_10887446 | Ga0207663_108874461 | 192 |
| 467 | 3300025922 | Ga0207646_10000240 | Ga0207646_1000024021 | 192 |
| 468 | 3300025922 | Ga0207646_10000341 | Ga0207646_1000034115 | 192 |
| 469 | 3300025922 | Ga0207646_10113350 | Ga0207646_101133502 | 192 |
| 470 | 3300025922 | Ga0207646_10294921 | Ga0207646_102949211 | 192 |
| 471 | 3300025922 | Ga0207646_10617367 | Ga0207646_106173671 | 192 |
| 472 | 3300025924 | Ga0207694_10391345 | Ga0207694_103913451 | 192 |
| 473 | 3300025924 | Ga0207694_10576520 | Ga0207694_105765201 | 192 |
| 474 | 3300025925 | Ga0207650_10295167 | Ga0207650_102951671 | 192 |
| 475 | 3300025927 | Ga0207687_10100734 | Ga0207687_101007343 | 192 |
| 476 | 3300025928 | Ga0207700_10000346 | Ga0207700_1000034619 | 192 |
| 477 | 3300025928 | Ga0207700_10012848 | Ga0207700_100128484 | 192 |
| 478 | 3300025928 | Ga0207700_10066360 | Ga0207700_100663603 | 192 |
| 479 | 3300025928 | Ga0207700_10219183 | Ga0207700_102191833 | 192 |
| 480 | 3300025928 | Ga0207700_10370578 | Ga0207700_103705782 | 192 |
| 481 | 3300025928 | Ga0207700_10392450 | Ga0207700_103924502 | 192 |
| 482 | 3300025929 | Ga0207664_10000201 | Ga0207664_1000020144 | 192 |
| 483 | 3300025929 | Ga0207664_10392487 | Ga0207664_103924872 | 192 |
| 484 | 3300025939 | Ga0207665_10003598 | Ga0207665_100035989 | 192 |
| 485 | 3300025939 | Ga0207665_10014974 | Ga0207665_100149741 | 192 |
| 486 | 3300025939 | Ga0207665_10050393 | Ga0207665_100503932 | 192 |
| 487 | 3300025939 | Ga0207665_10068696 | Ga0207665_100686963 | 192 |
| 488 | 3300025939 | Ga0207665_10140700 | Ga0207665_101407002 | 192 |
| 489 | 3300025939 | Ga0207665_10299628 | Ga0207665_102996282 | 192 |
| 490 | 3300025941 | Ga0207711_10332417 | Ga0207711_103324172 | 192 |
| 491 | 3300025942 | Ga0207689_10291861 | Ga0207689_102918613 | 192 |
| 492 | 3300025945 | Ga0207679_10822240 | Ga0207679_108222401 | 192 |
| 493 | 3300025949 | Ga0207667_10353783 | Ga0207667_103537832 | 192 |
| 494 | 3300025949 | Ga0207667_10451906 | Ga0207667_104519061 | 192 |
| 495 | 3300025981 | Ga0207640_10391143 | Ga0207640_103911431 | 192 |
| 496 | 3300025981 | Ga0207640_11263669 | Ga0207640_112636691 | 192 |
| 497 | 3300025986 | Ga0207658_10169082 | Ga0207658_101690822 | 192 |
| 498 | 3300025986 | Ga0207658_10625454 | Ga0207658_106254541 | 192 |
| 499 | 3300026023 | Ga0207677_10052606 | Ga0207677_100526062 | 192 |
| 500 | 3300026023 | Ga0207677_10268477 | Ga0207677_102684772 | 192 |
| 501 | 3300026078 | Ga0207702_10010742 | Ga0207702_100107425 | 192 |
| 502 | 3300026078 | Ga0207702_10089073 | Ga0207702_100890732 | 192 |
| 503 | 3300026078 | Ga0207702_10505245 | Ga0207702_105052452 | 192 |
| 504 | 3300026088 | Ga0207641_10049231 | Ga0207641_100492314 | 192 |
| 505 | 3300026088 | Ga0207641_10331212 | Ga0207641_103312122 | 192 |
| 506 | 3300026088 | Ga0207641_10421987 | Ga0207641_104219871 | 192 |
| 507 | 3300026116 | Ga0207674_10016566 | Ga0207674_100165664 | 192 |
| 508 | 3300026116 | Ga0207674_10181249 | Ga0207674_101812493 | 192 |
| 509 | 3300026121 | Ga0207683_10160969 | Ga0207683_101609694 | 192 |
| 510 | 3300028017 | Ga0265356_1001162 | Ga0265356_10011622 | 192 |
| 511 | 3300028017 | Ga0265356_1002472 | Ga0265356_10024722 | 192 |
| 512 | 3300028379 | Ga0268266_10305898 | Ga0268266_103058982 | 192 |
| 513 | 3300028381 | Ga0268264_10042134 | Ga0268264_100421344 | 192 |
| 514 | 3300028800 | Ga0265338_10024720 | Ga0265338_100247203 | 192 |
| 515 | 3300028800 | Ga0265338_10367482 | Ga0265338_103674821 | 192 |
| 516 | 3300030836 | Ga0265767_100901 | Ga0265767_1009012 | 192 |
| 517 | 3300030877 | Ga0265777_101754 | Ga0265777_1017542 | 192 |
| 518 | 3300030879 | Ga0265765_1012605 | Ga0265765_10126052 | 192 |
| 519 | 3300030882 | Ga0265764_103767 | Ga0265764_1037671 | 192 |
| 520 | 3300031010 | Ga0265771_1011809 | Ga0265771_10118091 | 192 |
| 521 | 3300031090 | Ga0265760_10003825 | Ga0265760_100038253 | 192 |
| 522 | 3300031090 | Ga0265760_10007880 | Ga0265760_100078801 | 192 |
| 523 | 3300031247 | Ga0265340_10095583 | Ga0265340_100955832 | 192 |
| 524 | 3300031249 | Ga0265339_10020315 | Ga0265339_100203153 | 192 |
| 525 | 3300031249 | Ga0265339_10030436 | Ga0265339_100304362 | 192 |
| 526 | 3300031249 | Ga0265339_10033158 | Ga0265339_100331584 | 192 |
| 527 | 3300031249 | Ga0265339_10149990 | Ga0265339_101499902 | 192 |
| 528 | 3300031344 | Ga0265316_10002054 | Ga0265316_1000205417 | 192 |
| 529 | 3300031344 | Ga0265316_10049817 | Ga0265316_100498175 | 192 |
| 530 | 3300031711 | Ga0265314_10000348 | Ga0265314_1000034835 | 192 |
| 531 | 3300031711 | Ga0265314_10023827 | Ga0265314_100238275 | 192 |
| 532 | 3300031711 | Ga0265314_10074163 | Ga0265314_100741631 | 192 |
| 533 | 3300031711 | Ga0265314_10100093 | Ga0265314_101000931 | 192 |
| 534 | 3300031712 | Ga0265342_10048686 | Ga0265342_100486862 | 192 |
| 535 | 3300031712 | Ga0265342_10295034 | Ga0265342_102950341 | 192 |
| 536 | 3300032120 | Ga0316053_100216 | Ga0316053_1002162 | 192 |
| 537 | 3300033547 | Ga0316212_1006664 | Ga0316212_10066642 | 192 |
| 538 | 3300033547 | Ga0316212_1019356 | Ga0316212_10193561 | 192 |
| 539 | 3300035083 | Ga0373926_0005377 | Ga0373926_0005377_1614_2195 | 192 |
| 540 | 3300035086 | Ga0373934_0038417 | Ga0373934_0038417_522_1100 | 192 |
| 541 | 3300035091 | Ga0373951_0025103 | Ga0373951_0025103_589_1173 | 192 |
| 542 | 3300035111 | Ga0373923_0008953 | Ga0373923_0008953_1082_1663 | 192 |
| 543 | 3300035112 | Ga0373932_0015752 | Ga0373932_0015752_317_901 | 192 |
| 544 | 3300035113 | Ga0373936_0000275 | Ga0373936_0000275_6958_7539 | 192 |
| 545 | 3300035113 | Ga0373936_0018891 | Ga0373936_0018891_25_606 | 192 |
| 546 | 3300035116 | Ga0373945_0053857 | Ga0373945_0053857_182_763 | 192 |
| 547 | 3300035117 | Ga0373953_0057031 | Ga0373953_0057031_161_742 | 192 |
| 548 | 3300035118 | Ga0373954_0029119 | Ga0373954_0029119_1115_1696 | 192 |
| 549 | 3300035119 | Ga0373956_0035693 | Ga0373956_0035693_475_1056 | 192 |
| 550 | 3300035170 | Ga0373943_0000011 | Ga0373943_0000011_50195_50776 | 192 |
| 551 | 3300035170 | Ga0373943_0136882 | Ga0373943_0136882_573_1154 | 192 |
| 552 | 3300035171 | Ga0373946_0004868 | Ga0373946_0004868_581_1162 | 192 |
| 553 | 3300035172 | Ga0373955_0419814 | Ga0373955_0419814_11_592 | 192 |
| 554 | 3300035410 | Ga0373924_0015151 | Ga0373924_0015151_2146_2727 | 192 |
| 555 | 3300035410 | Ga0373924_0082057 | Ga0373924_0082057_191_778 | 192 |
| 556 | 3300035410 | Ga0373924_0085550 | Ga0373924_0085550_46_639 | 192 |
| 557 | 3300035691 | Ga0373931_0008821 | Ga0373931_0008821_3170_3754 | 192 |
| 558 | 3300035692 | Ga0373935_0001861 | Ga0373935_0001861_8691_9272 | 192 |
| 559 | 3300035695 | Ga0373927_0000604 | Ga0373927_0000604_1081_1662 | 192 |
| 560 | 3300035695 | Ga0373927_0199084 | Ga0373927_0199084_251_844 | 192 |
| 561 | 3300035695 | Ga0373927_0279037 | Ga0373927_0279037_28_609 | 192 |
| 562 | 3300035724 | Ga0373933_0021828 | Ga0373933_0021828_2529_3116 | 192 |
| 563 | 3300035724 | Ga0373933_0200177 | Ga0373933_0200177_128_712 | 192 |
| 564 | 3300035725 | Ga0373947_0000784 | Ga0373947_0000784_18110_18691 | 192 |
| 565 | 3300036401 | Ga0373937_0096584 | Ga0373937_0096584_740_1318 | 192 |
| 566 | 3300036401 | Ga0373937_0373907 | Ga0373937_0373907_556_1149 | 192 |
| 567 | 3300036401 | Ga0373937_0489643 | Ga0373937_0489643_564_1151 | 192 |
| 568 | 3300037068 | Ga0373925_0001438 | Ga0373925_0001438_14454_15035 | 192 |
| 569 | 3300037068 | Ga0373925_0012397 | Ga0373925_0012397_2354_2935 | 192 |
| 570 | 3300039450 | Ga0436363_0451864 | Ga0436363_0451864_1378_1962 | 192 |
| 571 | 3300042876 | Ga0451577_0000241 | Ga0451577_0000241_95474_96064 | 192 |
| 572 | 3300042876 | Ga0451577_0677628 | Ga0451577_0677628_123_722 | 192 |
| 573 | 3300044694 | Ga0466963_0085737 | Ga0466963_0085737_400_990 | 192 |
| 574 | 3300044712 | Ga0453684_0000366 | Ga0453684_0000366_85301_85891 | 192 |
| 575 | 3300044712 | Ga0453684_0738228 | Ga0453684_0738228_44_637 | 192 |
| 576 | 3300044712 | Ga0453684_1510077 | Ga0453684_1510077_78_671 | 192 |
| 577 | 3300045051 | Ga0451576_0005686 | Ga0451576_0005686_811_1401 | 192 |
| 578 | 3300045051 | Ga0451576_0641173 | Ga0451576_0641173_294_887 | 192 |
| 579 | 3300045976 | Ga0466967_0028774 | Ga0466967_0028774_1173_1760 | 192 |
| 580 | 3300045976 | Ga0466967_0086055 | Ga0466967_0086055_2096_2686 | 192 |
| 581 | 3300046463 | Ga0495653_0083918 | Ga0495653_0083918_85_666 | 192 |
| 582 | 3300046472 | Ga0495580_0008969 | Ga0495580_0008969_1900_2481 | 192 |
| 583 | 3300046472 | Ga0495580_0023555 | Ga0495580_0023555_949_1542 | 192 |
| 584 | 3300046472 | Ga0495580_0263134 | Ga0495580_0263134_302_886 | 192 |
| 585 | 3300046473 | Ga0495582_0230587 | Ga0495582_0230587_405_998 | 192 |
| 586 | 3300046473 | Ga0495582_0373567 | Ga0495582_0373567_115_693 | 192 |
| 587 | 3300046477 | Ga0495664_0081079 | Ga0495664_0081079_1210_1791 | 192 |
| 588 | 3300046511 | Ga0495608_0268191 | Ga0495608_0268191_410_991 | 192 |
| 589 | 3300046511 | Ga0495608_0494284 | Ga0495608_0494284_68_661 | 192 |
| 590 | 3300046526 | Ga0495666_0151103 | Ga0495666_0151103_426_1004 | 192 |
| 591 | 3300046531 | Ga0495665_0332171 | Ga0495665_0332171_159_752 | 192 |
| 592 | 3300046543 | Ga0495645_0264922 | Ga0495645_0264922_204_785 | 192 |
| 593 | 3300046559 | Ga0495667_0170990 | Ga0495667_0170990_578_1171 | 192 |
| 594 | 3300046663 | Ga0495635_0029277 | Ga0495635_0029277_1391_1984 | 192 |
| 595 | 3300046675 | Ga0495657_0142812 | Ga0495657_0142812_499_1092 | 192 |
| 596 | 3300046675 | Ga0495657_0287746 | Ga0495657_0287746_66_659 | 192 |
| 597 | 3300046684 | Ga0495669_0002318 | Ga0495669_0002318_2072_2665 | 192 |
| 598 | 3300046684 | Ga0495669_0029992 | Ga0495669_0029992_55_648 | 192 |
| 599 | 3300047315 | Ga0495581_0088528 | Ga0495581_0088528_1153_1746 | 192 |
| 600 | 3300047319 | Ga0495674_0020609 | Ga0495674_0020609_5112_5693 | 192 |
| 601 | 3300047319 | Ga0495674_0343071 | Ga0495674_0343071_273_857 | 192 |
| 602 | 3300047444 | Ga0495675_0247434 | Ga0495675_0247434_276_866 | 192 |
| 603 | 3300047445 | Ga0495677_0093393 | Ga0495677_0093393_521_1114 | 192 |
| 604 | 3300048088 | Ga0495602_0156508 | Ga0495602_0156508_1164_1745 | 192 |
| 605 | 3300048088 | Ga0495602_0175584 | Ga0495602_0175584_560_1150 | 192 |
| 606 | 3300048088 | Ga0495602_0213169 | Ga0495602_0213169_412_999 | 192 |
| 607 | 3300048903 | Ga0496100_0060824 | Ga0496100_0060824_723_1307 | 192 |
| 608 | 3300048904 | Ga0496101_0052231 | Ga0496101_0052231_1846_2430 | 192 |
| 609 | 3300048904 | Ga0496101_0318450 | Ga0496101_0318450_465_1058 | 192 |
| 610 | 3300048905 | Ga0496102_0005937 | Ga0496102_0005937_8144_8728 | 192 |
| 611 | 3300048905 | Ga0496102_0363101 | Ga0496102_0363101_111_701 | 192 |
| 612 | 3300048906 | Ga0496103_0008297 | Ga0496103_0008297_924_1508 | 192 |
| 613 | 3300048907 | Ga0496104_0308672 | Ga0496104_0308672_458_1051 | 192 |
| 614 | 3300048908 | Ga0496105_0211209 | Ga0496105_0211209_423_1007 | 192 |
| 615 | 3300048908 | Ga0496105_0247897 | Ga0496105_0247897_250_834 | 192 |
| 616 | 3300048908 | Ga0496105_0649248 | Ga0496105_0649248_51_635 | 192 |
| 617 | 3300048909 | Ga0496106_0247080 | Ga0496106_0247080_832_1416 | 192 |
| 618 | 3300048910 | Ga0496107_0042844 | Ga0496107_0042844_204_788 | 192 |
| 619 | 3300048910 | Ga0496107_0361623 | Ga0496107_0361623_13_603 | 192 |
| 620 | 3300048911 | Ga0496108_0124534 | Ga0496108_0124534_173_766 | 192 |
| 621 | 3300048911 | Ga0496108_0355645 | Ga0496108_0355645_570_1154 | 192 |
| 622 | 3300048911 | Ga0496108_0391978 | Ga0496108_0391978_95_679 | 192 |
| 623 | 3300048912 | Ga0496109_0335280 | Ga0496109_0335280_328_912 | 192 |
| 624 | 3300048913 | Ga0496110_0552566 | Ga0496110_0552566_49_642 | 192 |
| 625 | 3300048915 | Ga0496112_0058500 | Ga0496112_0058500_1361_1951 | 192 |
| 626 | 3300048915 | Ga0496112_0089568 | Ga0496112_0089568_392_976 | 192 |
| 627 | 3300048915 | Ga0496112_0094726 | Ga0496112_0094726_1221_1814 | 192 |
| 628 | 3300048915 | Ga0496112_0619466 | Ga0496112_0619466_334_927 | 192 |
| 629 | 3300048916 | Ga0496113_0015649 | Ga0496113_0015649_3490_4083 | 192 |
| 630 | 3300048917 | Ga0496114_0059045 | Ga0496114_0059045_116_700 | 192 |
| 631 | 3300048918 | Ga0496115_0017969 | Ga0496115_0017969_769_1353 | 192 |
| 632 | 3300048918 | Ga0496115_0635984 | Ga0496115_0635984_81_668 | 192 |
| 633 | 3300049744 | Ga0501083_0026123 | Ga0501083_0026123_3223_3804 | 192 |
| 634 | 3300049744 | Ga0501083_0085897 | Ga0501083_0085897_933_1514 | 192 |
| 635 | 3300005338 | Ga0068868_100743530 | Ga0068868_1007435302 | 193 |
| 636 | 3300024227 | Ga0228598_1000383 | Ga0228598_10003837 | 195 |
| 637 | 3300031090 | Ga0265760_10034347 | Ga0265760_100343471 | 195 |
| 638 | 3300005445 | Ga0070708_100055671 | Ga0070708_1000556715 | 196 |
| 639 | 3300005518 | Ga0070699_100033580 | Ga0070699_1000335805 | 196 |
| 640 | 3300007265 | Ga0099794_10011693 | Ga0099794_100116933 | 196 |
| 641 | 3300025922 | Ga0207646_10411798 | Ga0207646_104117982 | 196 |
| 642 | 3300035083 | Ga0373926_0168743 | Ga0373926_0168743_192_797 | 196 |
| 643 | 3300037068 | Ga0373925_0081841 | Ga0373925_0081841_1534_2148 | 196 |
| 644 | 3300046517 | Ga0495630_0273204 | Ga0495630_0273204_217_831 | 196 |
| 645 | 3300031090 | Ga0265760_10000817 | Ga0265760_100008176 | 197 |
| 646 | 3300035170 | Ga0373943_0052333 | Ga0373943_0052333_30_647 | 197 |
| 647 | 3300035724 | Ga0373933_0050277 | Ga0373933_0050277_1067_1675 | 197 |
| 648 | 3300036401 | Ga0373937_0114777 | Ga0373937_0114777_734_1342 | 197 |
| 649 | 3300037068 | Ga0373925_0026046 | Ga0373925_0026046_2695_3312 | 197 |
| 650 | 3300046472 | Ga0495580_0069661 | Ga0495580_0069661_1081_1698 | 197 |
| 651 | 3300046473 | Ga0495582_0014062 | Ga0495582_0014062_2705_3322 | 197 |
| 652 | 3300046543 | Ga0495645_0405866 | Ga0495645_0405866_21_629 | 197 |
| 653 | 3300047319 | Ga0495674_0234772 | Ga0495674_0234772_326_967 | 197 |
| 654 | 3300047322 | Ga0495680_0357459 | Ga0495680_0357459_345_983 | 197 |
| 655 | 3300048088 | Ga0495602_0270263 | Ga0495602_0270263_556_1164 | 197 |
| 656 | 3300000546 | LJNas_1000260 | LJNas_10002604 | 198 |
| 657 | 3300005334 | Ga0068869_100689783 | Ga0068869_1006897831 | 198 |
| 658 | 3300005338 | Ga0068868_100355108 | Ga0068868_1003551082 | 198 |
| 659 | 3300005445 | Ga0070708_100334466 | Ga0070708_1003344662 | 198 |
| 660 | 3300005467 | Ga0070706_100577490 | Ga0070706_1005774902 | 198 |
| 661 | 3300005468 | Ga0070707_100395934 | Ga0070707_1003959342 | 198 |
| 662 | 3300005518 | Ga0070699_100037176 | Ga0070699_1000371761 | 198 |
| 663 | 3300005614 | Ga0068856_100064873 | Ga0068856_1000648732 | 198 |
| 664 | 3300009098 | Ga0105245_10616474 | Ga0105245_106164742 | 198 |
| 665 | 3300022734 | Ga0224571_100317 | Ga0224571_1003173 | 198 |
| 666 | 3300024225 | Ga0224572_1004935 | Ga0224572_10049353 | 198 |
| 667 | 3300025910 | Ga0207684_10517208 | Ga0207684_105172082 | 198 |
| 668 | 3300025922 | Ga0207646_10327932 | Ga0207646_103279322 | 198 |
| 669 | 3300025942 | Ga0207689_10745622 | Ga0207689_107456221 | 198 |
| 670 | 3300026078 | Ga0207702_10010133 | Ga0207702_100101336 | 198 |
| 671 | 3300028558 | Ga0265326_10066592 | Ga0265326_100665922 | 198 |
| 672 | 3300031090 | Ga0265760_10001979 | Ga0265760_100019797 | 198 |
| 673 | 3300031235 | Ga0265330_10009005 | Ga0265330_100090055 | 198 |
| 674 | 3300031247 | Ga0265340_10044209 | Ga0265340_100442093 | 198 |
| 675 | 3300037068 | Ga0373925_0305927 | Ga0373925_0305927_196_822 | 198 |
| 676 | 3300046457 | Ga0495590_0025074 | Ga0495590_0025074_639_1277 | 198 |
| 677 | 3300046472 | Ga0495580_0305002 | Ga0495580_0305002_112_717 | 198 |
| 678 | 3300046477 | Ga0495664_0220452 | Ga0495664_0220452_167_793 | 198 |
| 679 | 3300046517 | Ga0495630_0122804 | Ga0495630_0122804_1208_1834 | 198 |
| 680 | 3300046533 | Ga0495640_0064350 | Ga0495640_0064350_172_798 | 198 |
| 681 | 3300046678 | Ga0495599_0184764 | Ga0495599_0184764_185_811 | 198 |
| 682 | 3300046683 | Ga0495658_0069689 | Ga0495658_0069689_237_860 | 198 |
| 683 | 3300047319 | Ga0495674_0010911 | Ga0495674_0010911_5377_6003 | 198 |
| 684 | 3300047673 | Ga0495593_0208859 | Ga0495593_0208859_287_913 | 198 |
| 685 | 3300053077 | Ga0495601_0131310 | Ga0495601_0131310_980_1606 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.933 | 5 | 194 |
| 1ryb-assembly1.cif.gz_A | crystal structure of the chloroplast group ii intron splicing factor crs2 | 0.9314 | 7 | 183 |
| 7brd-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae | 0.9305 | 7 | 191 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9292 | 8 | 194 |
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9274 | 5 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54V95_265_452_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9285 | 66 | 193 | 3.40.50.1470 |
| 4q55B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9224 | 7 | 193 | 3.40.50.1470 |
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9162 | 8 | 198 | 3.40.50.1470 |
| 1rynA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9153 | 8 | 192 | 3.40.50.1470 |
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9124 | 4 | 191 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1IHG4-F1-model_v4 | Peptidyl-tRNA hydrolase | 0.9897 | 92 | 193 |
GO:0004045
|
| AF-A0A2V9ZXL4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.974 | 8 | 193 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-G2LJA4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9665 | 8 | 193 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A7W1T158-F1-model_v4 | Aminoacyl-tRNA hydrolase (EC 3.1.1.29) | 0.9656 | 41 | 198 |
GO:0004045
|
| AF-A0A2V9ZXL4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9638 | 8 | 193 |
GO:0004045
GO:0005737 GO:0006412 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar