F475108

General Info

Members Datasets Scaffolds Average Seq Length
685 268 685 195

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100334466|Ga0070708_1003344662
Length 228
Sequence LPVRPSAKRGRRPEGFARRNRVDECVRRYVVRDGGVKLIVGLGNPGIEYQFTPHNLGFLAIDRIAGDLGIEVRNRQCRALTARAEIENVPVLLAKPETYMNLSGLSVGELVRKHDLKPESDLIVIQDELDFPLGTLRIHTRRSSAGHNGIESIIGALGRKDFLRIRIGVAPERKVEDGERYLLSPLRKAQLKVVDGMLDTAEEAVKMILKEGPAAAMNRFNRKEESSQ

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
110 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
111 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
184 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 2.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.4
Rhizosphere 93.87
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000260 3300000546 Bacteria 9129
2 JGI24752J21851_1003237 3300001976 Bacteria 2148
3 JGI24737J22298_10112947 3300001990 Bacteria 803
4 JGI24749J21850_1009599 3300002076 Unclassified 1352
5 JGI24751J29686_10000764 3300002459 Bacteria 7574
6 Ga0065712_10304804 3300005290 Bacteria 833
7 Ga0065715_10134981 3300005293 Bacteria 1945
8 Ga0065715_10158482 3300005293 Bacteria 1652
9 Ga0070658_10754492 3300005327 Unclassified 845
10 Ga0070676_10046894 3300005328 Bacteria 2521
11 Ga0070683_100005649 3300005329 Bacteria 10448
12 Ga0070683_100407720 3300005329 Bacteria 1296
13 Ga0070690_100061327 3300005330 Unclassified 2422
14 Ga0070690_100272973 3300005330 Bacteria 1203
15 Ga0070670_100194552 3300005331 Bacteria 1762
16 Ga0070670_100338078 3300005331 Bacteria 1321
17 Ga0070670_100380499 3300005331 Bacteria 1243
18 Ga0070677_10239818 3300005333 Unclassified 895
19 Ga0068869_100074119 3300005334 Bacteria 2526
20 Ga0068869_100624253 3300005334 Bacteria 912
21 Ga0068869_100689783 3300005334 Bacteria 870
22 Ga0070680_100506119 3300005336 Unclassified 1033
23 Ga0068868_100004556 3300005338 Bacteria 9730
24 Ga0068868_100096044 3300005338 Bacteria 2393
25 Ga0068868_100355108 3300005338 Bacteria 1256
26 Ga0068868_100743530 3300005338 Unclassified 881
27 Ga0070660_100067840 3300005339 Bacteria 2779
28 Ga0070660_100151726 3300005339 Bacteria 1863
29 Ga0070689_100010090 3300005340 Bacteria 6724
30 Ga0070689_100063235 3300005340 Bacteria 2880
31 Ga0070687_100317222 3300005343 Bacteria 994
32 Ga0070661_100012749 3300005344 Bacteria 5884
33 Ga0070661_100057378 3300005344 Bacteria 2853
34 Ga0070692_10472005 3300005345 Unclassified 807
35 Ga0070668_100005025 3300005347 Bacteria 9796
36 Ga0070668_100418056 3300005347 Unclassified 1147
37 Ga0070669_100511106 3300005353 Unclassified 997
38 Ga0070669_100651046 3300005353 Bacteria 886
39 Ga0070675_100059776 3300005354 Bacteria 3145
40 Ga0070675_100130904 3300005354 Bacteria 2138
41 Ga0070675_100584183 3300005354 Bacteria 1012
42 Ga0070675_100666770 3300005354 Bacteria 946
43 Ga0070674_100220028 3300005356 Bacteria 1477
44 Ga0070688_100187917 3300005365 Bacteria 1437
45 Ga0070659_100004220 3300005366 Bacteria 10260
46 Ga0070667_100011429 3300005367 Bacteria 7341
47 Ga0070667_100073367 3300005367 Bacteria 2918
48 Ga0070667_100730903 3300005367 Unclassified 917
49 Ga0070709_10007118 3300005434 Bacteria 6122
50 Ga0070709_10010494 3300005434 Bacteria 5133
51 Ga0070709_10010869 3300005434 Bacteria 5054
52 Ga0070709_10046772 3300005434 Bacteria 2692
53 Ga0070709_10049158 3300005434 Unclassified 2635
54 Ga0070709_10100077 3300005434 Unclassified 1930
55 Ga0070709_10455055 3300005434 Bacteria 965
56 Ga0070714_100000046 3300005435 Bacteria 113150
57 Ga0070714_100002862 3300005435 Bacteria 12763
58 Ga0070714_100010217 3300005435 Bacteria 7410
59 Ga0070714_100059470 3300005435 Unclassified 3277
60 Ga0070714_100746881 3300005435 Bacteria 946
61 Ga0070713_100000057 3300005436 Bacteria 70266
62 Ga0070713_100000583 3300005436 Bacteria 23153
63 Ga0070713_100003196 3300005436 Bacteria 10785
64 Ga0070713_100024512 3300005436 Bacteria 4700
65 Ga0070713_100025850 3300005436 Bacteria 4598
66 Ga0070713_100047430 3300005436 Bacteria 3531
67 Ga0070713_100152369 3300005436 Bacteria 2058
68 Ga0070713_100155028 3300005436 Bacteria 2041
69 Ga0070713_100332154 3300005436 Bacteria 1406
70 Ga0070713_100415804 3300005436 Unclassified 1258
71 Ga0070713_100715086 3300005436 Bacteria 957
72 Ga0070713_101351123 3300005436 Unclassified 691
73 Ga0070713_101401111 3300005436 Unclassified 678
74 Ga0070710_10004463 3300005437 Bacteria 6623
75 Ga0070710_10033046 3300005437 Unclassified 2807
76 Ga0070710_10209085 3300005437 Bacteria 1236
77 Ga0070711_100007062 3300005439 Bacteria 6813
78 Ga0070711_100021372 3300005439 Bacteria 4184
79 Ga0070711_100203206 3300005439 Bacteria 1530
80 Ga0070711_100273015 3300005439 Unclassified 1335
81 Ga0070711_100449068 3300005439 Bacteria 1055
82 Ga0070705_100125960 3300005440 Bacteria 1663
83 Ga0070705_100287051 3300005440 Unclassified 1173
84 Ga0070694_100091865 3300005444 Bacteria 2132
85 Ga0070708_100000437 3300005445 Bacteria 31114
86 Ga0070708_100015048 3300005445 Bacteria 6382
87 Ga0070708_100018463 3300005445 Bacteria 5837
88 Ga0070708_100033060 3300005445 Bacteria 4492
89 Ga0070708_100055671 3300005445 Bacteria 3517
90 Ga0070708_100062121 3300005445 Bacteria 3339
91 Ga0070708_100070749 3300005445 Bacteria 3139
92 Ga0070708_100162121 3300005445 Bacteria 2084
93 Ga0070708_100174578 3300005445 Unclassified 2007
94 Ga0070708_100333521 3300005445 Bacteria 1429
95 Ga0070708_100334466 3300005445 Unclassified 1427
96 Ga0070663_100021022 3300005455 Bacteria 4332
97 Ga0070663_100257779 3300005455 Unclassified 1382
98 Ga0070678_100074534 3300005456 Bacteria 2551
99 Ga0070662_100128251 3300005457 Bacteria 1952
100 Ga0070662_100130123 3300005457 Bacteria 1939
101 Ga0070681_10006550 3300005458 Bacteria 11336
102 Ga0070681_10369159 3300005458 Bacteria 1345
103 Ga0068867_100053866 3300005459 Unclassified 2971
104 Ga0070706_100000935 3300005467 Bacteria 31937
105 Ga0070706_100003883 3300005467 Bacteria 14597
106 Ga0070706_100006968 3300005467 Bacteria 10660
107 Ga0070706_100064219 3300005467 Unclassified 3393
108 Ga0070706_100261281 3300005467 Bacteria 1616
109 Ga0070706_100577490 3300005467 Bacteria 1045
110 Ga0070706_100701326 3300005467 Unclassified 939
111 Ga0070706_101016775 3300005467 Unclassified 764
112 Ga0070707_100001244 3300005468 Bacteria 25018
113 Ga0070707_100002157 3300005468 Bacteria 18841
114 Ga0070707_100003649 3300005468 Bacteria 14508
115 Ga0070707_100030458 3300005468 Bacteria 5137
116 Ga0070707_100220881 3300005468 Bacteria 1845
117 Ga0070707_100395934 3300005468 Bacteria 1341
118 Ga0070698_100001005 3300005471 Bacteria 31065
119 Ga0070698_100002044 3300005471 Bacteria 22425
120 Ga0070698_100126852 3300005471 Bacteria 2509
121 Ga0070698_100159775 3300005471 Bacteria 2198
122 Ga0070698_101022260 3300005471 Unclassified 774
123 Ga0070699_100001100 3300005518 Bacteria 25172
124 Ga0070699_100002908 3300005518 Bacteria 15244
125 Ga0070699_100033580 3300005518 Bacteria 4432
126 Ga0070699_100037176 3300005518 Bacteria 4213
127 Ga0070699_100235755 3300005518 Bacteria 1632
128 Ga0070684_100030673 3300005535 Bacteria 4570
129 Ga0070684_100032221 3300005535 Bacteria 4466
130 Ga0070697_100000266 3300005536 Bacteria 42492
131 Ga0070697_100000701 3300005536 Bacteria 25059
132 Ga0070697_100016981 3300005536 Bacteria 5722
133 Ga0070697_100058991 3300005536 Bacteria 3123
134 Ga0070697_100061663 3300005536 Unclassified 3059
135 Ga0070697_100131111 3300005536 Bacteria 2102
136 Ga0070697_100668358 3300005536 Bacteria 915
137 Ga0068853_100341029 3300005539 Bacteria 1392
138 Ga0070672_100661908 3300005543 Bacteria 912
139 Ga0070686_100128055 3300005544 Bacteria 1752
140 Ga0070686_100146117 3300005544 Bacteria 1651
141 Ga0070695_100055008 3300005545 Unclassified 2564
142 Ga0070695_100103496 3300005545 Bacteria 1921
143 Ga0070695_100719205 3300005545 Bacteria 794
144 Ga0070693_100099957 3300005547 Bacteria 1765
145 Ga0070693_100192365 3300005547 Unclassified 1320
146 Ga0070693_100293454 3300005547 Unclassified 1093
147 Ga0070693_100777961 3300005547 Unclassified 707
148 Ga0070665_100025297 3300005548 Bacteria 5981
149 Ga0070665_100533677 3300005548 Bacteria 1185
150 Ga0070704_100074126 3300005549 Bacteria 2482
151 Ga0068855_100077184 3300005563 Bacteria 3864
152 Ga0068855_100568963 3300005563 Bacteria 1225
153 Ga0070664_100107745 3300005564 Bacteria 2429
154 Ga0070664_100222428 3300005564 Bacteria 1689
155 Ga0070664_100896424 3300005564 Unclassified 831
156 Ga0068857_100002168 3300005577 Bacteria 15958
157 Ga0068857_100044253 3300005577 Bacteria 3948
158 Ga0068857_100099360 3300005577 Bacteria 2610
159 Ga0068854_100093557 3300005578 Bacteria 2240
160 Ga0068854_100302063 3300005578 Unclassified 1295
161 Ga0068856_100018058 3300005614 Bacteria 6840
162 Ga0068856_100021804 3300005614 Bacteria 6226
163 Ga0068856_100044332 3300005614 Bacteria 4377
164 Ga0068856_100064873 3300005614 Bacteria 3608
165 Ga0068856_100104896 3300005614 Bacteria 2821
166 Ga0068856_100211510 3300005614 Bacteria 1955
167 Ga0068856_100256296 3300005614 Bacteria 1764
168 Ga0068852_100011844 3300005616 Bacteria 6591
169 Ga0068859_100021521 3300005617 Bacteria 6472
170 Ga0068864_100073221 3300005618 Bacteria 2986
171 Ga0068864_100163288 3300005618 Bacteria 2026
172 Ga0068866_10020794 3300005718 Unclassified 3012
173 Ga0068866_10109315 3300005718 Unclassified 1539
174 Ga0068861_100042481 3300005719 Bacteria 3407
175 Ga0068861_100428115 3300005719 Bacteria 1181
176 Ga0068851_10007547 3300005834 Bacteria 4998
177 Ga0068851_10311291 3300005834 Unclassified 907
178 Ga0068870_10010814 3300005840 Bacteria 4207
179 Ga0068863_100106501 3300005841 Bacteria 2668
180 Ga0068863_100292337 3300005841 Bacteria 1579
181 Ga0068858_100033597 3300005842 Bacteria 4758
182 Ga0068858_100068255 3300005842 Bacteria 3294
183 Ga0068858_101030596 3300005842 Bacteria 807
184 Ga0068860_100051564 3300005843 Bacteria 3915
185 Ga0068860_100098412 3300005843 Bacteria 2789
186 Ga0068860_100192215 3300005843 Bacteria 1975
187 Ga0068862_100010616 3300005844 Bacteria 7610
188 Ga0068862_100237907 3300005844 Bacteria 1654
189 Ga0070717_10001093 3300006028 Bacteria 18235
190 Ga0070717_10001658 3300006028 Bacteria 15470
191 Ga0070717_10012009 3300006028 Bacteria 6595
192 Ga0070717_10031513 3300006028 Bacteria 4266
193 Ga0070717_10046711 3300006028 Bacteria 3544
194 Ga0070717_10051907 3300006028 Bacteria 3376
195 Ga0070717_10054243 3300006028 Bacteria 3305
196 Ga0070717_10072990 3300006028 Bacteria 2867
197 Ga0070717_10155358 3300006028 Bacteria 1982
198 Ga0070717_10303444 3300006028 Bacteria 1420
199 Ga0070715_10026101 3300006163 Bacteria 2320
200 Ga0070716_100012854 3300006173 Bacteria 4255
201 Ga0070716_100029846 3300006173 Bacteria 2953
202 Ga0070716_100043545 3300006173 Bacteria 2511
203 Ga0070716_100060757 3300006173 Bacteria 2184
204 Ga0070716_100096582 3300006173 Bacteria 1801
205 Ga0070716_100123616 3300006173 Bacteria 1624
206 Ga0070716_100125871 3300006173 Bacteria 1612
207 Ga0070716_100240198 3300006173 Unclassified 1228
208 Ga0070716_100428372 3300006173 Bacteria 959
209 Ga0070712_100000130 3300006175 Bacteria 39526
210 Ga0070712_100002208 3300006175 Bacteria 11974
211 Ga0070712_100006015 3300006175 Bacteria 7508
212 Ga0070712_100036544 3300006175 Bacteria 3343
213 Ga0070712_100037951 3300006175 Bacteria 3287
214 Ga0070712_100083096 3300006175 Unclassified 2324
215 Ga0070712_100095851 3300006175 Bacteria 2184
216 Ga0070712_100205780 3300006175 Bacteria 1549
217 Ga0070712_100304398 3300006175 Unclassified 1291
218 Ga0097621_100144143 3300006237 Bacteria 2038
219 Ga0097621_100495087 3300006237 Bacteria 1106
220 Ga0068871_100067623 3300006358 Bacteria 2932
221 Ga0068871_100166672 3300006358 Unclassified 1886
222 Ga0068871_100261319 3300006358 Bacteria 1510
223 Ga0068871_100311734 3300006358 Bacteria 1383
224 Ga0068871_100317771 3300006358 Unclassified 1370
225 Ga0075433_10655289 3300006852 Unclassified 920
226 Ga0068865_100115694 3300006881 Bacteria 1985
227 Ga0075436_100001267 3300006914 Bacteria 17156
228 Ga0097620_100021523 3300006931 Bacteria 6472
229 Ga0075435_100010410 3300007076 Bacteria 6803
230 Ga0099794_10011693 3300007265 Bacteria 3765
231 Ga0099794_10302792 3300007265 Unclassified 828
232 Ga0105250_10069541 3300009092 Bacteria 1421
233 Ga0105240_10018684 3300009093 Bacteria 9288
234 Ga0105240_10037791 3300009093 Bacteria 6202
235 Ga0105240_10039687 3300009093 Bacteria 6026
236 Ga0105240_10216890 3300009093 Bacteria 2232
237 Ga0105240_10314497 3300009093 Bacteria 1787
238 Ga0105240_10385045 3300009093 Bacteria 1583
239 Ga0105240_10461079 3300009093 Bacteria 1420
240 Ga0105245_10010421 3300009098 Bacteria 8095
241 Ga0105245_10011580 3300009098 Bacteria 7685
242 Ga0105245_10034309 3300009098 Bacteria 4500
243 Ga0105245_10126039 3300009098 Bacteria 2397
244 Ga0105245_10397236 3300009098 Unclassified 1377
245 Ga0105245_10616474 3300009098 Bacteria 1113
246 Ga0105247_10020036 3300009101 Bacteria 4021
247 Ga0105247_10061130 3300009101 Bacteria 2335
248 Ga0105247_10186684 3300009101 Unclassified 1386
249 Ga0105241_10001638 3300009174 Bacteria 17067
250 Ga0105241_10014378 3300009174 Bacteria 5796
251 Ga0105241_10092985 3300009174 Bacteria 2382
252 Ga0105241_10201452 3300009174 Bacteria 1663
253 Ga0105242_10217703 3300009176 Bacteria 1705
254 Ga0105248_10024998 3300009177 Bacteria 6639
255 Ga0105248_10028234 3300009177 Bacteria 6250
256 Ga0105248_10477857 3300009177 Bacteria 1405
257 Ga0105237_10009832 3300009545 Bacteria 10228
258 Ga0105237_10039971 3300009545 Bacteria 4732
259 Ga0105237_10423771 3300009545 Unclassified 1336
260 Ga0105237_10643054 3300009545 Bacteria 1067
261 Ga0105238_10030176 3300009551 Bacteria 5518
262 Ga0105238_10137889 3300009551 Bacteria 2417
263 Ga0105238_10165197 3300009551 Bacteria 2189
264 Ga0105238_11074347 3300009551 Unclassified 827
265 Ga0105238_11329721 3300009551 Unclassified 745
266 Ga0105249_10032205 3300009553 Bacteria 4742
267 Ga0105249_10071939 3300009553 Bacteria 3196
268 Ga0105249_10089823 3300009553 Bacteria 2871
269 Ga0105246_10074648 3300011119 Bacteria 2398
270 Ga0105246_10202787 3300011119 Unclassified 1543
271 Ga0157373_10001299 3300013100 Bacteria 19063
272 Ga0157373_10004687 3300013100 Bacteria 10283
273 Ga0157373_10322939 3300013100 Unclassified 1098
274 Ga0157373_10535255 3300013100 Unclassified 848
275 Ga0157371_10008938 3300013102 Bacteria 7928
276 Ga0157371_10014882 3300013102 Bacteria 5855
277 Ga0157370_10016617 3300013104 Bacteria 7445
278 Ga0157370_10314105 3300013104 Bacteria 1446
279 Ga0157369_10031049 3300013105 Bacteria 5888
280 Ga0157369_10046588 3300013105 Bacteria 4711
281 Ga0157369_10060956 3300013105 Bacteria 4068
282 Ga0157369_10201939 3300013105 Unclassified 2086
283 Ga0157369_10323184 3300013105 Unclassified 1604
284 Ga0157374_10013788 3300013296 Bacteria 7060
285 Ga0157374_10030581 3300013296 Bacteria 4891
286 Ga0157374_10038624 3300013296 Bacteria 4389
287 Ga0157374_10062225 3300013296 Bacteria 3497
288 Ga0157374_10291834 3300013296 Bacteria 1612
289 Ga0157374_10403686 3300013296 Bacteria 1364
290 Ga0157378_10435188 3300013297 Bacteria 1299
291 Ga0157378_10983779 3300013297 Bacteria 877
292 Ga0163162_10001531 3300013306 Bacteria 21558
293 Ga0163162_10015654 3300013306 Bacteria 7412
294 Ga0163162_10373372 3300013306 Unclassified 1559
295 Ga0157372_10000825 3300013307 Bacteria 33540
296 Ga0157372_10015799 3300013307 Bacteria 8098
297 Ga0157372_10028645 3300013307 Bacteria 6081
298 Ga0157372_10039702 3300013307 Bacteria 5196
299 Ga0157372_10078707 3300013307 Bacteria 3726
300 Ga0157375_10110076 3300013308 Bacteria 2851
301 Ga0157375_10288099 3300013308 Bacteria 1805
302 Ga0157375_12098690 3300013308 Bacteria 672
303 Ga0163163_10010127 3300014325 Bacteria 8456
304 Ga0163163_10040139 3300014325 Bacteria 4569
305 Ga0163163_10112727 3300014325 Bacteria 2749
306 Ga0163163_10116898 3300014325 Unclassified 2698
307 Ga0163163_10152848 3300014325 Bacteria 2351
308 Ga0163163_10300583 3300014325 Bacteria 1657
309 Ga0163163_11031706 3300014325 Bacteria 886
310 Ga0157377_10021473 3300014745 Bacteria 3396
311 Ga0157379_10001261 3300014968 Bacteria 20577
312 Ga0157379_10007858 3300014968 Bacteria 9240
313 Ga0157379_10078446 3300014968 Bacteria 2958
314 Ga0157379_10241143 3300014968 Bacteria 1640
315 Ga0157376_10174796 3300014969 Bacteria 1958
316 Ga0157376_10180233 3300014969 Bacteria 1930
317 Ga0157376_10917042 3300014969 Bacteria 895
318 Ga0157376_11717763 3300014969 Unclassified 663
319 Ga0184601_104320 3300019183 Bacteria 848
320 Ga0213874_10063999 3300021377 Bacteria 1158
321 Ga0224570_100291 3300022730 Bacteria 3800
322 Ga0224571_100317 3300022734 Unclassified 2520
323 Ga0247553_100308 3300023672 Bacteria 1692
324 Ga0224572_1000408 3300024225 Bacteria 4894
325 Ga0224572_1004935 3300024225 Bacteria 2356
326 Ga0228598_1000383 3300024227 Bacteria 8859
327 Ga0228598_1002732 3300024227 Bacteria 3823
328 Ga0228598_1020970 3300024227 Unclassified 1286
329 Ga0207656_10024608 3300025321 Bacteria 2436
330 Ga0207692_10006024 3300025898 Bacteria 4902
331 Ga0207692_10025360 3300025898 Unclassified 2768
332 Ga0207692_10037896 3300025898 Bacteria 2361
333 Ga0207642_10030947 3300025899 Bacteria 2236
334 Ga0207710_10101690 3300025900 Bacteria 1356
335 Ga0207680_10324478 3300025903 Unclassified 1077
336 Ga0207647_10015589 3300025904 Bacteria 5205
337 Ga0207685_10069819 3300025905 Bacteria 1420
338 Ga0207699_10000528 3300025906 Bacteria 18865
339 Ga0207699_10003495 3300025906 Bacteria 7499
340 Ga0207699_10004846 3300025906 Bacteria 6438
341 Ga0207699_10012963 3300025906 Bacteria 4251
342 Ga0207699_10170108 3300025906 Unclassified 1457
343 Ga0207699_10246783 3300025906 Bacteria 1229
344 Ga0207699_10301663 3300025906 Bacteria 1119
345 Ga0207699_10452759 3300025906 Bacteria 921
346 Ga0207699_10489048 3300025906 Bacteria 887
347 Ga0207645_10004270 3300025907 Bacteria 10605
348 Ga0207684_10000274 3300025910 Bacteria 76497
349 Ga0207684_10003347 3300025910 Bacteria 15715
350 Ga0207684_10019671 3300025910 Bacteria 5775
351 Ga0207684_10096830 3300025910 Bacteria 2519
352 Ga0207684_10145762 3300025910 Unclassified 2036
353 Ga0207684_10207565 3300025910 Bacteria 1690
354 Ga0207684_10517208 3300025910 Bacteria 1022
355 Ga0207684_10723930 3300025910 Unclassified 844
356 Ga0207654_10139287 3300025911 Bacteria 1545
357 Ga0207654_10232786 3300025911 Unclassified 1228
358 Ga0207707_10009709 3300025912 Bacteria 8348
359 Ga0207707_10090077 3300025912 Bacteria 2681
360 Ga0207707_10196174 3300025912 Unclassified 1761
361 Ga0207695_10028405 3300025913 Bacteria 6204
362 Ga0207695_10047537 3300025913 Bacteria 4540
363 Ga0207695_10085345 3300025913 Bacteria 3186
364 Ga0207695_10271179 3300025913 Bacteria 1592
365 Ga0207671_10332065 3300025914 Unclassified 1204
366 Ga0207671_10453384 3300025914 Unclassified 1022
367 Ga0207693_10000013 3300025915 Bacteria 154365
368 Ga0207693_10000143 3300025915 Bacteria 65412
369 Ga0207693_10002309 3300025915 Bacteria 16587
370 Ga0207693_10004457 3300025915 Bacteria 11831
371 Ga0207693_10014717 3300025915 Bacteria 6285
372 Ga0207693_10062201 3300025915 Bacteria 2925
373 Ga0207693_10138156 3300025915 Bacteria 1916
374 Ga0207693_10275187 3300025915 Bacteria 1319
375 Ga0207693_10275488 3300025915 Unclassified 1318
376 Ga0207663_10001881 3300025916 Bacteria 9929
377 Ga0207663_10012032 3300025916 Bacteria 4665
378 Ga0207663_10154117 3300025916 Bacteria 1615
379 Ga0207663_10887446 3300025916 Bacteria 713
380 Ga0207660_10639312 3300025917 Unclassified 867
381 Ga0207657_10002502 3300025919 Bacteria 19880
382 Ga0207649_10032077 3300025920 Bacteria 3128
383 Ga0207652_10088156 3300025921 Bacteria 2722
384 Ga0207646_10000240 3300025922 Bacteria 75609
385 Ga0207646_10000341 3300025922 Bacteria 63056
386 Ga0207646_10113350 3300025922 Bacteria 2434
387 Ga0207646_10167820 3300025922 Unclassified 1982
388 Ga0207646_10294921 3300025922 Unclassified 1465
389 Ga0207646_10327932 3300025922 Bacteria 1383
390 Ga0207646_10411798 3300025922 Unclassified 1221
391 Ga0207646_10617367 3300025922 Bacteria 973
392 Ga0207694_10088049 3300025924 Bacteria 2447
393 Ga0207694_10391345 3300025924 Unclassified 1155
394 Ga0207694_10576520 3300025924 Unclassified 945
395 Ga0207650_10295167 3300025925 Bacteria 1322
396 Ga0207687_10032008 3300025927 Bacteria 3559
397 Ga0207687_10100734 3300025927 Bacteria 2125
398 Ga0207700_10000337 3300025928 Bacteria 27629
399 Ga0207700_10000346 3300025928 Bacteria 27177
400 Ga0207700_10012848 3300025928 Bacteria 5418
401 Ga0207700_10031073 3300025928 Bacteria 3790
402 Ga0207700_10066360 3300025928 Bacteria 2758
403 Ga0207700_10151549 3300025928 Unclassified 1916
404 Ga0207700_10219183 3300025928 Unclassified 1612
405 Ga0207700_10370578 3300025928 Bacteria 1250
406 Ga0207700_10392450 3300025928 Bacteria 1215
407 Ga0207700_10644168 3300025928 Bacteria 945
408 Ga0207664_10000201 3300025929 Bacteria 44962
409 Ga0207664_10013157 3300025929 Bacteria 5931
410 Ga0207664_10082306 3300025929 Bacteria 2621
411 Ga0207664_10089793 3300025929 Bacteria 2517
412 Ga0207664_10305247 3300025929 Bacteria 1401
413 Ga0207664_10373971 3300025929 Bacteria 1264
414 Ga0207664_10392487 3300025929 Bacteria 1233
415 Ga0207690_10080728 3300025932 Bacteria 2270
416 Ga0207706_10001321 3300025933 Bacteria 24837
417 Ga0207686_10770868 3300025934 Bacteria 769
418 Ga0207709_10047224 3300025935 Bacteria 2616
419 Ga0207669_10154973 3300025937 Unclassified 1610
420 Ga0207665_10003598 3300025939 Bacteria 10348
421 Ga0207665_10005780 3300025939 Bacteria 8227
422 Ga0207665_10014974 3300025939 Bacteria 5094
423 Ga0207665_10019820 3300025939 Bacteria 4420
424 Ga0207665_10046599 3300025939 Bacteria 2904
425 Ga0207665_10050393 3300025939 Bacteria 2800
426 Ga0207665_10068696 3300025939 Bacteria 2415
427 Ga0207665_10079100 3300025939 Bacteria 2260
428 Ga0207665_10140700 3300025939 Bacteria 1720
429 Ga0207665_10299628 3300025939 Unclassified 1201
430 Ga0207711_10005468 3300025941 Bacteria 10741
431 Ga0207711_10332417 3300025941 Bacteria 1405
432 Ga0207689_10021360 3300025942 Bacteria 5444
433 Ga0207689_10291861 3300025942 Bacteria 1351
434 Ga0207689_10745622 3300025942 Bacteria 826
435 Ga0207661_11523938 3300025944 Bacteria 612
436 Ga0207679_10778907 3300025945 Unclassified 871
437 Ga0207679_10822240 3300025945 Unclassified 848
438 Ga0207667_10353783 3300025949 Bacteria 1498
439 Ga0207667_10451906 3300025949 Bacteria 1305
440 Ga0207640_10391143 3300025981 Unclassified 1129
441 Ga0207640_11263669 3300025981 Unclassified 658
442 Ga0207658_10169082 3300025986 Unclassified 1799
443 Ga0207658_10625454 3300025986 Unclassified 969
444 Ga0207677_10052606 3300026023 Unclassified 2767
445 Ga0207677_10268477 3300026023 Unclassified 1394
446 Ga0207639_10439738 3300026041 Bacteria 1182
447 Ga0207678_10000277 3300026067 Bacteria 46368
448 Ga0207702_10010133 3300026078 Bacteria 7892
449 Ga0207702_10010742 3300026078 Bacteria 7646
450 Ga0207702_10076477 3300026078 Unclassified 2894
451 Ga0207702_10089073 3300026078 Bacteria 2698
452 Ga0207702_10505245 3300026078 Bacteria 1179
453 Ga0207641_10049231 3300026088 Bacteria 3560
454 Ga0207641_10331212 3300026088 Bacteria 1446
455 Ga0207641_10421987 3300026088 Bacteria 1284
456 Ga0207648_10017311 3300026089 Bacteria 6563
457 Ga0207676_10128670 3300026095 Bacteria 2149
458 Ga0207674_10012162 3300026116 Bacteria 9635
459 Ga0207674_10016566 3300026116 Bacteria 8062
460 Ga0207674_10181249 3300026116 Bacteria 2058
461 Ga0207675_100243973 3300026118 Bacteria 1736
462 Ga0207683_10160969 3300026121 Bacteria 2029
463 Ga0265356_1001162 3300028017 Bacteria 4045
464 Ga0265356_1002472 3300028017 Bacteria 2477
465 Ga0268266_10305898 3300028379 Bacteria 1484
466 Ga0268265_10066561 3300028380 Bacteria 2785
467 Ga0268264_10042134 3300028381 Bacteria 3778
468 Ga0268264_10058821 3300028381 Bacteria 3219
469 Ga0265326_10066592 3300028558 Unclassified 1018
470 Ga0265338_10024720 3300028800 Bacteria 6126
471 Ga0265338_10367482 3300028800 Bacteria 1031
472 Ga0265762_1001174 3300030760 Bacteria 4743
473 Ga0265767_100901 3300030836 Unclassified 1362
474 Ga0265777_101754 3300030877 Unclassified 1198
475 Ga0265765_1012605 3300030879 Bacteria 960
476 Ga0265764_103767 3300030882 Unclassified 802
477 Ga0265771_1011809 3300031010 Unclassified 659
478 Ga0265760_10000817 3300031090 Bacteria 8977
479 Ga0265760_10001979 3300031090 Bacteria 6017
480 Ga0265760_10003825 3300031090 Bacteria 4364
481 Ga0265760_10007880 3300031090 Bacteria 3043
482 Ga0265760_10022950 3300031090 Bacteria 1810
483 Ga0265760_10034347 3300031090 Bacteria 1500
484 Ga0265330_10009005 3300031235 Bacteria 4764
485 Ga0265340_10044209 3300031247 Bacteria 2180
486 Ga0265340_10095583 3300031247 Bacteria 1385
487 Ga0265339_10020315 3300031249 Bacteria 3883
488 Ga0265339_10030436 3300031249 Bacteria 3056
489 Ga0265339_10033158 3300031249 Bacteria 2910
490 Ga0265339_10149990 3300031249 Bacteria 1180
491 Ga0265316_10002054 3300031344 Bacteria 21202
492 Ga0265316_10027901 3300031344 Unclassified 4667
493 Ga0265316_10049817 3300031344 Unclassified 3297
494 Ga0265314_10000348 3300031711 Bacteria 64175
495 Ga0265314_10023827 3300031711 Bacteria 4655
496 Ga0265314_10074163 3300031711 Bacteria 2267
497 Ga0265314_10100093 3300031711 Bacteria 1865
498 Ga0265342_10048686 3300031712 Bacteria 2540
499 Ga0265342_10295034 3300031712 Bacteria 855
500 Ga0316053_100216 3300032120 Bacteria 2278
501 Ga0316212_1006664 3300033547 Bacteria 1671
502 Ga0316212_1019356 3300033547 Unclassified 955
503 Ga0373930_0047228 3300034816 Unclassified 931
504 Ga0373926_0005377 3300035083 Bacteria 4218
505 Ga0373926_0055670 3300035083 Bacteria 1434
506 Ga0373926_0168743 3300035083 Unclassified 837
507 Ga0373934_0038417 3300035086 Bacteria 1886
508 Ga0373940_0014887 3300035088 Bacteria 1905
509 Ga0373951_0025103 3300035091 Unclassified 1383
510 Ga0373923_0008953 3300035111 Bacteria 3593
511 Ga0373932_0015752 3300035112 Bacteria 1921
512 Ga0373936_0000275 3300035113 Bacteria 17102
513 Ga0373936_0018891 3300035113 Bacteria 2667
514 Ga0373936_0032100 3300035113 Bacteria 2076
515 Ga0373936_0107940 3300035113 Bacteria 1180
516 Ga0373939_0004499 3300035114 Bacteria 3302
517 Ga0373945_0053857 3300035116 Unclassified 1486
518 Ga0373953_0057031 3300035117 Bacteria 1589
519 Ga0373954_0029119 3300035118 Bacteria 2542
520 Ga0373956_0035693 3300035119 Bacteria 2193
521 Ga0373960_0007444 3300035121 Unclassified 2594
522 Ga0373943_0000011 3300035170 Bacteria 64439
523 Ga0373943_0018454 3300035170 Unclassified 3206
524 Ga0373943_0052333 3300035170 Bacteria 2013
525 Ga0373943_0135442 3300035170 Bacteria 1322
526 Ga0373943_0136882 3300035170 Bacteria 1316
527 Ga0373943_0237461 3300035170 Bacteria 1020
528 Ga0373943_0274154 3300035170 Bacteria 952
529 Ga0373946_0004868 3300035171 Bacteria 4834
530 Ga0373955_0419814 3300035172 Unclassified 813
531 Ga0373942_0077346 3300035207 Bacteria 982
532 Ga0373924_0015151 3300035410 Bacteria 2925
533 Ga0373924_0082057 3300035410 Unclassified 1372
534 Ga0373924_0085550 3300035410 Bacteria 1345
535 Ga0373931_0008821 3300035691 Bacteria 4798
536 Ga0373931_0444078 3300035691 Bacteria 828
537 Ga0373935_0001861 3300035692 Bacteria 11832
538 Ga0373935_0002744 3300035692 Bacteria 10136
539 Ga0373935_0064889 3300035692 Bacteria 2342
540 Ga0373935_0438278 3300035692 Bacteria 942
541 Ga0373927_0000604 3300035695 Bacteria 27351
542 Ga0373927_0003800 3300035695 Bacteria 10715
543 Ga0373927_0080802 3300035695 Bacteria 2106
544 Ga0373927_0199084 3300035695 Unclassified 1315
545 Ga0373927_0279037 3300035695 Bacteria 1099
546 Ga0373933_0021828 3300035724 Bacteria 3642
547 Ga0373933_0050277 3300035724 Bacteria 2488
548 Ga0373933_0200177 3300035724 Unclassified 1278
549 Ga0373947_0000784 3300035725 Bacteria 19102
550 Ga0373947_0010631 3300035725 Bacteria 5280
551 Ga0373947_0048835 3300035725 Bacteria 2540
552 Ga0373937_0096584 3300036401 Bacteria 2741
553 Ga0373937_0114777 3300036401 Bacteria 2507
554 Ga0373937_0373907 3300036401 Bacteria 1351
555 Ga0373937_0489643 3300036401 Unclassified 1168
556 Ga0265778_004477 3300036457 Unclassified 1447
557 Ga0373925_0001438 3300037068 Bacteria 20628
558 Ga0373925_0006773 3300037068 Bacteria 8398
559 Ga0373925_0009721 3300037068 Bacteria 6992
560 Ga0373925_0010976 3300037068 Bacteria 6576
561 Ga0373925_0012397 3300037068 Bacteria 6172
562 Ga0373925_0026046 3300037068 Bacteria 4276
563 Ga0373925_0081841 3300037068 Unclassified 2456
564 Ga0373925_0305927 3300037068 Unclassified 1284
565 Ga0373925_0328263 3300037068 Bacteria 1239
566 Ga0373925_0358106 3300037068 Unclassified 1186
567 Ga0395900_1237968 3300037418 Unclassified 661
568 Ga0436360_0358964 3300039438 Bacteria 1147
569 Ga0436363_0451864 3300039450 Unclassified 2065
570 Ga0451839_1277567 3300041496 Bacteria 734
571 Ga0451577_0000241 3300042876 Bacteria 108191
572 Ga0451577_0677628 3300042876 Bacteria 935
573 Ga0451577_0984051 3300042876 Unclassified 758
574 Ga0466963_0085737 3300044694 Unclassified 2139
575 Ga0466964_0033709 3300044706 Bacteria 2041
576 Ga0453684_0000366 3300044712 Bacteria 186117
577 Ga0453684_0738228 3300044712 Bacteria 1067
578 Ga0453684_1510077 3300044712 Bacteria 693
579 Ga0466959_0320400 3300045049 Unclassified 1060
580 Ga0451576_0005686 3300045051 Bacteria 15558
581 Ga0451576_0252655 3300045051 Unclassified 1843
582 Ga0451576_0641173 3300045051 Bacteria 1116
583 Ga0466967_0028583 3300045976 Bacteria 4657
584 Ga0466967_0028774 3300045976 Bacteria 4644
585 Ga0466967_0086055 3300045976 Bacteria 2847
586 Ga0495590_0025074 3300046457 Bacteria 2098
587 Ga0495653_0083918 3300046463 Bacteria 2348
588 Ga0495580_0001182 3300046472 Bacteria 22952
589 Ga0495580_0005708 3300046472 Bacteria 10237
590 Ga0495580_0008969 3300046472 Bacteria 7902
591 Ga0495580_0023555 3300046472 Bacteria 4519
592 Ga0495580_0029919 3300046472 Bacteria 3948
593 Ga0495580_0069661 3300046472 Bacteria 2457
594 Ga0495580_0263134 3300046472 Unclassified 1179
595 Ga0495580_0305002 3300046472 Bacteria 1084
596 Ga0495582_0001573 3300046473 Bacteria 12875
597 Ga0495582_0014062 3300046473 Bacteria 4405
598 Ga0495582_0230587 3300046473 Bacteria 1060
599 Ga0495582_0373567 3300046473 Bacteria 821
600 Ga0495664_0081079 3300046477 Bacteria 1945
601 Ga0495664_0220452 3300046477 Bacteria 1148
602 Ga0495608_0268191 3300046511 Bacteria 1062
603 Ga0495608_0494284 3300046511 Bacteria 741
604 Ga0495630_0122804 3300046517 Bacteria 1970
605 Ga0495630_0273204 3300046517 Bacteria 1291
606 Ga0495666_0021858 3300046526 Bacteria 3167
607 Ga0495666_0151103 3300046526 Bacteria 1080
608 Ga0495665_0011363 3300046531 Bacteria 4819
609 Ga0495665_0026731 3300046531 Bacteria 3099
610 Ga0495665_0148579 3300046531 Bacteria 1224
611 Ga0495665_0332171 3300046531 Bacteria 775
612 Ga0495640_0064350 3300046533 Bacteria 2480
613 Ga0495645_0264922 3300046543 Unclassified 1136
614 Ga0495645_0405866 3300046543 Unclassified 867
615 Ga0495667_0170990 3300046559 Bacteria 1396
616 Ga0495635_0029277 3300046663 Bacteria 3829
617 Ga0495657_0142812 3300046675 Bacteria 1491
618 Ga0495657_0287746 3300046675 Bacteria 982
619 Ga0495599_0184764 3300046678 Bacteria 1284
620 Ga0495658_0069689 3300046683 Bacteria 2039
621 Ga0495658_0303379 3300046683 Bacteria 1010
622 Ga0495669_0002318 3300046684 Bacteria 7799
623 Ga0495669_0029992 3300046684 Bacteria 2387
624 Ga0495581_0023298 3300047315 Unclassified 3588
625 Ga0495581_0088528 3300047315 Bacteria 1795
626 Ga0495604_0178863 3300047317 Bacteria 1485
627 Ga0495674_0010911 3300047319 Bacteria 8588
628 Ga0495674_0020609 3300047319 Bacteria 6103
629 Ga0495674_0196723 3300047319 Bacteria 1674
630 Ga0495674_0234772 3300047319 Bacteria 1513
631 Ga0495674_0343071 3300047319 Unclassified 1214
632 Ga0495674_0680826 3300047319 Unclassified 809
633 Ga0495680_0357459 3300047322 Bacteria 1016
634 Ga0495675_0247434 3300047444 Unclassified 1072
635 Ga0495677_0093393 3300047445 Bacteria 1135
636 Ga0495593_0208859 3300047673 Unclassified 980
637 Ga0495602_0156508 3300048088 Bacteria 1784
638 Ga0495602_0175584 3300048088 Bacteria 1658
639 Ga0495602_0213169 3300048088 Bacteria 1464
640 Ga0495602_0270263 3300048088 Unclassified 1257
641 Ga0495614_0315796 3300048089 Unclassified 724
642 Ga0496100_0060824 3300048903 Bacteria 2487
643 Ga0496101_0052231 3300048904 Bacteria 2947
644 Ga0496101_0318450 3300048904 Bacteria 1220
645 Ga0496102_0005937 3300048905 Bacteria 10396
646 Ga0496102_0052945 3300048905 Bacteria 3699
647 Ga0496102_0363101 3300048905 Unclassified 1363
648 Ga0496103_0008297 3300048906 Bacteria 6168
649 Ga0496104_0153745 3300048907 Bacteria 2208
650 Ga0496104_0308672 3300048907 Bacteria 1495
651 Ga0496105_0211209 3300048908 Unclassified 1582
652 Ga0496105_0247897 3300048908 Bacteria 1443
653 Ga0496105_0647316 3300048908 Unclassified 816
654 Ga0496105_0649248 3300048908 Bacteria 814
655 Ga0496106_0247080 3300048909 Bacteria 1426
656 Ga0496106_0571434 3300048909 Unclassified 907
657 Ga0496107_0042844 3300048910 Bacteria 3252
658 Ga0496107_0361623 3300048910 Bacteria 1080
659 Ga0496107_0599157 3300048910 Bacteria 814
660 Ga0496108_0124534 3300048911 Bacteria 2212
661 Ga0496108_0355645 3300048911 Unclassified 1278
662 Ga0496108_0391978 3300048911 Bacteria 1213
663 Ga0496109_0335280 3300048912 Unclassified 1428
664 Ga0496110_0552566 3300048913 Bacteria 1046
665 Ga0496110_1112353 3300048913 Bacteria 698
666 Ga0496112_0011087 3300048915 Bacteria 8215
667 Ga0496112_0058500 3300048915 Bacteria 3796
668 Ga0496112_0089568 3300048915 Bacteria 3045
669 Ga0496112_0094726 3300048915 Bacteria 2956
670 Ga0496112_0437180 3300048915 Bacteria 1246
671 Ga0496112_0619466 3300048915 Unclassified 1013
672 Ga0496113_0015649 3300048916 Bacteria 5223
673 Ga0496113_0504423 3300048916 Unclassified 971
674 Ga0496114_0056576 3300048917 Bacteria 3274
675 Ga0496114_0059045 3300048917 Bacteria 3204
676 Ga0496115_0017969 3300048918 Bacteria 5418
677 Ga0496115_0635984 3300048918 Bacteria 845
678 Ga0496115_0968686 3300048918 Bacteria 652
679 Ga0501083_0026123 3300049744 Bacteria 4040
680 Ga0501083_0085897 3300049744 Bacteria 2081
681 nmdc:mga0n895_224433_c1 3300050512 Unclassified 1907
682 nmdc:mga0rr50_45157_c1 3300050513 Bacteria 3236
683 nmdc:mga08x19_1063_c1 3300050514 Bacteria 17156
684 nmdc:mga0a205_617208_c1 3300050515 Unclassified 937
685 Ga0495601_0131310 3300053077 Bacteria 1631

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0328263 Ga0373925_0328263_90_653 184
2 3300046472 Ga0495580_0001182 Ga0495580_0001182_15722_16285 184
3 3300005435 Ga0070714_100010217 Ga0070714_1000102175 185
4 3300005435 Ga0070714_100059470 Ga0070714_1000594702 185
5 3300005436 Ga0070713_100024512 Ga0070713_1000245124 185
6 3300005436 Ga0070713_100047430 Ga0070713_1000474302 185
7 3300005467 Ga0070706_100701326 Ga0070706_1007013261 185
8 3300005468 Ga0070707_100220881 Ga0070707_1002208812 185
9 3300005614 Ga0068856_100104896 Ga0068856_1001048965 185
10 3300006028 Ga0070717_10031513 Ga0070717_100315135 185
11 3300006028 Ga0070717_10046711 Ga0070717_100467115 185
12 3300006028 Ga0070717_10303444 Ga0070717_103034442 185
13 3300006173 Ga0070716_100096582 Ga0070716_1000965823 185
14 3300006175 Ga0070712_100083096 Ga0070712_1000830962 185
15 3300006914 Ga0075436_100001267 Ga0075436_1000012676 185
16 3300007076 Ga0075435_100010410 Ga0075435_1000104107 185
17 3300009093 Ga0105240_10018684 Ga0105240_1001868410 185
18 3300013105 Ga0157369_10046588 Ga0157369_100465885 185
19 3300013307 Ga0157372_10000825 Ga0157372_1000082524 185
20 3300013307 Ga0157372_10028645 Ga0157372_100286452 185
21 3300025906 Ga0207699_10004846 Ga0207699_100048464 185
22 3300025906 Ga0207699_10301663 Ga0207699_103016632 185
23 3300025910 Ga0207684_10723930 Ga0207684_107239302 185
24 3300025913 Ga0207695_10028405 Ga0207695_100284055 185
25 3300025913 Ga0207695_10085345 Ga0207695_100853452 185
26 3300025915 Ga0207693_10138156 Ga0207693_101381563 185
27 3300025928 Ga0207700_10031073 Ga0207700_100310733 185
28 3300025928 Ga0207700_10151549 Ga0207700_101515491 185
29 3300025929 Ga0207664_10089793 Ga0207664_100897934 185
30 3300025929 Ga0207664_10305247 Ga0207664_103052472 185
31 3300025929 Ga0207664_10373971 Ga0207664_103739712 185
32 3300025939 Ga0207665_10005780 Ga0207665_100057802 185
33 3300026078 Ga0207702_10076477 Ga0207702_100764772 185
34 3300035083 Ga0373926_0055670 Ga0373926_0055670_585_1163 185
35 3300035113 Ga0373936_0032100 Ga0373936_0032100_150_719 185
36 3300035170 Ga0373943_0018454 Ga0373943_0018454_1609_2178 185
37 3300035170 Ga0373943_0237461 Ga0373943_0237461_189_767 185
38 3300035170 Ga0373943_0274154 Ga0373943_0274154_205_774 185
39 3300035692 Ga0373935_0002744 Ga0373935_0002744_9279_9848 185
40 3300035692 Ga0373935_0064889 Ga0373935_0064889_500_1078 185
41 3300035692 Ga0373935_0438278 Ga0373935_0438278_56_625 185
42 3300035695 Ga0373927_0003800 Ga0373927_0003800_3608_4186 185
43 3300035695 Ga0373927_0080802 Ga0373927_0080802_159_728 185
44 3300035725 Ga0373947_0010631 Ga0373947_0010631_2477_3046 185
45 3300035725 Ga0373947_0048835 Ga0373947_0048835_1641_2210 185
46 3300037068 Ga0373925_0006773 Ga0373925_0006773_4262_4831 185
47 3300037068 Ga0373925_0009721 Ga0373925_0009721_478_1056 185
48 3300039438 Ga0436360_0358964 Ga0436360_0358964_322_897 185
49 3300046472 Ga0495580_0005708 Ga0495580_0005708_4544_5113 185
50 3300046473 Ga0495582_0001573 Ga0495582_0001573_10800_11369 185
51 3300046526 Ga0495666_0021858 Ga0495666_0021858_592_1161 185
52 3300046531 Ga0495665_0011363 Ga0495665_0011363_1449_2018 185
53 3300046531 Ga0495665_0026731 Ga0495665_0026731_2456_3034 185
54 3300046683 Ga0495658_0303379 Ga0495658_0303379_129_698 185
55 3300047315 Ga0495581_0023298 Ga0495581_0023298_1544_2113 185
56 3300047317 Ga0495604_0178863 Ga0495604_0178863_172_750 185
57 3300047319 Ga0495674_0196723 Ga0495674_0196723_847_1416 185
58 3300048089 Ga0495614_0315796 Ga0495614_0315796_58_627 185
59 3300050513 nmdc:mga0rr50_45157_c1 nmdc:mga0rr50_45157_c1_2140_2709 185
60 3300050514 nmdc:mga08x19_1063_c1 nmdc:mga08x19_1063_c1_2584_3153 185
61 3300014969 Ga0157376_11717763 Ga0157376_117177631 189
62 3300025913 Ga0207695_10271179 Ga0207695_102711793 189
63 3300005434 Ga0070709_10049158 Ga0070709_100491583 190
64 3300005435 Ga0070714_100746881 Ga0070714_1007468812 190
65 3300005436 Ga0070713_100715086 Ga0070713_1007150861 190
66 3300005436 Ga0070713_101351123 Ga0070713_1013511231 190
67 3300005437 Ga0070710_10004463 Ga0070710_100044635 190
68 3300005439 Ga0070711_100007062 Ga0070711_1000070627 190
69 3300006163 Ga0070715_10026101 Ga0070715_100261014 190
70 3300006173 Ga0070716_100012854 Ga0070716_1000128545 190
71 3300006173 Ga0070716_100060757 Ga0070716_1000607572 190
72 3300006175 Ga0070712_100002208 Ga0070712_1000022086 190
73 3300025898 Ga0207692_10006024 Ga0207692_100060244 190
74 3300025905 Ga0207685_10069819 Ga0207685_100698192 190
75 3300025915 Ga0207693_10000013 Ga0207693_1000001365 190
76 3300025916 Ga0207663_10001881 Ga0207663_100018812 190
77 3300025928 Ga0207700_10644168 Ga0207700_106441682 190
78 3300025929 Ga0207664_10082306 Ga0207664_100823064 190
79 3300025939 Ga0207665_10019820 Ga0207665_100198206 190
80 3300025939 Ga0207665_10079100 Ga0207665_100791002 190
81 3300031090 Ga0265760_10022950 Ga0265760_100229502 190
82 3300035170 Ga0373943_0135442 Ga0373943_0135442_654_1238 190
83 3300037068 Ga0373925_0010976 Ga0373925_0010976_1419_2003 190
84 3300041496 Ga0451839_1277567 Ga0451839_1277567_90_665 190
85 3300044706 Ga0466964_0033709 Ga0466964_0033709_116_688 190
86 3300045049 Ga0466959_0320400 Ga0466959_0320400_379_954 190
87 3300045976 Ga0466967_0028583 Ga0466967_0028583_1396_1968 190
88 3300005290 Ga0065712_10304804 Ga0065712_103048041 191
89 3300005327 Ga0070658_10754492 Ga0070658_107544921 191
90 3300005328 Ga0070676_10046894 Ga0070676_100468941 191
91 3300005329 Ga0070683_100005649 Ga0070683_1000056493 191
92 3300005330 Ga0070690_100061327 Ga0070690_1000613272 191
93 3300005338 Ga0068868_100004556 Ga0068868_1000045567 191
94 3300005339 Ga0070660_100067840 Ga0070660_1000678403 191
95 3300005340 Ga0070689_100063235 Ga0070689_1000632355 191
96 3300005344 Ga0070661_100057378 Ga0070661_1000573782 191
97 3300005347 Ga0070668_100005025 Ga0070668_1000050259 191
98 3300005353 Ga0070669_100651046 Ga0070669_1006510461 191
99 3300005354 Ga0070675_100130904 Ga0070675_1001309043 191
100 3300005354 Ga0070675_100584183 Ga0070675_1005841832 191
101 3300005356 Ga0070674_100220028 Ga0070674_1002200282 191
102 3300005365 Ga0070688_100187917 Ga0070688_1001879172 191
103 3300005366 Ga0070659_100004220 Ga0070659_10000422010 191
104 3300005367 Ga0070667_100011429 Ga0070667_1000114298 191
105 3300005434 Ga0070709_10007118 Ga0070709_100071186 191
106 3300005435 Ga0070714_100002862 Ga0070714_10000286213 191
107 3300005436 Ga0070713_100000057 Ga0070713_10000005744 191
108 3300005439 Ga0070711_100021372 Ga0070711_1000213724 191
109 3300005440 Ga0070705_100287051 Ga0070705_1002870511 191
110 3300005444 Ga0070694_100091865 Ga0070694_1000918653 191
111 3300005445 Ga0070708_100018463 Ga0070708_1000184635 191
112 3300005455 Ga0070663_100257779 Ga0070663_1002577792 191
113 3300005457 Ga0070662_100130123 Ga0070662_1001301232 191
114 3300005458 Ga0070681_10369159 Ga0070681_103691591 191
115 3300005467 Ga0070706_100261281 Ga0070706_1002612812 191
116 3300005468 Ga0070707_100030458 Ga0070707_1000304585 191
117 3300005471 Ga0070698_100126852 Ga0070698_1001268523 191
118 3300005535 Ga0070684_100032221 Ga0070684_1000322212 191
119 3300005539 Ga0068853_100341029 Ga0068853_1003410292 191
120 3300005544 Ga0070686_100146117 Ga0070686_1001461172 191
121 3300005545 Ga0070695_100055008 Ga0070695_1000550082 191
122 3300005547 Ga0070693_100777961 Ga0070693_1007779611 191
123 3300005548 Ga0070665_100025297 Ga0070665_1000252975 191
124 3300005549 Ga0070704_100074126 Ga0070704_1000741263 191
125 3300005564 Ga0070664_100107745 Ga0070664_1001077453 191
126 3300005577 Ga0068857_100099360 Ga0068857_1000993603 191
127 3300005578 Ga0068854_100093557 Ga0068854_1000935571 191
128 3300005614 Ga0068856_100044332 Ga0068856_1000443325 191
129 3300005617 Ga0068859_100021521 Ga0068859_1000215215 191
130 3300005618 Ga0068864_100163288 Ga0068864_1001632882 191
131 3300005718 Ga0068866_10109315 Ga0068866_101093152 191
132 3300005719 Ga0068861_100042481 Ga0068861_1000424812 191
133 3300005834 Ga0068851_10311291 Ga0068851_103112912 191
134 3300005842 Ga0068858_100068255 Ga0068858_1000682551 191
135 3300005843 Ga0068860_100098412 Ga0068860_1000984122 191
136 3300005844 Ga0068862_100010616 Ga0068862_1000106167 191
137 3300006028 Ga0070717_10001658 Ga0070717_1000165814 191
138 3300006028 Ga0070717_10012009 Ga0070717_100120097 191
139 3300006175 Ga0070712_100036544 Ga0070712_1000365444 191
140 3300006175 Ga0070712_100304398 Ga0070712_1003043982 191
141 3300006237 Ga0097621_100495087 Ga0097621_1004950872 191
142 3300006358 Ga0068871_100067623 Ga0068871_1000676233 191
143 3300006852 Ga0075433_10655289 Ga0075433_106552892 191
144 3300006881 Ga0068865_100115694 Ga0068865_1001156942 191
145 3300006931 Ga0097620_100021523 Ga0097620_1000215235 191
146 3300009093 Ga0105240_10039687 Ga0105240_100396878 191
147 3300009093 Ga0105240_10461079 Ga0105240_104610791 191
148 3300009098 Ga0105245_10034309 Ga0105245_100343097 191
149 3300009101 Ga0105247_10020036 Ga0105247_100200363 191
150 3300009176 Ga0105242_10217703 Ga0105242_102177031 191
151 3300009177 Ga0105248_10028234 Ga0105248_100282346 191
152 3300009545 Ga0105237_10643054 Ga0105237_106430542 191
153 3300009551 Ga0105238_10030176 Ga0105238_100301767 191
154 3300009553 Ga0105249_10089823 Ga0105249_100898233 191
155 3300011119 Ga0105246_10074648 Ga0105246_100746482 191
156 3300013100 Ga0157373_10322939 Ga0157373_103229391 191
157 3300013102 Ga0157371_10014882 Ga0157371_100148825 191
158 3300013104 Ga0157370_10314105 Ga0157370_103141052 191
159 3300013105 Ga0157369_10060956 Ga0157369_100609564 191
160 3300013296 Ga0157374_10030581 Ga0157374_100305811 191
161 3300013297 Ga0157378_10435188 Ga0157378_104351882 191
162 3300013308 Ga0157375_10110076 Ga0157375_101100761 191
163 3300014325 Ga0163163_10112727 Ga0163163_101127273 191
164 3300014325 Ga0163163_10152848 Ga0163163_101528483 191
165 3300014969 Ga0157376_10174796 Ga0157376_101747963 191
166 3300014969 Ga0157376_10180233 Ga0157376_101802332 191
167 3300025321 Ga0207656_10024608 Ga0207656_100246083 191
168 3300025898 Ga0207692_10037896 Ga0207692_100378962 191
169 3300025899 Ga0207642_10030947 Ga0207642_100309473 191
170 3300025900 Ga0207710_10101690 Ga0207710_101016902 191
171 3300025903 Ga0207680_10324478 Ga0207680_103244782 191
172 3300025904 Ga0207647_10015589 Ga0207647_100155894 191
173 3300025906 Ga0207699_10003495 Ga0207699_100034956 191
174 3300025907 Ga0207645_10004270 Ga0207645_1000427010 191
175 3300025910 Ga0207684_10207565 Ga0207684_102075652 191
176 3300025912 Ga0207707_10090077 Ga0207707_100900773 191
177 3300025914 Ga0207671_10453384 Ga0207671_104533842 191
178 3300025915 Ga0207693_10000143 Ga0207693_100001434 191
179 3300025915 Ga0207693_10275488 Ga0207693_102754882 191
180 3300025916 Ga0207663_10154117 Ga0207663_101541172 191
181 3300025917 Ga0207660_10639312 Ga0207660_106393122 191
182 3300025919 Ga0207657_10002502 Ga0207657_100025027 191
183 3300025920 Ga0207649_10032077 Ga0207649_100320773 191
184 3300025921 Ga0207652_10088156 Ga0207652_100881563 191
185 3300025922 Ga0207646_10167820 Ga0207646_101678202 191
186 3300025924 Ga0207694_10088049 Ga0207694_100880494 191
187 3300025927 Ga0207687_10032008 Ga0207687_100320085 191
188 3300025928 Ga0207700_10000337 Ga0207700_100003377 191
189 3300025929 Ga0207664_10013157 Ga0207664_100131576 191
190 3300025932 Ga0207690_10080728 Ga0207690_100807281 191
191 3300025933 Ga0207706_10001321 Ga0207706_100013216 191
192 3300025934 Ga0207686_10770868 Ga0207686_107708681 191
193 3300025935 Ga0207709_10047224 Ga0207709_100472242 191
194 3300025937 Ga0207669_10154973 Ga0207669_101549733 191
195 3300025939 Ga0207665_10046599 Ga0207665_100465992 191
196 3300025941 Ga0207711_10005468 Ga0207711_100054688 191
197 3300025942 Ga0207689_10021360 Ga0207689_100213607 191
198 3300025944 Ga0207661_11523938 Ga0207661_115239381 191
199 3300025945 Ga0207679_10778907 Ga0207679_107789071 191
200 3300026041 Ga0207639_10439738 Ga0207639_104397382 191
201 3300026067 Ga0207678_10000277 Ga0207678_1000027711 191
202 3300026089 Ga0207648_10017311 Ga0207648_100173116 191
203 3300026095 Ga0207676_10128670 Ga0207676_101286703 191
204 3300026116 Ga0207674_10012162 Ga0207674_1001216210 191
205 3300026118 Ga0207675_100243973 Ga0207675_1002439731 191
206 3300028380 Ga0268265_10066561 Ga0268265_100665611 191
207 3300028381 Ga0268264_10058821 Ga0268264_100588213 191
208 3300030760 Ga0265762_1001174 Ga0265762_10011743 191
209 3300031344 Ga0265316_10027901 Ga0265316_100279016 191
210 3300034816 Ga0373930_0047228 Ga0373930_0047228_262_840 191
211 3300035088 Ga0373940_0014887 Ga0373940_0014887_191_769 191
212 3300035113 Ga0373936_0107940 Ga0373936_0107940_127_723 191
213 3300035114 Ga0373939_0004499 Ga0373939_0004499_2239_2817 191
214 3300035121 Ga0373960_0007444 Ga0373960_0007444_489_1067 191
215 3300035207 Ga0373942_0077346 Ga0373942_0077346_379_957 191
216 3300035691 Ga0373931_0444078 Ga0373931_0444078_167_745 191
217 3300036457 Ga0265778_004477 Ga0265778_004477_749_1324 191
218 3300037068 Ga0373925_0358106 Ga0373925_0358106_141_743 191
219 3300037418 Ga0395900_1237968 Ga0395900_1237968_19_597 191
220 3300042876 Ga0451577_0984051 Ga0451577_0984051_115_693 191
221 3300045051 Ga0451576_0252655 Ga0451576_0252655_635_1213 191
222 3300046472 Ga0495580_0029919 Ga0495580_0029919_2291_2869 191
223 3300046531 Ga0495665_0148579 Ga0495665_0148579_223_798 191
224 3300047319 Ga0495674_0680826 Ga0495674_0680826_58_645 191
225 3300048905 Ga0496102_0052945 Ga0496102_0052945_63_641 191
226 3300048907 Ga0496104_0153745 Ga0496104_0153745_1138_1734 191
227 3300048908 Ga0496105_0647316 Ga0496105_0647316_20_616 191
228 3300048909 Ga0496106_0571434 Ga0496106_0571434_83_661 191
229 3300048910 Ga0496107_0599157 Ga0496107_0599157_187_765 191
230 3300048913 Ga0496110_1112353 Ga0496110_1112353_33_611 191
231 3300048915 Ga0496112_0011087 Ga0496112_0011087_7346_7942 191
232 3300048915 Ga0496112_0437180 Ga0496112_0437180_651_1229 191
233 3300048916 Ga0496113_0504423 Ga0496113_0504423_360_956 191
234 3300048917 Ga0496114_0056576 Ga0496114_0056576_1992_2567 191
235 3300048918 Ga0496115_0968686 Ga0496115_0968686_16_594 191
236 3300050512 nmdc:mga0n895_224433_c1 nmdc:mga0n895_224433_c1_320_898 191
237 3300050515 nmdc:mga0a205_617208_c1 nmdc:mga0a205_617208_c1_268_858 191
238 3300001976 JGI24752J21851_1003237 JGI24752J21851_10032373 192
239 3300001990 JGI24737J22298_10112947 JGI24737J22298_101129472 192
240 3300002076 JGI24749J21850_1009599 JGI24749J21850_10095992 192
241 3300002459 JGI24751J29686_10000764 JGI24751J29686_100007642 192
242 3300005293 Ga0065715_10134981 Ga0065715_101349811 192
243 3300005293 Ga0065715_10158482 Ga0065715_101584821 192
244 3300005329 Ga0070683_100407720 Ga0070683_1004077201 192
245 3300005330 Ga0070690_100272973 Ga0070690_1002729732 192
246 3300005331 Ga0070670_100194552 Ga0070670_1001945523 192
247 3300005331 Ga0070670_100338078 Ga0070670_1003380781 192
248 3300005331 Ga0070670_100380499 Ga0070670_1003804991 192
249 3300005333 Ga0070677_10239818 Ga0070677_102398182 192
250 3300005334 Ga0068869_100074119 Ga0068869_1000741191 192
251 3300005334 Ga0068869_100624253 Ga0068869_1006242531 192
252 3300005336 Ga0070680_100506119 Ga0070680_1005061192 192
253 3300005338 Ga0068868_100096044 Ga0068868_1000960442 192
254 3300005339 Ga0070660_100151726 Ga0070660_1001517262 192
255 3300005340 Ga0070689_100010090 Ga0070689_1000100903 192
256 3300005343 Ga0070687_100317222 Ga0070687_1003172221 192
257 3300005344 Ga0070661_100012749 Ga0070661_1000127492 192
258 3300005345 Ga0070692_10472005 Ga0070692_104720051 192
259 3300005347 Ga0070668_100418056 Ga0070668_1004180562 192
260 3300005353 Ga0070669_100511106 Ga0070669_1005111062 192
261 3300005354 Ga0070675_100059776 Ga0070675_1000597764 192
262 3300005354 Ga0070675_100666770 Ga0070675_1006667702 192
263 3300005367 Ga0070667_100073367 Ga0070667_1000733673 192
264 3300005367 Ga0070667_100730903 Ga0070667_1007309032 192
265 3300005434 Ga0070709_10010494 Ga0070709_100104946 192
266 3300005434 Ga0070709_10010869 Ga0070709_100108699 192
267 3300005434 Ga0070709_10046772 Ga0070709_100467722 192
268 3300005434 Ga0070709_10100077 Ga0070709_101000771 192
269 3300005434 Ga0070709_10455055 Ga0070709_104550552 192
270 3300005435 Ga0070714_100000046 Ga0070714_10000004644 192
271 3300005436 Ga0070713_100000583 Ga0070713_1000005832 192
272 3300005436 Ga0070713_100003196 Ga0070713_1000031968 192
273 3300005436 Ga0070713_100025850 Ga0070713_1000258501 192
274 3300005436 Ga0070713_100152369 Ga0070713_1001523691 192
275 3300005436 Ga0070713_100155028 Ga0070713_1001550282 192
276 3300005436 Ga0070713_100332154 Ga0070713_1003321542 192
277 3300005436 Ga0070713_100415804 Ga0070713_1004158042 192
278 3300005436 Ga0070713_101401111 Ga0070713_1014011111 192
279 3300005437 Ga0070710_10033046 Ga0070710_100330463 192
280 3300005437 Ga0070710_10209085 Ga0070710_102090852 192
281 3300005439 Ga0070711_100203206 Ga0070711_1002032062 192
282 3300005439 Ga0070711_100273015 Ga0070711_1002730151 192
283 3300005439 Ga0070711_100449068 Ga0070711_1004490681 192
284 3300005440 Ga0070705_100125960 Ga0070705_1001259603 192
285 3300005445 Ga0070708_100000437 Ga0070708_10000043720 192
286 3300005445 Ga0070708_100015048 Ga0070708_1000150485 192
287 3300005445 Ga0070708_100033060 Ga0070708_1000330605 192
288 3300005445 Ga0070708_100062121 Ga0070708_1000621212 192
289 3300005445 Ga0070708_100070749 Ga0070708_1000707496 192
290 3300005445 Ga0070708_100162121 Ga0070708_1001621213 192
291 3300005445 Ga0070708_100174578 Ga0070708_1001745782 192
292 3300005445 Ga0070708_100333521 Ga0070708_1003335212 192
293 3300005455 Ga0070663_100021022 Ga0070663_1000210225 192
294 3300005456 Ga0070678_100074534 Ga0070678_1000745342 192
295 3300005457 Ga0070662_100128251 Ga0070662_1001282512 192
296 3300005458 Ga0070681_10006550 Ga0070681_100065503 192
297 3300005459 Ga0068867_100053866 Ga0068867_1000538662 192
298 3300005467 Ga0070706_100000935 Ga0070706_10000093528 192
299 3300005467 Ga0070706_100003883 Ga0070706_10000388311 192
300 3300005467 Ga0070706_100006968 Ga0070706_10000696812 192
301 3300005467 Ga0070706_100064219 Ga0070706_1000642192 192
302 3300005467 Ga0070706_101016775 Ga0070706_1010167751 192
303 3300005468 Ga0070707_100001244 Ga0070707_10000124420 192
304 3300005468 Ga0070707_100002157 Ga0070707_1000021577 192
305 3300005468 Ga0070707_100003649 Ga0070707_10000364911 192
306 3300005471 Ga0070698_100001005 Ga0070698_10000100520 192
307 3300005471 Ga0070698_100002044 Ga0070698_10000204417 192
308 3300005471 Ga0070698_100159775 Ga0070698_1001597752 192
309 3300005471 Ga0070698_101022260 Ga0070698_1010222601 192
310 3300005518 Ga0070699_100001100 Ga0070699_1000011008 192
311 3300005518 Ga0070699_100002908 Ga0070699_10000290818 192
312 3300005518 Ga0070699_100235755 Ga0070699_1002357552 192
313 3300005535 Ga0070684_100030673 Ga0070684_1000306736 192
314 3300005536 Ga0070697_100000266 Ga0070697_10000026621 192
315 3300005536 Ga0070697_100000701 Ga0070697_1000007015 192
316 3300005536 Ga0070697_100016981 Ga0070697_1000169816 192
317 3300005536 Ga0070697_100058991 Ga0070697_1000589912 192
318 3300005536 Ga0070697_100061663 Ga0070697_1000616635 192
319 3300005536 Ga0070697_100131111 Ga0070697_1001311111 192
320 3300005536 Ga0070697_100668358 Ga0070697_1006683581 192
321 3300005543 Ga0070672_100661908 Ga0070672_1006619081 192
322 3300005544 Ga0070686_100128055 Ga0070686_1001280552 192
323 3300005545 Ga0070695_100103496 Ga0070695_1001034962 192
324 3300005545 Ga0070695_100719205 Ga0070695_1007192051 192
325 3300005547 Ga0070693_100099957 Ga0070693_1000999572 192
326 3300005547 Ga0070693_100192365 Ga0070693_1001923651 192
327 3300005547 Ga0070693_100293454 Ga0070693_1002934541 192
328 3300005548 Ga0070665_100533677 Ga0070665_1005336772 192
329 3300005563 Ga0068855_100077184 Ga0068855_1000771843 192
330 3300005563 Ga0068855_100568963 Ga0068855_1005689632 192
331 3300005564 Ga0070664_100222428 Ga0070664_1002224281 192
332 3300005564 Ga0070664_100896424 Ga0070664_1008964241 192
333 3300005577 Ga0068857_100002168 Ga0068857_1000021687 192
334 3300005577 Ga0068857_100044253 Ga0068857_1000442534 192
335 3300005578 Ga0068854_100302063 Ga0068854_1003020633 192
336 3300005614 Ga0068856_100018058 Ga0068856_1000180587 192
337 3300005614 Ga0068856_100021804 Ga0068856_1000218043 192
338 3300005614 Ga0068856_100211510 Ga0068856_1002115101 192
339 3300005614 Ga0068856_100256296 Ga0068856_1002562963 192
340 3300005616 Ga0068852_100011844 Ga0068852_1000118448 192
341 3300005618 Ga0068864_100073221 Ga0068864_1000732213 192
342 3300005718 Ga0068866_10020794 Ga0068866_100207942 192
343 3300005719 Ga0068861_100428115 Ga0068861_1004281152 192
344 3300005834 Ga0068851_10007547 Ga0068851_100075477 192
345 3300005840 Ga0068870_10010814 Ga0068870_100108145 192
346 3300005841 Ga0068863_100106501 Ga0068863_1001065013 192
347 3300005841 Ga0068863_100292337 Ga0068863_1002923372 192
348 3300005842 Ga0068858_100033597 Ga0068858_1000335972 192
349 3300005842 Ga0068858_101030596 Ga0068858_1010305962 192
350 3300005843 Ga0068860_100051564 Ga0068860_1000515644 192
351 3300005843 Ga0068860_100192215 Ga0068860_1001922152 192
352 3300005844 Ga0068862_100237907 Ga0068862_1002379071 192
353 3300006028 Ga0070717_10001093 Ga0070717_100010935 192
354 3300006028 Ga0070717_10051907 Ga0070717_100519073 192
355 3300006028 Ga0070717_10054243 Ga0070717_100542433 192
356 3300006028 Ga0070717_10072990 Ga0070717_100729903 192
357 3300006028 Ga0070717_10155358 Ga0070717_101553582 192
358 3300006173 Ga0070716_100029846 Ga0070716_1000298463 192
359 3300006173 Ga0070716_100043545 Ga0070716_1000435452 192
360 3300006173 Ga0070716_100123616 Ga0070716_1001236162 192
361 3300006173 Ga0070716_100125871 Ga0070716_1001258712 192
362 3300006173 Ga0070716_100240198 Ga0070716_1002401982 192
363 3300006173 Ga0070716_100428372 Ga0070716_1004283722 192
364 3300006175 Ga0070712_100000130 Ga0070712_10000013034 192
365 3300006175 Ga0070712_100006015 Ga0070712_1000060157 192
366 3300006175 Ga0070712_100037951 Ga0070712_1000379513 192
367 3300006175 Ga0070712_100095851 Ga0070712_1000958513 192
368 3300006175 Ga0070712_100205780 Ga0070712_1002057801 192
369 3300006237 Ga0097621_100144143 Ga0097621_1001441433 192
370 3300006358 Ga0068871_100166672 Ga0068871_1001666723 192
371 3300006358 Ga0068871_100261319 Ga0068871_1002613192 192
372 3300006358 Ga0068871_100311734 Ga0068871_1003117342 192
373 3300006358 Ga0068871_100317771 Ga0068871_1003177712 192
374 3300007265 Ga0099794_10302792 Ga0099794_103027921 192
375 3300009092 Ga0105250_10069541 Ga0105250_100695413 192
376 3300009093 Ga0105240_10037791 Ga0105240_100377918 192
377 3300009093 Ga0105240_10216890 Ga0105240_102168903 192
378 3300009093 Ga0105240_10314497 Ga0105240_103144971 192
379 3300009093 Ga0105240_10385045 Ga0105240_103850452 192
380 3300009098 Ga0105245_10010421 Ga0105245_100104217 192
381 3300009098 Ga0105245_10011580 Ga0105245_100115802 192
382 3300009098 Ga0105245_10126039 Ga0105245_101260393 192
383 3300009098 Ga0105245_10397236 Ga0105245_103972362 192
384 3300009101 Ga0105247_10061130 Ga0105247_100611303 192
385 3300009101 Ga0105247_10186684 Ga0105247_101866843 192
386 3300009174 Ga0105241_10001638 Ga0105241_1000163811 192
387 3300009174 Ga0105241_10014378 Ga0105241_100143786 192
388 3300009174 Ga0105241_10092985 Ga0105241_100929854 192
389 3300009174 Ga0105241_10201452 Ga0105241_102014522 192
390 3300009177 Ga0105248_10024998 Ga0105248_100249987 192
391 3300009177 Ga0105248_10477857 Ga0105248_104778572 192
392 3300009545 Ga0105237_10009832 Ga0105237_100098323 192
393 3300009545 Ga0105237_10039971 Ga0105237_100399713 192
394 3300009545 Ga0105237_10423771 Ga0105237_104237712 192
395 3300009551 Ga0105238_10137889 Ga0105238_101378893 192
396 3300009551 Ga0105238_10165197 Ga0105238_101651971 192
397 3300009551 Ga0105238_11074347 Ga0105238_110743471 192
398 3300009551 Ga0105238_11329721 Ga0105238_113297211 192
399 3300009553 Ga0105249_10032205 Ga0105249_100322053 192
400 3300009553 Ga0105249_10071939 Ga0105249_100719392 192
401 3300011119 Ga0105246_10202787 Ga0105246_102027872 192
402 3300013100 Ga0157373_10001299 Ga0157373_1000129910 192
403 3300013100 Ga0157373_10004687 Ga0157373_100046876 192
404 3300013100 Ga0157373_10535255 Ga0157373_105352551 192
405 3300013102 Ga0157371_10008938 Ga0157371_100089387 192
406 3300013104 Ga0157370_10016617 Ga0157370_100166172 192
407 3300013105 Ga0157369_10031049 Ga0157369_100310499 192
408 3300013105 Ga0157369_10201939 Ga0157369_102019392 192
409 3300013105 Ga0157369_10323184 Ga0157369_103231842 192
410 3300013296 Ga0157374_10013788 Ga0157374_1001378810 192
411 3300013296 Ga0157374_10038624 Ga0157374_100386245 192
412 3300013296 Ga0157374_10062225 Ga0157374_100622252 192
413 3300013296 Ga0157374_10291834 Ga0157374_102918342 192
414 3300013296 Ga0157374_10403686 Ga0157374_104036862 192
415 3300013297 Ga0157378_10983779 Ga0157378_109837792 192
416 3300013306 Ga0163162_10001531 Ga0163162_100015318 192
417 3300013306 Ga0163162_10015654 Ga0163162_100156546 192
418 3300013306 Ga0163162_10373372 Ga0163162_103733722 192
419 3300013307 Ga0157372_10015799 Ga0157372_1001579910 192
420 3300013307 Ga0157372_10039702 Ga0157372_100397023 192
421 3300013307 Ga0157372_10078707 Ga0157372_100787071 192
422 3300013308 Ga0157375_10288099 Ga0157375_102880992 192
423 3300013308 Ga0157375_12098690 Ga0157375_120986901 192
424 3300014325 Ga0163163_10010127 Ga0163163_100101278 192
425 3300014325 Ga0163163_10040139 Ga0163163_100401394 192
426 3300014325 Ga0163163_10116898 Ga0163163_101168984 192
427 3300014325 Ga0163163_10300583 Ga0163163_103005831 192
428 3300014325 Ga0163163_11031706 Ga0163163_110317061 192
429 3300014745 Ga0157377_10021473 Ga0157377_100214734 192
430 3300014968 Ga0157379_10001261 Ga0157379_1000126121 192
431 3300014968 Ga0157379_10007858 Ga0157379_100078589 192
432 3300014968 Ga0157379_10078446 Ga0157379_100784461 192
433 3300014968 Ga0157379_10241143 Ga0157379_102411433 192
434 3300014969 Ga0157376_10917042 Ga0157376_109170422 192
435 3300019183 Ga0184601_104320 Ga0184601_1043201 192
436 3300021377 Ga0213874_10063999 Ga0213874_100639992 192
437 3300022730 Ga0224570_100291 Ga0224570_1002913 192
438 3300023672 Ga0247553_100308 Ga0247553_1003082 192
439 3300024225 Ga0224572_1000408 Ga0224572_10004083 192
440 3300024227 Ga0228598_1002732 Ga0228598_10027323 192
441 3300024227 Ga0228598_1020970 Ga0228598_10209702 192
442 3300025898 Ga0207692_10025360 Ga0207692_100253603 192
443 3300025906 Ga0207699_10000528 Ga0207699_100005285 192
444 3300025906 Ga0207699_10012963 Ga0207699_100129635 192
445 3300025906 Ga0207699_10170108 Ga0207699_101701081 192
446 3300025906 Ga0207699_10246783 Ga0207699_102467831 192
447 3300025906 Ga0207699_10452759 Ga0207699_104527591 192
448 3300025906 Ga0207699_10489048 Ga0207699_104890481 192
449 3300025910 Ga0207684_10000274 Ga0207684_1000027421 192
450 3300025910 Ga0207684_10003347 Ga0207684_1000334713 192
451 3300025910 Ga0207684_10019671 Ga0207684_100196715 192
452 3300025910 Ga0207684_10096830 Ga0207684_100968302 192
453 3300025910 Ga0207684_10145762 Ga0207684_101457624 192
454 3300025911 Ga0207654_10139287 Ga0207654_101392872 192
455 3300025911 Ga0207654_10232786 Ga0207654_102327862 192
456 3300025912 Ga0207707_10009709 Ga0207707_100097099 192
457 3300025912 Ga0207707_10196174 Ga0207707_101961741 192
458 3300025913 Ga0207695_10047537 Ga0207695_100475374 192
459 3300025914 Ga0207671_10332065 Ga0207671_103320652 192
460 3300025915 Ga0207693_10002309 Ga0207693_1000230911 192
461 3300025915 Ga0207693_10004457 Ga0207693_100044578 192
462 3300025915 Ga0207693_10014717 Ga0207693_100147178 192
463 3300025915 Ga0207693_10062201 Ga0207693_100622012 192
464 3300025915 Ga0207693_10275187 Ga0207693_102751872 192
465 3300025916 Ga0207663_10012032 Ga0207663_100120324 192
466 3300025916 Ga0207663_10887446 Ga0207663_108874461 192
467 3300025922 Ga0207646_10000240 Ga0207646_1000024021 192
468 3300025922 Ga0207646_10000341 Ga0207646_1000034115 192
469 3300025922 Ga0207646_10113350 Ga0207646_101133502 192
470 3300025922 Ga0207646_10294921 Ga0207646_102949211 192
471 3300025922 Ga0207646_10617367 Ga0207646_106173671 192
472 3300025924 Ga0207694_10391345 Ga0207694_103913451 192
473 3300025924 Ga0207694_10576520 Ga0207694_105765201 192
474 3300025925 Ga0207650_10295167 Ga0207650_102951671 192
475 3300025927 Ga0207687_10100734 Ga0207687_101007343 192
476 3300025928 Ga0207700_10000346 Ga0207700_1000034619 192
477 3300025928 Ga0207700_10012848 Ga0207700_100128484 192
478 3300025928 Ga0207700_10066360 Ga0207700_100663603 192
479 3300025928 Ga0207700_10219183 Ga0207700_102191833 192
480 3300025928 Ga0207700_10370578 Ga0207700_103705782 192
481 3300025928 Ga0207700_10392450 Ga0207700_103924502 192
482 3300025929 Ga0207664_10000201 Ga0207664_1000020144 192
483 3300025929 Ga0207664_10392487 Ga0207664_103924872 192
484 3300025939 Ga0207665_10003598 Ga0207665_100035989 192
485 3300025939 Ga0207665_10014974 Ga0207665_100149741 192
486 3300025939 Ga0207665_10050393 Ga0207665_100503932 192
487 3300025939 Ga0207665_10068696 Ga0207665_100686963 192
488 3300025939 Ga0207665_10140700 Ga0207665_101407002 192
489 3300025939 Ga0207665_10299628 Ga0207665_102996282 192
490 3300025941 Ga0207711_10332417 Ga0207711_103324172 192
491 3300025942 Ga0207689_10291861 Ga0207689_102918613 192
492 3300025945 Ga0207679_10822240 Ga0207679_108222401 192
493 3300025949 Ga0207667_10353783 Ga0207667_103537832 192
494 3300025949 Ga0207667_10451906 Ga0207667_104519061 192
495 3300025981 Ga0207640_10391143 Ga0207640_103911431 192
496 3300025981 Ga0207640_11263669 Ga0207640_112636691 192
497 3300025986 Ga0207658_10169082 Ga0207658_101690822 192
498 3300025986 Ga0207658_10625454 Ga0207658_106254541 192
499 3300026023 Ga0207677_10052606 Ga0207677_100526062 192
500 3300026023 Ga0207677_10268477 Ga0207677_102684772 192
501 3300026078 Ga0207702_10010742 Ga0207702_100107425 192
502 3300026078 Ga0207702_10089073 Ga0207702_100890732 192
503 3300026078 Ga0207702_10505245 Ga0207702_105052452 192
504 3300026088 Ga0207641_10049231 Ga0207641_100492314 192
505 3300026088 Ga0207641_10331212 Ga0207641_103312122 192
506 3300026088 Ga0207641_10421987 Ga0207641_104219871 192
507 3300026116 Ga0207674_10016566 Ga0207674_100165664 192
508 3300026116 Ga0207674_10181249 Ga0207674_101812493 192
509 3300026121 Ga0207683_10160969 Ga0207683_101609694 192
510 3300028017 Ga0265356_1001162 Ga0265356_10011622 192
511 3300028017 Ga0265356_1002472 Ga0265356_10024722 192
512 3300028379 Ga0268266_10305898 Ga0268266_103058982 192
513 3300028381 Ga0268264_10042134 Ga0268264_100421344 192
514 3300028800 Ga0265338_10024720 Ga0265338_100247203 192
515 3300028800 Ga0265338_10367482 Ga0265338_103674821 192
516 3300030836 Ga0265767_100901 Ga0265767_1009012 192
517 3300030877 Ga0265777_101754 Ga0265777_1017542 192
518 3300030879 Ga0265765_1012605 Ga0265765_10126052 192
519 3300030882 Ga0265764_103767 Ga0265764_1037671 192
520 3300031010 Ga0265771_1011809 Ga0265771_10118091 192
521 3300031090 Ga0265760_10003825 Ga0265760_100038253 192
522 3300031090 Ga0265760_10007880 Ga0265760_100078801 192
523 3300031247 Ga0265340_10095583 Ga0265340_100955832 192
524 3300031249 Ga0265339_10020315 Ga0265339_100203153 192
525 3300031249 Ga0265339_10030436 Ga0265339_100304362 192
526 3300031249 Ga0265339_10033158 Ga0265339_100331584 192
527 3300031249 Ga0265339_10149990 Ga0265339_101499902 192
528 3300031344 Ga0265316_10002054 Ga0265316_1000205417 192
529 3300031344 Ga0265316_10049817 Ga0265316_100498175 192
530 3300031711 Ga0265314_10000348 Ga0265314_1000034835 192
531 3300031711 Ga0265314_10023827 Ga0265314_100238275 192
532 3300031711 Ga0265314_10074163 Ga0265314_100741631 192
533 3300031711 Ga0265314_10100093 Ga0265314_101000931 192
534 3300031712 Ga0265342_10048686 Ga0265342_100486862 192
535 3300031712 Ga0265342_10295034 Ga0265342_102950341 192
536 3300032120 Ga0316053_100216 Ga0316053_1002162 192
537 3300033547 Ga0316212_1006664 Ga0316212_10066642 192
538 3300033547 Ga0316212_1019356 Ga0316212_10193561 192
539 3300035083 Ga0373926_0005377 Ga0373926_0005377_1614_2195 192
540 3300035086 Ga0373934_0038417 Ga0373934_0038417_522_1100 192
541 3300035091 Ga0373951_0025103 Ga0373951_0025103_589_1173 192
542 3300035111 Ga0373923_0008953 Ga0373923_0008953_1082_1663 192
543 3300035112 Ga0373932_0015752 Ga0373932_0015752_317_901 192
544 3300035113 Ga0373936_0000275 Ga0373936_0000275_6958_7539 192
545 3300035113 Ga0373936_0018891 Ga0373936_0018891_25_606 192
546 3300035116 Ga0373945_0053857 Ga0373945_0053857_182_763 192
547 3300035117 Ga0373953_0057031 Ga0373953_0057031_161_742 192
548 3300035118 Ga0373954_0029119 Ga0373954_0029119_1115_1696 192
549 3300035119 Ga0373956_0035693 Ga0373956_0035693_475_1056 192
550 3300035170 Ga0373943_0000011 Ga0373943_0000011_50195_50776 192
551 3300035170 Ga0373943_0136882 Ga0373943_0136882_573_1154 192
552 3300035171 Ga0373946_0004868 Ga0373946_0004868_581_1162 192
553 3300035172 Ga0373955_0419814 Ga0373955_0419814_11_592 192
554 3300035410 Ga0373924_0015151 Ga0373924_0015151_2146_2727 192
555 3300035410 Ga0373924_0082057 Ga0373924_0082057_191_778 192
556 3300035410 Ga0373924_0085550 Ga0373924_0085550_46_639 192
557 3300035691 Ga0373931_0008821 Ga0373931_0008821_3170_3754 192
558 3300035692 Ga0373935_0001861 Ga0373935_0001861_8691_9272 192
559 3300035695 Ga0373927_0000604 Ga0373927_0000604_1081_1662 192
560 3300035695 Ga0373927_0199084 Ga0373927_0199084_251_844 192
561 3300035695 Ga0373927_0279037 Ga0373927_0279037_28_609 192
562 3300035724 Ga0373933_0021828 Ga0373933_0021828_2529_3116 192
563 3300035724 Ga0373933_0200177 Ga0373933_0200177_128_712 192
564 3300035725 Ga0373947_0000784 Ga0373947_0000784_18110_18691 192
565 3300036401 Ga0373937_0096584 Ga0373937_0096584_740_1318 192
566 3300036401 Ga0373937_0373907 Ga0373937_0373907_556_1149 192
567 3300036401 Ga0373937_0489643 Ga0373937_0489643_564_1151 192
568 3300037068 Ga0373925_0001438 Ga0373925_0001438_14454_15035 192
569 3300037068 Ga0373925_0012397 Ga0373925_0012397_2354_2935 192
570 3300039450 Ga0436363_0451864 Ga0436363_0451864_1378_1962 192
571 3300042876 Ga0451577_0000241 Ga0451577_0000241_95474_96064 192
572 3300042876 Ga0451577_0677628 Ga0451577_0677628_123_722 192
573 3300044694 Ga0466963_0085737 Ga0466963_0085737_400_990 192
574 3300044712 Ga0453684_0000366 Ga0453684_0000366_85301_85891 192
575 3300044712 Ga0453684_0738228 Ga0453684_0738228_44_637 192
576 3300044712 Ga0453684_1510077 Ga0453684_1510077_78_671 192
577 3300045051 Ga0451576_0005686 Ga0451576_0005686_811_1401 192
578 3300045051 Ga0451576_0641173 Ga0451576_0641173_294_887 192
579 3300045976 Ga0466967_0028774 Ga0466967_0028774_1173_1760 192
580 3300045976 Ga0466967_0086055 Ga0466967_0086055_2096_2686 192
581 3300046463 Ga0495653_0083918 Ga0495653_0083918_85_666 192
582 3300046472 Ga0495580_0008969 Ga0495580_0008969_1900_2481 192
583 3300046472 Ga0495580_0023555 Ga0495580_0023555_949_1542 192
584 3300046472 Ga0495580_0263134 Ga0495580_0263134_302_886 192
585 3300046473 Ga0495582_0230587 Ga0495582_0230587_405_998 192
586 3300046473 Ga0495582_0373567 Ga0495582_0373567_115_693 192
587 3300046477 Ga0495664_0081079 Ga0495664_0081079_1210_1791 192
588 3300046511 Ga0495608_0268191 Ga0495608_0268191_410_991 192
589 3300046511 Ga0495608_0494284 Ga0495608_0494284_68_661 192
590 3300046526 Ga0495666_0151103 Ga0495666_0151103_426_1004 192
591 3300046531 Ga0495665_0332171 Ga0495665_0332171_159_752 192
592 3300046543 Ga0495645_0264922 Ga0495645_0264922_204_785 192
593 3300046559 Ga0495667_0170990 Ga0495667_0170990_578_1171 192
594 3300046663 Ga0495635_0029277 Ga0495635_0029277_1391_1984 192
595 3300046675 Ga0495657_0142812 Ga0495657_0142812_499_1092 192
596 3300046675 Ga0495657_0287746 Ga0495657_0287746_66_659 192
597 3300046684 Ga0495669_0002318 Ga0495669_0002318_2072_2665 192
598 3300046684 Ga0495669_0029992 Ga0495669_0029992_55_648 192
599 3300047315 Ga0495581_0088528 Ga0495581_0088528_1153_1746 192
600 3300047319 Ga0495674_0020609 Ga0495674_0020609_5112_5693 192
601 3300047319 Ga0495674_0343071 Ga0495674_0343071_273_857 192
602 3300047444 Ga0495675_0247434 Ga0495675_0247434_276_866 192
603 3300047445 Ga0495677_0093393 Ga0495677_0093393_521_1114 192
604 3300048088 Ga0495602_0156508 Ga0495602_0156508_1164_1745 192
605 3300048088 Ga0495602_0175584 Ga0495602_0175584_560_1150 192
606 3300048088 Ga0495602_0213169 Ga0495602_0213169_412_999 192
607 3300048903 Ga0496100_0060824 Ga0496100_0060824_723_1307 192
608 3300048904 Ga0496101_0052231 Ga0496101_0052231_1846_2430 192
609 3300048904 Ga0496101_0318450 Ga0496101_0318450_465_1058 192
610 3300048905 Ga0496102_0005937 Ga0496102_0005937_8144_8728 192
611 3300048905 Ga0496102_0363101 Ga0496102_0363101_111_701 192
612 3300048906 Ga0496103_0008297 Ga0496103_0008297_924_1508 192
613 3300048907 Ga0496104_0308672 Ga0496104_0308672_458_1051 192
614 3300048908 Ga0496105_0211209 Ga0496105_0211209_423_1007 192
615 3300048908 Ga0496105_0247897 Ga0496105_0247897_250_834 192
616 3300048908 Ga0496105_0649248 Ga0496105_0649248_51_635 192
617 3300048909 Ga0496106_0247080 Ga0496106_0247080_832_1416 192
618 3300048910 Ga0496107_0042844 Ga0496107_0042844_204_788 192
619 3300048910 Ga0496107_0361623 Ga0496107_0361623_13_603 192
620 3300048911 Ga0496108_0124534 Ga0496108_0124534_173_766 192
621 3300048911 Ga0496108_0355645 Ga0496108_0355645_570_1154 192
622 3300048911 Ga0496108_0391978 Ga0496108_0391978_95_679 192
623 3300048912 Ga0496109_0335280 Ga0496109_0335280_328_912 192
624 3300048913 Ga0496110_0552566 Ga0496110_0552566_49_642 192
625 3300048915 Ga0496112_0058500 Ga0496112_0058500_1361_1951 192
626 3300048915 Ga0496112_0089568 Ga0496112_0089568_392_976 192
627 3300048915 Ga0496112_0094726 Ga0496112_0094726_1221_1814 192
628 3300048915 Ga0496112_0619466 Ga0496112_0619466_334_927 192
629 3300048916 Ga0496113_0015649 Ga0496113_0015649_3490_4083 192
630 3300048917 Ga0496114_0059045 Ga0496114_0059045_116_700 192
631 3300048918 Ga0496115_0017969 Ga0496115_0017969_769_1353 192
632 3300048918 Ga0496115_0635984 Ga0496115_0635984_81_668 192
633 3300049744 Ga0501083_0026123 Ga0501083_0026123_3223_3804 192
634 3300049744 Ga0501083_0085897 Ga0501083_0085897_933_1514 192
635 3300005338 Ga0068868_100743530 Ga0068868_1007435302 193
636 3300024227 Ga0228598_1000383 Ga0228598_10003837 195
637 3300031090 Ga0265760_10034347 Ga0265760_100343471 195
638 3300005445 Ga0070708_100055671 Ga0070708_1000556715 196
639 3300005518 Ga0070699_100033580 Ga0070699_1000335805 196
640 3300007265 Ga0099794_10011693 Ga0099794_100116933 196
641 3300025922 Ga0207646_10411798 Ga0207646_104117982 196
642 3300035083 Ga0373926_0168743 Ga0373926_0168743_192_797 196
643 3300037068 Ga0373925_0081841 Ga0373925_0081841_1534_2148 196
644 3300046517 Ga0495630_0273204 Ga0495630_0273204_217_831 196
645 3300031090 Ga0265760_10000817 Ga0265760_100008176 197
646 3300035170 Ga0373943_0052333 Ga0373943_0052333_30_647 197
647 3300035724 Ga0373933_0050277 Ga0373933_0050277_1067_1675 197
648 3300036401 Ga0373937_0114777 Ga0373937_0114777_734_1342 197
649 3300037068 Ga0373925_0026046 Ga0373925_0026046_2695_3312 197
650 3300046472 Ga0495580_0069661 Ga0495580_0069661_1081_1698 197
651 3300046473 Ga0495582_0014062 Ga0495582_0014062_2705_3322 197
652 3300046543 Ga0495645_0405866 Ga0495645_0405866_21_629 197
653 3300047319 Ga0495674_0234772 Ga0495674_0234772_326_967 197
654 3300047322 Ga0495680_0357459 Ga0495680_0357459_345_983 197
655 3300048088 Ga0495602_0270263 Ga0495602_0270263_556_1164 197
656 3300000546 LJNas_1000260 LJNas_10002604 198
657 3300005334 Ga0068869_100689783 Ga0068869_1006897831 198
658 3300005338 Ga0068868_100355108 Ga0068868_1003551082 198
659 3300005445 Ga0070708_100334466 Ga0070708_1003344662 198
660 3300005467 Ga0070706_100577490 Ga0070706_1005774902 198
661 3300005468 Ga0070707_100395934 Ga0070707_1003959342 198
662 3300005518 Ga0070699_100037176 Ga0070699_1000371761 198
663 3300005614 Ga0068856_100064873 Ga0068856_1000648732 198
664 3300009098 Ga0105245_10616474 Ga0105245_106164742 198
665 3300022734 Ga0224571_100317 Ga0224571_1003173 198
666 3300024225 Ga0224572_1004935 Ga0224572_10049353 198
667 3300025910 Ga0207684_10517208 Ga0207684_105172082 198
668 3300025922 Ga0207646_10327932 Ga0207646_103279322 198
669 3300025942 Ga0207689_10745622 Ga0207689_107456221 198
670 3300026078 Ga0207702_10010133 Ga0207702_100101336 198
671 3300028558 Ga0265326_10066592 Ga0265326_100665922 198
672 3300031090 Ga0265760_10001979 Ga0265760_100019797 198
673 3300031235 Ga0265330_10009005 Ga0265330_100090055 198
674 3300031247 Ga0265340_10044209 Ga0265340_100442093 198
675 3300037068 Ga0373925_0305927 Ga0373925_0305927_196_822 198
676 3300046457 Ga0495590_0025074 Ga0495590_0025074_639_1277 198
677 3300046472 Ga0495580_0305002 Ga0495580_0305002_112_717 198
678 3300046477 Ga0495664_0220452 Ga0495664_0220452_167_793 198
679 3300046517 Ga0495630_0122804 Ga0495630_0122804_1208_1834 198
680 3300046533 Ga0495640_0064350 Ga0495640_0064350_172_798 198
681 3300046678 Ga0495599_0184764 Ga0495599_0184764_185_811 198
682 3300046683 Ga0495658_0069689 Ga0495658_0069689_237_860 198
683 3300047319 Ga0495674_0010911 Ga0495674_0010911_5377_6003 198
684 3300047673 Ga0495593_0208859 Ga0495593_0208859_287_913 198
685 3300053077 Ga0495601_0131310 Ga0495601_0131310_980_1606 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

38

221

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.933 5 194
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9314 7 183
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.9305 7 191
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9292 8 194
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9274 5 183
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9285 66 193 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9224 7 193 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9162 8 198 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9153 8 192 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9124 4 191 3.40.50.1470
ID Description Score Start End GO Terms
AF-X1IHG4-F1-model_v4 Peptidyl-tRNA hydrolase 0.9897 92 193 GO:0004045
AF-A0A2V9ZXL4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.974 8 193 GO:0004045
GO:0005737
GO:0006412
AF-G2LJA4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9665 8 193 GO:0004045
GO:0005737
GO:0006412
AF-A0A7W1T158-F1-model_v4 Aminoacyl-tRNA hydrolase (EC 3.1.1.29) 0.9656 41 198 GO:0004045
AF-A0A2V9ZXL4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9638 8 193 GO:0004045
GO:0005737
GO:0006412

Feature Viewer

pLDDT pTM Quality
92.07 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map