F475110

General Info

Members Datasets Scaffolds Average Seq Length
685 371 685 98

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10592365|Ga0070681_105923652
Length 105
Sequence VSQKGQVMATYEGKRTIDGLVVTADGKRLDEHYEVKRFTKYGFEWTYEGESPQQLALAILYDHLGDKDRAIRMSEPFMRKVVANLDNDWTLRGEDVAAFVAGAGT

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
301 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
302 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 8.47
Rhizosphere 89.64
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214881028 2209111006 Unclassified 578
2 JGI24737J22298_10083048 3300001990 Bacteria 953
3 JGI24743J22301_10025535 3300001991 Bacteria 1145
4 JGI24750J21931_1001341 3300002070 Bacteria 3090
5 JGI24738J21930_10062502 3300002075 Unclassified 765
6 JGI24749J21850_1034635 3300002076 Bacteria 731
7 JGI24744J21845_10025982 3300002077 Unclassified 1139
8 JGI24034J26672_10015667 3300002239 Unclassified 1162
9 JGI24742J22300_10001929 3300002244 Bacteria 3302
10 JGI24751J29686_10014846 3300002459 Bacteria 1607
11 JGI25153J46596_10000711 3300003215 Bacteria 20338
12 JGI25404J52841_10064658 3300003659 Bacteria 765
13 JGI25405J52794_10004873 3300003911 Bacteria 2405
14 Ga0065707_10543569 3300005295 Bacteria 726
15 Ga0070676_10567433 3300005328 Unclassified 814
16 Ga0070676_10694783 3300005328 Bacteria 742
17 Ga0070676_11339488 3300005328 Unclassified 548
18 Ga0070683_100115805 3300005329 Bacteria 2530
19 Ga0070683_100205026 3300005329 Bacteria 1873
20 Ga0070690_100050605 3300005330 Bacteria 2651
21 Ga0070670_100596065 3300005331 Unclassified 988
22 Ga0070666_10023216 3300005335 Bacteria 4036
23 Ga0070666_10129280 3300005335 Bacteria 1754
24 Ga0070680_100148475 3300005336 Bacteria 1968
25 Ga0070680_102019077 3300005336 Bacteria 500
26 Ga0068868_100173786 3300005338 Bacteria 1784
27 Ga0070660_100884455 3300005339 Bacteria 753
28 Ga0070660_101136214 3300005339 Bacteria 661
29 Ga0070689_100202762 3300005340 Bacteria 1620
30 Ga0070691_10034543 3300005341 Bacteria 2380
31 Ga0070687_100064706 3300005343 Bacteria 1943
32 Ga0070687_100175550 3300005343 Unclassified 1279
33 Ga0070661_100222692 3300005344 Bacteria 1448
34 Ga0070692_10038798 3300005345 Bacteria 2429
35 Ga0070668_100087445 3300005347 Bacteria 2452
36 Ga0070668_100535529 3300005347 Unclassified 1018
37 Ga0070669_100463089 3300005353 Unclassified 1047
38 Ga0070669_100967319 3300005353 Bacteria 729
39 Ga0070675_100221317 3300005354 Bacteria 1648
40 Ga0070671_100177396 3300005355 Bacteria 1803
41 Ga0070671_100778361 3300005355 Bacteria 832
42 Ga0070674_100305946 3300005356 Bacteria 1269
43 Ga0070674_100575308 3300005356 Bacteria 948
44 Ga0070673_100051409 3300005364 Bacteria 3227
45 Ga0070673_100092739 3300005364 Bacteria 2471
46 Ga0070673_101388442 3300005364 Unclassified 661
47 Ga0070688_100019755 3300005365 Bacteria 3906
48 Ga0070659_100274381 3300005366 Bacteria 1401
49 Ga0070667_100760484 3300005367 Unclassified 898
50 Ga0070703_10319443 3300005406 Bacteria 653
51 Ga0070709_10003717 3300005434 Bacteria 8199
52 Ga0070709_11426750 3300005434 Bacteria 561
53 Ga0070714_100027177 3300005435 Bacteria 4735
54 Ga0070714_100351433 3300005435 Unclassified 1385
55 Ga0070713_100004110 3300005436 Bacteria 9698
56 Ga0070713_100434942 3300005436 Bacteria 1230
57 Ga0070713_101218970 3300005436 Unclassified 728
58 Ga0070710_10005634 3300005437 Bacteria 5960
59 Ga0070710_10269330 3300005437 Bacteria 1101
60 Ga0070711_100829849 3300005439 Bacteria 785
61 Ga0070711_100911483 3300005439 Unclassified 750
62 Ga0070705_100460808 3300005440 Bacteria 956
63 Ga0070705_100762615 3300005440 Unclassified 766
64 Ga0070700_100157106 3300005441 Bacteria 1561
65 Ga0070700_100964888 3300005441 Unclassified 698
66 Ga0070694_100133382 3300005444 Bacteria 1797
67 Ga0070694_101490107 3300005444 Bacteria 572
68 Ga0070708_101890748 3300005445 Bacteria 553
69 Ga0070663_100337562 3300005455 Bacteria 1216
70 Ga0070663_100889703 3300005455 Unclassified 768
71 Ga0070678_100189872 3300005456 Bacteria 1688
72 Ga0070678_100323936 3300005456 Bacteria 1317
73 Ga0070662_100037565 3300005457 Bacteria 3434
74 Ga0070681_10592365 3300005458 Bacteria 1023
75 Ga0070681_11996703 3300005458 Bacteria 508
76 Ga0068867_100041718 3300005459 Bacteria 3353
77 Ga0068867_100301491 3300005459 Bacteria 1321
78 Ga0070679_100161661 3300005530 Bacteria 2214
79 Ga0070679_100604774 3300005530 Bacteria 1040
80 Ga0070679_100978525 3300005530 Bacteria 790
81 Ga0070684_100126352 3300005535 Bacteria 2304
82 Ga0070684_100165924 3300005535 Bacteria 2004
83 Ga0070684_100263281 3300005535 Bacteria 1577
84 Ga0068853_100600650 3300005539 Bacteria 1045
85 Ga0068853_101156250 3300005539 Unclassified 747
86 Ga0070672_100151698 3300005543 Bacteria 1917
87 Ga0070686_100287153 3300005544 Bacteria 1215
88 Ga0070686_100448579 3300005544 Bacteria 991
89 Ga0070696_100011790 3300005546 Bacteria 5858
90 Ga0070696_101249308 3300005546 Bacteria 629
91 Ga0070693_100205167 3300005547 Unclassified 1283
92 Ga0070693_101458945 3300005547 Bacteria 533
93 Ga0070665_100210003 3300005548 Bacteria 1947
94 Ga0070704_100003037 3300005549 Bacteria 9551
95 Ga0068855_100157074 3300005563 Bacteria 2583
96 Ga0068855_100546820 3300005563 Unclassified 1254
97 Ga0070664_100018435 3300005564 Bacteria 5734
98 Ga0070664_100289865 3300005564 Bacteria 1477
99 Ga0070664_101270056 3300005564 Bacteria 695
100 Ga0068854_100071551 3300005578 Bacteria 2537
101 Ga0068856_100548702 3300005614 Bacteria 1177
102 Ga0068852_100766955 3300005616 Bacteria 977
103 Ga0068852_100777694 3300005616 Bacteria 970
104 Ga0068859_100077463 3300005617 Bacteria 3365
105 Ga0068859_100498048 3300005617 Unclassified 1313
106 Ga0068864_100005603 3300005618 Bacteria 10294
107 Ga0068864_100194705 3300005618 Bacteria 1859
108 Ga0068866_10048175 3300005718 Bacteria 2153
109 Ga0068861_100329960 3300005719 Unclassified 1331
110 Ga0068861_101625783 3300005719 Bacteria 637
111 Ga0068851_10049054 3300005834 Bacteria 2141
112 Ga0068870_10125530 3300005840 Bacteria 1484
113 Ga0068863_100090051 3300005841 Bacteria 2909
114 Ga0068863_100199880 3300005841 Bacteria 1922
115 Ga0068858_100124350 3300005842 Bacteria 2414
116 Ga0068860_100056993 3300005843 Bacteria 3713
117 Ga0068862_100123793 3300005844 Bacteria 2281
118 Ga0068862_100599485 3300005844 Bacteria 1057
119 Ga0081455_10002167 3300005937 Bacteria 23428
120 Ga0081455_10115039 3300005937 Bacteria 2130
121 Ga0081540_1000008 3300005983 Bacteria 203702
122 Ga0070717_10002524 3300006028 Bacteria 12888
123 Ga0070717_11550002 3300006028 Bacteria 601
124 Ga0070717_12148950 3300006028 Bacteria 502
125 Ga0075365_10444672 3300006038 Bacteria 915
126 Ga0070715_10035898 3300006163 Bacteria 2041
127 Ga0070715_10154817 3300006163 Unclassified 1127
128 Ga0070715_10483732 3300006163 Bacteria 705
129 Ga0070716_100243226 3300006173 Bacteria 1221
130 Ga0070716_100420967 3300006173 Bacteria 966
131 Ga0070712_100036653 3300006175 Bacteria 3339
132 Ga0070712_100112330 3300006175 Bacteria 2035
133 Ga0070712_100270553 3300006175 Bacteria 1365
134 Ga0070712_100796922 3300006175 Bacteria 810
135 Ga0070712_101540531 3300006175 Unclassified 581
136 Ga0075369_10533538 3300006186 Unclassified 559
137 Ga0097621_100239229 3300006237 Bacteria 1587
138 Ga0097621_101486726 3300006237 Unclassified 642
139 Ga0075370_10470580 3300006353 Bacteria 757
140 Ga0075370_10595282 3300006353 Unclassified 670
141 Ga0068871_100159680 3300006358 Bacteria 1927
142 Ga0068871_100575992 3300006358 Unclassified 1022
143 Ga0075428_100002840 3300006844 Bacteria 18885
144 Ga0075428_102131069 3300006844 Unclassified 579
145 Ga0075430_100094409 3300006846 Bacteria 2501
146 Ga0075431_100001610 3300006847 Bacteria 21067
147 Ga0075433_10128386 3300006852 Bacteria 2252
148 Ga0075433_11172471 3300006852 Bacteria 667
149 Ga0075434_100086382 3300006871 Bacteria 3137
150 Ga0075434_100118738 3300006871 Bacteria 2658
151 Ga0075434_100168202 3300006871 Bacteria 2212
152 Ga0075434_100381912 3300006871 Bacteria 1429
153 Ga0075429_100090555 3300006880 Bacteria 2668
154 Ga0068865_100073958 3300006881 Bacteria 2425
155 Ga0075436_101210603 3300006914 Bacteria 570
156 Ga0097620_100077464 3300006931 Bacteria 3365
157 Ga0097620_100498060 3300006931 Unclassified 1313
158 Ga0075435_100004091 3300007076 Bacteria 9987
159 Ga0075435_101175962 3300007076 Bacteria 671
160 Ga0099794_10748027 3300007265 Bacteria 522
161 Ga0105251_10034356 3300009011 Bacteria 2510
162 Ga0105250_10079947 3300009092 Bacteria 1325
163 Ga0105240_11185402 3300009093 Bacteria 809
164 Ga0111539_10003049 3300009094 Bacteria 22198
165 Ga0105247_10184604 3300009101 Bacteria 1393
166 Ga0114129_10001163 3300009147 Bacteria 34882
167 Ga0105243_10932966 3300009148 Unclassified 866
168 Ga0105241_10067576 3300009174 Bacteria 2767
169 Ga0105241_10112609 3300009174 Bacteria 2180
170 Ga0105241_10132301 3300009174 Bacteria 2021
171 Ga0105241_11355790 3300009174 Bacteria 679
172 Ga0105242_10124133 3300009176 Bacteria 2220
173 Ga0105242_10424632 3300009176 Bacteria 1246
174 Ga0105248_10247838 3300009177 Bacteria 2005
175 Ga0105248_11265892 3300009177 Unclassified 834
176 Ga0105248_12998841 3300009177 Unclassified 538
177 Ga0105237_11561853 3300009545 Bacteria 667
178 Ga0105237_12266513 3300009545 Bacteria 553
179 Ga0105238_10311325 3300009551 Bacteria 1559
180 Ga0105238_11170507 3300009551 Bacteria 793
181 Ga0105249_10000905 3300009553 Bacteria 26200
182 Ga0105249_10507336 3300009553 Unclassified 1252
183 Ga0105249_12019285 3300009553 Unclassified 649
184 Ga0105239_10220786 3300010375 Bacteria 2126
185 Ga0105239_13325708 3300010375 Bacteria 523
186 Ga0105246_10187076 3300011119 Bacteria 1599
187 Ga0105246_10412995 3300011119 Bacteria 1124
188 Ga0157344_1003810 3300012476 Unclassified 870
189 Ga0157369_11147123 3300013105 Unclassified 794
190 Ga0157369_12374675 3300013105 Unclassified 537
191 Ga0157374_10173224 3300013296 Bacteria 2106
192 Ga0157374_11002813 3300013296 Unclassified 854
193 Ga0157378_10053607 3300013297 Bacteria 3591
194 Ga0163162_10217253 3300013306 Bacteria 2042
195 Ga0163162_10433602 3300013306 Bacteria 1446
196 Ga0163162_10605755 3300013306 Bacteria 1221
197 Ga0157375_11418558 3300013308 Unclassified 818
198 Ga0163163_10056522 3300014325 Bacteria 3879
199 Ga0163163_11210663 3300014325 Unclassified 818
200 Ga0157380_10363205 3300014326 Unclassified 1359
201 Ga0157380_10644661 3300014326 Bacteria 1055
202 Ga0157380_12533079 3300014326 Bacteria 579
203 Ga0182008_10252942 3300014497 Bacteria 909
204 Ga0157377_10018475 3300014745 Bacteria 3624
205 Ga0157377_10088941 3300014745 Bacteria 1820
206 Ga0157379_10171571 3300014968 Bacteria 1958
207 Ga0157379_10551277 3300014968 Bacteria 1073
208 Ga0157376_10277065 3300014969 Unclassified 1578
209 Ga0157376_10898082 3300014969 Unclassified 904
210 Ga0157376_11512421 3300014969 Bacteria 704
211 Ga0163161_11205958 3300017792 Unclassified 654
212 Ga0197907_11230264 3300020069 Bacteria 577
213 Ga0209758_1000373 3300025297 Bacteria 78698
214 Ga0207426_1139105 3300025302 Bacteria 579
215 Ga0207656_10229552 3300025321 Bacteria 904
216 Ga0207713_1046555 3300025735 Bacteria 1763
217 Ga0207682_10114400 3300025893 Bacteria 1190
218 Ga0207692_10027430 3300025898 Bacteria 2683
219 Ga0207692_10183794 3300025898 Bacteria 1219
220 Ga0207642_10239780 3300025899 Unclassified 1023
221 Ga0207710_10020902 3300025900 Bacteria 2802
222 Ga0207710_10035279 3300025900 Bacteria 2201
223 Ga0207688_10002291 3300025901 Bacteria 10295
224 Ga0207688_10170276 3300025901 Bacteria 1295
225 Ga0207680_10161096 3300025903 Bacteria 1504
226 Ga0207647_10023557 3300025904 Bacteria 4070
227 Ga0207685_10019025 3300025905 Bacteria 2255
228 Ga0207685_10036859 3300025905 Bacteria 1797
229 Ga0207685_10495790 3300025905 Bacteria 642
230 Ga0207699_10001254 3300025906 Bacteria 12078
231 Ga0207699_10525795 3300025906 Bacteria 856
232 Ga0207645_10062167 3300025907 Bacteria 2385
233 Ga0207645_10357608 3300025907 Bacteria 978
234 Ga0207643_10024520 3300025908 Bacteria 3329
235 Ga0207654_10033105 3300025911 Bacteria 2862
236 Ga0207654_10299084 3300025911 Unclassified 1094
237 Ga0207707_11166412 3300025912 Bacteria 625
238 Ga0207671_11472425 3300025914 Bacteria 526
239 Ga0207693_10033262 3300025915 Bacteria 4069
240 Ga0207693_10047415 3300025915 Bacteria 3376
241 Ga0207693_10128967 3300025915 Bacteria 1988
242 Ga0207693_10451968 3300025915 Bacteria 1004
243 Ga0207693_10877279 3300025915 Bacteria 689
244 Ga0207663_10496535 3300025916 Unclassified 947
245 Ga0207663_11596646 3300025916 Unclassified 525
246 Ga0207663_11720471 3300025916 Unclassified 504
247 Ga0207660_10212170 3300025917 Bacteria 1517
248 Ga0207660_11308975 3300025917 Unclassified 588
249 Ga0207662_10003397 3300025918 Bacteria 8187
250 Ga0207662_11192377 3300025918 Bacteria 541
251 Ga0207657_10048757 3300025919 Bacteria 3696
252 Ga0207657_10413513 3300025919 Bacteria 1060
253 Ga0207649_10567042 3300025920 Unclassified 870
254 Ga0207652_10439677 3300025921 Bacteria 1176
255 Ga0207694_10485853 3300025924 Bacteria 1033
256 Ga0207694_11465133 3300025924 Bacteria 576
257 Ga0207650_10230663 3300025925 Bacteria 1493
258 Ga0207659_10254859 3300025926 Bacteria 1425
259 Ga0207687_10873675 3300025927 Bacteria 769
260 Ga0207700_10001346 3300025928 Bacteria 13937
261 Ga0207700_10472414 3300025928 Bacteria 1107
262 Ga0207664_10034782 3300025929 Bacteria 3883
263 Ga0207664_11124598 3300025929 Bacteria 702
264 Ga0207644_10555613 3300025931 Unclassified 950
265 Ga0207690_10538355 3300025932 Unclassified 948
266 Ga0207706_10047303 3300025933 Bacteria 3807
267 Ga0207706_10074129 3300025933 Bacteria 2993
268 Ga0207706_11601959 3300025933 Unclassified 527
269 Ga0207686_10118332 3300025934 Bacteria 1799
270 Ga0207686_10593998 3300025934 Bacteria 870
271 Ga0207709_10359365 3300025935 Unclassified 1102
272 Ga0207709_11059281 3300025935 Bacteria 665
273 Ga0207670_10104197 3300025936 Bacteria 2031
274 Ga0207670_11601493 3300025936 Bacteria 554
275 Ga0207669_10028791 3300025937 Bacteria 3061
276 Ga0207704_10047933 3300025938 Bacteria 2558
277 Ga0207665_10004253 3300025939 Bacteria 9516
278 Ga0207665_10055173 3300025939 Bacteria 2680
279 Ga0207691_10015850 3300025940 Bacteria 7163
280 Ga0207711_10273311 3300025941 Bacteria 1555
281 Ga0207711_10873998 3300025941 Bacteria 836
282 Ga0207689_10113511 3300025942 Bacteria 2227
283 Ga0207661_10555000 3300025944 Bacteria 1052
284 Ga0207679_10265519 3300025945 Bacteria 1466
285 Ga0207667_10050154 3300025949 Bacteria 4405
286 Ga0207667_11605900 3300025949 Bacteria 619
287 Ga0207651_10024143 3300025960 Bacteria 3755
288 Ga0207651_11172561 3300025960 Unclassified 689
289 Ga0207712_10004862 3300025961 Bacteria 8494
290 Ga0207712_10121746 3300025961 Bacteria 1975
291 Ga0207712_10283870 3300025961 Unclassified 1352
292 Ga0207668_10115721 3300025972 Bacteria 2020
293 Ga0207668_10379657 3300025972 Bacteria 1189
294 Ga0207668_10529973 3300025972 Bacteria 1017
295 Ga0207640_10722042 3300025981 Unclassified 856
296 Ga0207658_10278849 3300025986 Bacteria 1432
297 Ga0207658_11219868 3300025986 Bacteria 688
298 Ga0207677_10055397 3300026023 Bacteria 2711
299 Ga0207677_11425546 3300026023 Unclassified 638
300 Ga0207703_10012740 3300026035 Bacteria 6557
301 Ga0207703_10894394 3300026035 Bacteria 850
302 Ga0207639_10364778 3300026041 Bacteria 1293
303 Ga0207639_10367285 3300026041 Bacteria 1289
304 Ga0207678_10038146 3300026067 Bacteria 4176
305 Ga0207708_10030243 3300026075 Bacteria 4107
306 Ga0207708_11071894 3300026075 Unclassified 702
307 Ga0207702_10037988 3300026078 Bacteria 4033
308 Ga0207702_11557536 3300026078 Unclassified 654
309 Ga0207641_10515635 3300026088 Bacteria 1162
310 Ga0207648_10012760 3300026089 Bacteria 7852
311 Ga0207648_10243918 3300026089 Bacteria 1600
312 Ga0207676_10047716 3300026095 Bacteria 3320
313 Ga0207674_10250716 3300026116 Bacteria 1717
314 Ga0207675_100002876 3300026118 Bacteria 16923
315 Ga0207675_100068525 3300026118 Bacteria 3316
316 Ga0207675_101621546 3300026118 Bacteria 667
317 Ga0207683_10023595 3300026121 Bacteria 5291
318 Ga0207683_10658365 3300026121 Unclassified 970
319 Ga0207428_10005326 3300027907 Bacteria 11998
320 Ga0268266_10045805 3300028379 Bacteria 3743
321 Ga0268266_10369073 3300028379 Bacteria 1351
322 Ga0268265_10027056 3300028380 Bacteria 4088
323 Ga0268265_11191083 3300028380 Bacteria 759
324 Ga0265332_10278017 3300031238 Bacteria 692
325 Ga0265340_10296913 3300031247 Bacteria 717
326 Ga0265339_10142168 3300031249 Bacteria 1220
327 Ga0265331_10071212 3300031250 Bacteria 1627
328 Ga0265316_10101358 3300031344 Bacteria 2187
329 Ga0307408_101153673 3300031548 Bacteria 721
330 Ga0307405_11497847 3300031731 Unclassified 593
331 Ga0307410_10239231 3300031852 Bacteria 1406
332 Ga0307406_10662292 3300031901 Unclassified 868
333 Ga0307407_10230380 3300031903 Unclassified 1258
334 Ga0307409_101428041 3300031995 Bacteria 719
335 Ga0307416_101619248 3300032002 Bacteria 753
336 Ga0307411_10756025 3300032005 Bacteria 852
337 Ga0373926_0006770 3300035083 Bacteria 3808
338 Ga0373926_0067171 3300035083 Unclassified 1314
339 Ga0373926_0117565 3300035083 Bacteria 1001
340 Ga0373934_0109789 3300035086 Bacteria 1118
341 Ga0373940_0021083 3300035088 Bacteria 1662
342 Ga0373944_0001887 3300035089 Bacteria 5300
343 Ga0373944_0009056 3300035089 Bacteria 2693
344 Ga0373951_0072830 3300035091 Bacteria 878
345 Ga0373923_0004951 3300035111 Bacteria 4477
346 Ga0373923_0028384 3300035111 Bacteria 2238
347 Ga0373932_0427568 3300035112 Unclassified 516
348 Ga0373936_0003385 3300035113 Bacteria 5976
349 Ga0373936_0102318 3300035113 Bacteria 1209
350 Ga0373945_0001184 3300035116 Bacteria 7928
351 Ga0373945_0004059 3300035116 Bacteria 4633
352 Ga0373945_0055860 3300035116 Bacteria 1463
353 Ga0373953_0092979 3300035117 Bacteria 1263
354 Ga0373954_0017433 3300035118 Bacteria 3226
355 Ga0373954_0176850 3300035118 Bacteria 1046
356 Ga0373957_0023742 3300035120 Bacteria 2196
357 Ga0373943_0007904 3300035170 Bacteria 4773
358 Ga0373943_0018338 3300035170 Bacteria 3213
359 Ga0373943_0089848 3300035170 Bacteria 1589
360 Ga0373943_0308759 3300035170 Bacteria 899
361 Ga0373943_0677614 3300035170 Unclassified 610
362 Ga0373946_0001037 3300035171 Bacteria 9550
363 Ga0373946_0001521 3300035171 Bacteria 8060
364 Ga0373946_0008101 3300035171 Bacteria 3858
365 Ga0373946_0380143 3300035171 Unclassified 710
366 Ga0373955_0023108 3300035172 Bacteria 3163
367 Ga0373962_0140516 3300035242 Bacteria 784
368 Ga0373924_0002712 3300035410 Bacteria 5976
369 Ga0373924_0053467 3300035410 Bacteria 1678
370 Ga0373924_0413962 3300035410 Unclassified 603
371 Ga0373931_0004834 3300035691 Bacteria 6188
372 Ga0373935_0001406 3300035692 Bacteria 13337
373 Ga0373935_0014243 3300035692 Bacteria 4799
374 Ga0373935_0035255 3300035692 Bacteria 3122
375 Ga0373935_0281159 3300035692 Bacteria 1172
376 Ga0373935_0359194 3300035692 Bacteria 1040
377 Ga0373927_0000892 3300035695 Bacteria 22721
378 Ga0373927_0003933 3300035695 Bacteria 10535
379 Ga0373927_0038572 3300035695 Bacteria 3101
380 Ga0373927_0072933 3300035695 Bacteria 2223
381 Ga0373927_0161516 3300035695 Bacteria 1468
382 Ga0373927_0208007 3300035695 Bacteria 1285
383 Ga0373933_0023914 3300035724 Bacteria 3495
384 Ga0373947_0000629 3300035725 Bacteria 20890
385 Ga0373947_0003263 3300035725 Bacteria 9619
386 Ga0373947_0007599 3300035725 Bacteria 6272
387 Ga0373947_0190914 3300035725 Bacteria 1337
388 Ga0373947_0639401 3300035725 Bacteria 725
389 Ga0373947_0904139 3300035725 Unclassified 603
390 Ga0373947_1125483 3300035725 Unclassified 535
391 Ga0373947_1267644 3300035725 Unclassified 502
392 Ga0373937_0084788 3300036401 Bacteria 2931
393 Ga0373925_0003681 3300037068 Bacteria 11791
394 Ga0373925_0017905 3300037068 Bacteria 5142
395 Ga0373925_0075656 3300037068 Bacteria 2552
396 Ga0373925_0079818 3300037068 Bacteria 2486
397 Ga0373925_0165413 3300037068 Bacteria 1744
398 Ga0373925_0422570 3300037068 Unclassified 1089
399 Ga0395898_0324414 3300037466 Bacteria 1469
400 Ga0395898_1979984 3300037466 Unclassified 502
401 Ga0395901_0079286 3300038443 Bacteria 3429
402 Ga0451793_0517916 3300041452 Bacteria 516
403 Ga0439464_0076514 3300042439 Bacteria 995
404 Ga0466960_0428184 3300044901 Unclassified 766
405 Ga0466958_0591265 3300045836 Bacteria 722
406 Ga0495617_037668 3300046452 Bacteria 1619
407 Ga0495592_0052256 3300046454 Bacteria 3034
408 Ga0495603_0036999 3300046455 Bacteria 2929
409 Ga0495603_0056534 3300046455 Bacteria 2322
410 Ga0495591_073226 3300046458 Bacteria 886
411 Ga0495591_099477 3300046458 Bacteria 722
412 Ga0495629_0014941 3300046459 Bacteria 5579
413 Ga0495629_0026104 3300046459 Bacteria 4151
414 Ga0495629_0844630 3300046459 Bacteria 602
415 Ga0495629_0967854 3300046459 Unclassified 555
416 Ga0495641_0041321 3300046461 Bacteria 2143
417 Ga0495651_0016437 3300046462 Bacteria 5731
418 Ga0495653_0005878 3300046463 Bacteria 10041
419 Ga0495653_0129270 3300046463 Bacteria 1790
420 Ga0495580_0053925 3300046472 Bacteria 2837
421 Ga0495580_0059600 3300046472 Bacteria 2682
422 Ga0495580_0352741 3300046472 Unclassified 996
423 Ga0495582_0099607 3300046473 Bacteria 1626
424 Ga0495582_0603397 3300046473 Bacteria 635
425 Ga0495639_0005083 3300046475 Bacteria 5652
426 Ga0495639_0075971 3300046475 Bacteria 1558
427 Ga0495639_0196684 3300046475 Unclassified 986
428 Ga0495662_0018751 3300046476 Bacteria 3349
429 Ga0495662_0087217 3300046476 Bacteria 1520
430 Ga0495662_0343201 3300046476 Bacteria 734
431 Ga0495664_0001034 3300046477 Bacteria 14381
432 Ga0495664_0061834 3300046477 Bacteria 2229
433 Ga0495664_0437337 3300046477 Bacteria 784
434 Ga0495584_0010382 3300046491 Bacteria 4787
435 Ga0495584_0133481 3300046491 Bacteria 1260
436 Ga0495585_0002702 3300046492 Bacteria 12423
437 Ga0495594_0084341 3300046499 Bacteria 1776
438 Ga0495596_0207950 3300046500 Bacteria 760
439 Ga0495607_0043119 3300046501 Bacteria 2670
440 Ga0495583_0331447 3300046506 Bacteria 602
441 Ga0495608_0023329 3300046511 Bacteria 4240
442 Ga0495618_0005416 3300046514 Bacteria 7782
443 Ga0495618_0009681 3300046514 Bacteria 5818
444 Ga0495618_0017145 3300046514 Bacteria 4438
445 Ga0495628_0023643 3300046516 Bacteria 5042
446 Ga0495628_0160286 3300046516 Bacteria 1710
447 Ga0495630_0014775 3300046517 Bacteria 5693
448 Ga0495630_0026988 3300046517 Bacteria 4256
449 Ga0495630_0116373 3300046517 Bacteria 2026
450 Ga0495644_0000510 3300046523 Bacteria 16598
451 Ga0495666_0004543 3300046526 Bacteria 7014
452 Ga0495666_0153262 3300046526 Bacteria 1071
453 Ga0495652_0012180 3300046529 Bacteria 7768
454 Ga0495652_0018127 3300046529 Bacteria 6283
455 Ga0495652_0106455 3300046529 Bacteria 2265
456 Ga0495665_0002324 3300046531 Bacteria 10269
457 Ga0495665_0085230 3300046531 Bacteria 1660
458 Ga0495665_0168889 3300046531 Bacteria 1139
459 Ga0495665_0362674 3300046531 Bacteria 737
460 Ga0495640_0008356 3300046533 Bacteria 8120
461 Ga0495640_0021657 3300046533 Bacteria 4711
462 Ga0495640_0058303 3300046533 Bacteria 2633
463 Ga0495640_0108868 3300046533 Bacteria 1812
464 Ga0495586_0012180 3300046535 Bacteria 4566
465 Ga0495587_0009020 3300046536 Bacteria 6402
466 Ga0495598_0001168 3300046537 Bacteria 5074
467 Ga0495609_0040488 3300046538 Bacteria 2097
468 Ga0495645_0015262 3300046543 Bacteria 5463
469 Ga0495645_0258761 3300046543 Bacteria 1154
470 Ga0495622_0028237 3300046557 Bacteria 2619
471 Ga0495633_0005507 3300046558 Bacteria 7705
472 Ga0495667_0004324 3300046559 Bacteria 9586
473 Ga0495656_0215066 3300046615 Bacteria 959
474 Ga0495634_0007278 3300046642 Bacteria 8338
475 Ga0495634_0018647 3300046642 Bacteria 4936
476 Ga0495634_0069154 3300046642 Bacteria 2330
477 Ga0495634_0182003 3300046642 Bacteria 1315
478 Ga0495634_0208915 3300046642 Bacteria 1209
479 Ga0495611_0004254 3300046648 Bacteria 6229
480 Ga0495625_0258092 3300046660 Bacteria 1129
481 Ga0495635_0007226 3300046663 Bacteria 7758
482 Ga0495635_0092738 3300046663 Bacteria 2065
483 Ga0495635_0162211 3300046663 Bacteria 1521
484 Ga0495635_1077575 3300046663 Unclassified 509
485 Ga0495661_0085906 3300046665 Bacteria 1802
486 Ga0495588_0001938 3300046674 Bacteria 8837
487 Ga0495599_0025038 3300046678 Bacteria 3734
488 Ga0495599_0037081 3300046678 Bacteria 3063
489 Ga0495623_0516505 3300046679 Unclassified 629
490 Ga0495646_0061436 3300046680 Bacteria 2238
491 Ga0495646_0075503 3300046680 Bacteria 1976
492 Ga0495647_0037492 3300046681 Bacteria 1830
493 Ga0495647_0107629 3300046681 Bacteria 1160
494 Ga0495647_0251045 3300046681 Bacteria 787
495 Ga0495647_0413171 3300046681 Unclassified 621
496 Ga0495658_0035402 3300046683 Bacteria 2746
497 Ga0495658_0055302 3300046683 Bacteria 2260
498 Ga0495658_0260796 3300046683 Bacteria 1091
499 Ga0495658_0971465 3300046683 Unclassified 542
500 Ga0495669_0282768 3300046684 Bacteria 798
501 Ga0495613_0024550 3300046689 Bacteria 4491
502 Ga0495613_0043387 3300046689 Bacteria 3327
503 Ga0495613_0162977 3300046689 Bacteria 1585
504 Ga0495613_0688658 3300046689 Bacteria 674
505 Ga0495613_1064924 3300046689 Unclassified 517
506 Ga0495624_0003037 3300046690 Bacteria 12571
507 Ga0495624_0027240 3300046690 Bacteria 3743
508 Ga0495624_0099022 3300046690 Bacteria 1795
509 Ga0495670_0003427 3300046691 Bacteria 7793
510 Ga0495649_0059244 3300046694 Bacteria 2062
511 Ga0495589_0042744 3300046794 Bacteria 2258
512 Ga0495589_0103827 3300046794 Bacteria 1374
513 Ga0495600_0000758 3300046809 Bacteria 17034
514 Ga0495581_0002122 3300047315 Bacteria 11179
515 Ga0495581_0008625 3300047315 Bacteria 5905
516 Ga0495581_0055853 3300047315 Bacteria 2279
517 Ga0495581_0274980 3300047315 Unclassified 985
518 Ga0495604_0006519 3300047317 Bacteria 9249
519 Ga0495636_0322726 3300047318 Bacteria 725
520 Ga0495674_0003621 3300047319 Bacteria 15039
521 Ga0495674_0025009 3300047319 Bacteria 5479
522 Ga0495674_0094472 3300047319 Bacteria 2550
523 Ga0495672_0250442 3300047320 Unclassified 860
524 Ga0495676_0074467 3300047321 Bacteria 2600
525 Ga0495676_0090087 3300047321 Bacteria 2296
526 Ga0495680_0006335 3300047322 Bacteria 11014
527 Ga0495680_0192123 3300047322 Bacteria 1468
528 Ga0495683_0207585 3300047323 Bacteria 880
529 Ga0495675_0063137 3300047444 Bacteria 2344
530 Ga0495677_0139985 3300047445 Unclassified 929
531 Ga0495679_009932 3300047446 Bacteria 3772
532 Ga0495681_0104800 3300047470 Bacteria 1232
533 Ga0495684_0002702 3300047471 Bacteria 14043
534 Ga0495684_0035642 3300047471 Bacteria 3814
535 Ga0495684_0107676 3300047471 Bacteria 2105
536 Ga0495684_0489647 3300047471 Bacteria 847
537 Ga0495593_0010234 3300047673 Bacteria 5423
538 Ga0495593_0029008 3300047673 Bacteria 3037
539 Ga0495593_0133338 3300047673 Bacteria 1260
540 Ga0495602_0122404 3300048088 Bacteria 2091
541 Ga0495614_0063042 3300048089 Bacteria 1593
542 Ga0495626_0170403 3300048091 Bacteria 908
543 Ga0496100_0004121 3300048903 Bacteria 7665
544 Ga0496100_0018910 3300048903 Bacteria 4099
545 Ga0496101_0002301 3300048904 Bacteria 11683
546 Ga0496101_0022121 3300048904 Bacteria 4374
547 Ga0496101_0174536 3300048904 Bacteria 1652
548 Ga0496101_0474792 3300048904 Bacteria 987
549 Ga0496102_0001907 3300048905 Bacteria 17978
550 Ga0496102_0211431 3300048905 Bacteria 1828
551 Ga0496102_0636578 3300048905 Bacteria 989
552 Ga0496103_0005408 3300048906 Bacteria 7645
553 Ga0496103_0031406 3300048906 Bacteria 3235
554 Ga0496103_0090853 3300048906 Bacteria 1926
555 Ga0496104_0003321 3300048907 Bacteria 13883
556 Ga0496104_0113207 3300048907 Unclassified 2602
557 Ga0496104_0259799 3300048907 Bacteria 1649
558 Ga0496104_0605768 3300048907 Unclassified 1005
559 Ga0496105_0005879 3300048908 Bacteria 9354
560 Ga0496105_0011008 3300048908 Bacteria 7130
561 Ga0496105_0143115 3300048908 Bacteria 1967
562 Ga0496106_0001903 3300048909 Bacteria 15629
563 Ga0496106_0050355 3300048909 Bacteria 3139
564 Ga0496106_0168933 3300048909 Bacteria 1732
565 Ga0496107_0000742 3300048910 Bacteria 18683
566 Ga0496107_0048198 3300048910 Bacteria 3068
567 Ga0496107_0067308 3300048910 Bacteria 2598
568 Ga0496108_0005149 3300048911 Bacteria 10570
569 Ga0496108_0012312 3300048911 Bacteria 6957
570 Ga0496108_0170760 3300048911 Bacteria 1881
571 Ga0496108_0223913 3300048911 Bacteria 1634
572 Ga0496109_0002185 3300048912 Bacteria 16231
573 Ga0496109_0013309 3300048912 Bacteria 7128
574 Ga0496109_0045609 3300048912 Bacteria 3978
575 Ga0496109_0075548 3300048912 Bacteria 3098
576 Ga0496109_0087085 3300048912 Bacteria 2884
577 Ga0496110_0001267 3300048913 Bacteria 18072
578 Ga0496110_0001439 3300048913 Bacteria 17212
579 Ga0496110_0148733 3300048913 Bacteria 2119
580 Ga0496110_1290329 3300048913 Bacteria 639
581 Ga0496111_0005865 3300048914 Bacteria 7920
582 Ga0496111_0006191 3300048914 Bacteria 7749
583 Ga0496111_0198510 3300048914 Bacteria 1491
584 Ga0496111_0213186 3300048914 Bacteria 1434
585 Ga0496112_0002066 3300048915 Bacteria 15919
586 Ga0496112_0019496 3300048915 Bacteria 6403
587 Ga0496112_0126841 3300048915 Bacteria 2522
588 Ga0496112_0192675 3300048915 Bacteria 1999
589 Ga0496113_0068732 3300048916 Bacteria 2688
590 Ga0496113_0085245 3300048916 Unclassified 2426
591 Ga0496113_0167417 3300048916 Bacteria 1739
592 Ga0496114_0060481 3300048917 Bacteria 3166
593 Ga0496114_0067365 3300048917 Bacteria 3003
594 Ga0496114_0269161 3300048917 Unclassified 1501
595 Ga0496114_0405911 3300048917 Bacteria 1206
596 Ga0496115_0183612 3300048918 Bacteria 1728
597 Ga0496115_0336407 3300048918 Bacteria 1232
598 Ga0496115_0400705 3300048918 Unclassified 1113
599 Ga0496115_0704442 3300048918 Unclassified 793
600 Ga0496126_0923403 3300048929 Bacteria 660
601 Ga0501031_0050661 3300049568 Bacteria 2705
602 Ga0501031_0055109 3300049568 Bacteria 2591
603 Ga0501032_0022579 3300049569 Bacteria 4360
604 Ga0501033_0125882 3300049570 Bacteria 1858
605 Ga0501034_0000032 3300049571 Bacteria 243763
606 Ga0501034_0053224 3300049571 Bacteria 4077
607 Ga0501034_0167100 3300049571 Bacteria 2168
608 Ga0501036_0004475 3300049572 Bacteria 11297
609 Ga0501036_0026331 3300049572 Bacteria 4908
610 Ga0501036_0833797 3300049572 Bacteria 758
611 Ga0501037_0025692 3300049573 Bacteria 4350
612 Ga0501037_0086237 3300049573 Bacteria 2273
613 Ga0501038_0010512 3300049574 Bacteria 8465
614 Ga0501038_0202241 3300049574 Bacteria 1593
615 Ga0501038_0342947 3300049574 Unclassified 1165
616 Ga0501039_0030967 3300049575 Bacteria 4125
617 Ga0501039_0708378 3300049575 Bacteria 787
618 Ga0501040_0574537 3300049576 Unclassified 814
619 Ga0501043_0022339 3300049579 Bacteria 4963
620 Ga0501043_0068702 3300049579 Bacteria 2782
621 Ga0501046_0281789 3300049580 Bacteria 1217
622 Ga0501047_0000100 3300049581 Bacteria 105717
623 Ga0501047_0040658 3300049581 Bacteria 4496
624 Ga0501048_0000083 3300049582 Bacteria 49621
625 Ga0501068_0368335 3300049584 Bacteria 924
626 Ga0501069_0248815 3300049585 Bacteria 1037
627 Ga0501070_0009312 3300049586 Bacteria 8307
628 Ga0501070_0439238 3300049586 Bacteria 1053
629 Ga0501070_1039113 3300049586 Unclassified 634
630 Ga0501071_0084581 3300049587 Bacteria 2325
631 Ga0501073_0085335 3300049589 Bacteria 2197
632 Ga0501073_0129310 3300049589 Bacteria 1750
633 Ga0501074_0048380 3300049590 Bacteria 3072
634 Ga0501074_0064991 3300049590 Bacteria 2626
635 Ga0501075_0027790 3300049591 Bacteria 4171
636 Ga0501076_0011514 3300049592 Bacteria 6593
637 Ga0501076_0477887 3300049592 Unclassified 1027
638 Ga0501077_0232710 3300049593 Unclassified 1171
639 Ga0501079_0086821 3300049741 Bacteria 2421
640 Ga0501080_0000030 3300049742 Bacteria 87736
641 Ga0501080_0003855 3300049742 Bacteria 13252
642 Ga0501080_0003899 3300049742 Bacteria 13209
643 Ga0501080_1035702 3300049742 Bacteria 711
644 Ga0501083_0022286 3300049744 Bacteria 4395
645 Ga0501083_0272399 3300049744 Bacteria 1101
646 Ga0501035_0211044 3300049822 Bacteria 1661
647 Ga0501044_0000587 3300049823 Bacteria 44137
648 Ga0501044_0017933 3300049823 Bacteria 7591
649 Ga0501044_1408195 3300049823 Bacteria 563
650 nmdc:mga03n38_359880_c1 3300050490 Bacteria 793
651 nmdc:mga07m45_228300_c2 3300050496 Unclassified 670
652 nmdc:mga05p37_928_c1 3300050507 Bacteria 33059
653 nmdc:mga09592_38098_c1 3300050508 Bacteria 4035
654 nmdc:mga0qj67_32315_c1 3300050509 Bacteria 4080
655 nmdc:mga06r32_795_c1 3300050510 Bacteria 27918
656 nmdc:mga08y16_2587_c1 3300050511 Bacteria 18610
657 nmdc:mga0n895_169692_c1 3300050512 Bacteria 2214
658 nmdc:mga0n895_342855_c1 3300050512 Bacteria 1513
659 nmdc:mga0n895_385564_c1 3300050512 Bacteria 1418
660 nmdc:mga0n895_94584_c1 3300050512 Bacteria 2992
661 nmdc:mga0rr50_12010_c1 3300050513 Bacteria 5575
662 nmdc:mga0rr50_139729_c1 3300050513 Bacteria 1947
663 nmdc:mga08x19_188283_c1 3300050514 Bacteria 1411
664 nmdc:mga0a205_388535_c1 3300050515 Bacteria 1260
665 Ga0495601_0000489 3300053077 Bacteria 20787
666 Ga0495601_0000886 3300053077 Bacteria 16328
667 Ga0495601_0024445 3300053077 Bacteria 3720
668 Ga0495612_0003322 3300053078 Bacteria 6669
669 Ga0495612_0004147 3300053078 Bacteria 6003
670 Ga0495612_0094419 3300053078 Bacteria 1269
671 Ga0495595_0005839 3300053084 Bacteria 4986
672 Ga0495595_0397820 3300053084 Bacteria 698
673 Ga0495619_0000918 3300053085 Bacteria 19328
674 Ga0495619_0036833 3300053085 Bacteria 3187
675 Ga0495619_0209324 3300053085 Bacteria 1350
676 Ga0495619_0287657 3300053085 Bacteria 1139
677 Ga0500566_0077295 3300053094 Bacteria 1859
678 Ga0500642_0245807 3300053130 Bacteria 823
679 Ga0500652_085912 3300053131 Bacteria 1312
680 Ga0501084_0177788 3300054114 Unclassified 1796
681 Ga0501084_1270286 3300054114 Unclassified 617
682 Ga0501082_0099629 3300060353 Bacteria 2513
683 Ga0501082_0105261 3300060353 Bacteria 2441
684 Ga0501082_0391088 3300060353 Bacteria 1213
685 Ga0501082_0590491 3300060353 Bacteria 972

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_1035702 Ga0501080_1035702_389_649 77
2 3300020069 Ga0197907_11230264 Ga0197907_112302641 84
3 3300046475 Ga0495639_0196684 Ga0495639_0196684_336_626 86
4 3300003215 JGI25153J46596_10000711 JGI25153J46596_1000071114 87
5 3300005295 Ga0065707_10543569 Ga0065707_105435691 87
6 3300005328 Ga0070676_10694783 Ga0070676_106947831 87
7 3300005353 Ga0070669_100967319 Ga0070669_1009673192 87
8 3300005458 Ga0070681_11996703 Ga0070681_119967031 87
9 3300005719 Ga0068861_101625783 Ga0068861_1016257831 87
10 3300006175 Ga0070712_101540531 Ga0070712_1015405312 87
11 3300006353 Ga0075370_10470580 Ga0075370_104705802 87
12 3300006353 Ga0075370_10595282 Ga0075370_105952821 87
13 3300006844 Ga0075428_100002840 Ga0075428_1000028403 87
14 3300006844 Ga0075428_102131069 Ga0075428_1021310691 87
15 3300006846 Ga0075430_100094409 Ga0075430_1000944092 87
16 3300006847 Ga0075431_100001610 Ga0075431_1000016103 87
17 3300006880 Ga0075429_100090555 Ga0075429_1000905552 87
18 3300009094 Ga0111539_10003049 Ga0111539_100030493 87
19 3300009147 Ga0114129_10001163 Ga0114129_100011633 87
20 3300014326 Ga0157380_12533079 Ga0157380_125330791 87
21 3300025297 Ga0209758_1000373 Ga0209758_100037346 87
22 3300025302 Ga0207426_1139105 Ga0207426_11391052 87
23 3300025907 Ga0207645_10357608 Ga0207645_103576082 87
24 3300025915 Ga0207693_10451968 Ga0207693_104519682 87
25 3300025918 Ga0207662_11192377 Ga0207662_111923772 87
26 3300025986 Ga0207658_11219868 Ga0207658_112198682 87
27 3300026118 Ga0207675_101621546 Ga0207675_1016215462 87
28 3300027907 Ga0207428_10005326 Ga0207428_1000532614 87
29 3300035083 Ga0373926_0117565 Ga0373926_0117565_560_853 87
30 3300035113 Ga0373936_0102318 Ga0373936_0102318_749_1042 87
31 3300035116 Ga0373945_0055860 Ga0373945_0055860_334_627 87
32 3300035170 Ga0373943_0018338 Ga0373943_0018338_965_1258 87
33 3300035171 Ga0373946_0001037 Ga0373946_0001037_5769_6062 87
34 3300035410 Ga0373924_0053467 Ga0373924_0053467_118_411 87
35 3300035692 Ga0373935_0014243 Ga0373935_0014243_47_340 87
36 3300035695 Ga0373927_0000892 Ga0373927_0000892_4593_4886 87
37 3300035725 Ga0373947_0000629 Ga0373947_0000629_7339_7632 87
38 3300037068 Ga0373925_0003681 Ga0373925_0003681_10217_10510 87
39 3300037466 Ga0395898_0324414 Ga0395898_0324414_47_340 87
40 3300038443 Ga0395901_0079286 Ga0395901_0079286_1487_1780 87
41 3300042439 Ga0439464_0076514 Ga0439464_0076514_261_554 87
42 3300046459 Ga0495629_0844630 Ga0495629_0844630_118_411 87
43 3300046472 Ga0495580_0053925 Ga0495580_0053925_1263_1556 87
44 3300046517 Ga0495630_0014775 Ga0495630_0014775_1077_1370 87
45 3300046526 Ga0495666_0153262 Ga0495666_0153262_150_443 87
46 3300046529 Ga0495652_0106455 Ga0495652_0106455_1795_2088 87
47 3300046531 Ga0495665_0085230 Ga0495665_0085230_1230_1523 87
48 3300046533 Ga0495640_0108868 Ga0495640_0108868_1424_1717 87
49 3300046642 Ga0495634_0208915 Ga0495634_0208915_106_399 87
50 3300046663 Ga0495635_1077575 Ga0495635_1077575_187_480 87
51 3300046681 Ga0495647_0037492 Ga0495647_0037492_506_799 87
52 3300046683 Ga0495658_0260796 Ga0495658_0260796_355_648 87
53 3300046689 Ga0495613_0024550 Ga0495613_0024550_1566_1859 87
54 3300046690 Ga0495624_0003037 Ga0495624_0003037_5054_5347 87
55 3300047315 Ga0495581_0008625 Ga0495581_0008625_967_1260 87
56 3300047471 Ga0495684_0035642 Ga0495684_0035642_2057_2350 87
57 3300047673 Ga0495593_0010234 Ga0495593_0010234_1651_1944 87
58 3300048929 Ga0496126_0923403 Ga0496126_0923403_122_415 87
59 3300050490 nmdc:mga03n38_359880_c1 nmdc:mga03n38_359880_c1_307_600 87
60 3300050496 nmdc:mga07m45_228300_c2 nmdc:mga07m45_228300_c2_342_635 87
61 3300050507 nmdc:mga05p37_928_c1 nmdc:mga05p37_928_c1_1605_1898 87
62 3300050508 nmdc:mga09592_38098_c1 nmdc:mga09592_38098_c1_2643_2936 87
63 3300050509 nmdc:mga0qj67_32315_c1 nmdc:mga0qj67_32315_c1_2201_2494 87
64 3300050510 nmdc:mga06r32_795_c1 nmdc:mga06r32_795_c1_1585_1878 87
65 3300050511 nmdc:mga08y16_2587_c1 nmdc:mga08y16_2587_c1_16713_17006 87
66 3300053085 Ga0495619_0036833 Ga0495619_0036833_706_999 87
67 3300053130 Ga0500642_0245807 Ga0500642_0245807_412_705 87
68 3300053131 Ga0500652_085912 Ga0500652_085912_561_854 87
69 3300060353 Ga0501082_0590491 Ga0501082_0590491_158_457 87
70 3300005458 Ga0070681_10592365 Ga0070681_105923652 88
71 3300005530 Ga0070679_100161661 Ga0070679_1001616612 88
72 3300005616 Ga0068852_100766955 Ga0068852_1007669552 88
73 3300005937 Ga0081455_10115039 Ga0081455_101150393 88
74 3300013105 Ga0157369_12374675 Ga0157369_123746752 88
75 3300025912 Ga0207707_11166412 Ga0207707_111664122 88
76 3300025921 Ga0207652_10439677 Ga0207652_104396772 88
77 3300025936 Ga0207670_11601493 Ga0207670_116014931 88
78 3300025949 Ga0207667_11605900 Ga0207667_116059002 88
79 3300031901 Ga0307406_10662292 Ga0307406_106622921 88
80 3300032002 Ga0307416_101619248 Ga0307416_1016192481 88
81 3300035692 Ga0373935_0359194 Ga0373935_0359194_273_569 88
82 3300035725 Ga0373947_1125483 Ga0373947_1125483_15_311 88
83 3300035725 Ga0373947_1267644 Ga0373947_1267644_67_363 88
84 3300045836 Ga0466958_0591265 Ga0466958_0591265_122_418 88
85 3300048908 Ga0496105_0005879 Ga0496105_0005879_250_546 88
86 3300048911 Ga0496108_0170760 Ga0496108_0170760_1260_1556 88
87 3300048912 Ga0496109_0075548 Ga0496109_0075548_2548_2844 88
88 3300048913 Ga0496110_1290329 Ga0496110_1290329_245_541 88
89 3300049569 Ga0501032_0022579 Ga0501032_0022579_2310_2606 88
90 3300049571 Ga0501034_0000032 Ga0501034_0000032_49235_49531 88
91 3300049571 Ga0501034_0167100 Ga0501034_0167100_793_1089 88
92 3300049572 Ga0501036_0004475 Ga0501036_0004475_843_1139 88
93 3300049572 Ga0501036_0833797 Ga0501036_0833797_43_339 88
94 3300049573 Ga0501037_0025692 Ga0501037_0025692_3354_3650 88
95 3300049574 Ga0501038_0202241 Ga0501038_0202241_426_722 88
96 3300049575 Ga0501039_0030967 Ga0501039_0030967_345_641 88
97 3300049579 Ga0501043_0022339 Ga0501043_0022339_3922_4218 88
98 3300049580 Ga0501046_0281789 Ga0501046_0281789_336_632 88
99 3300049581 Ga0501047_0000100 Ga0501047_0000100_39744_40040 88
100 3300049582 Ga0501048_0000083 Ga0501048_0000083_38717_39013 88
101 3300049584 Ga0501068_0368335 Ga0501068_0368335_185_481 88
102 3300049586 Ga0501070_0009312 Ga0501070_0009312_2369_2665 88
103 3300049586 Ga0501070_0439238 Ga0501070_0439238_507_803 88
104 3300049589 Ga0501073_0085335 Ga0501073_0085335_264_560 88
105 3300049590 Ga0501074_0064991 Ga0501074_0064991_1006_1302 88
106 3300049742 Ga0501080_0000030 Ga0501080_0000030_48598_48894 88
107 3300049744 Ga0501083_0022286 Ga0501083_0022286_118_414 88
108 3300049744 Ga0501083_0272399 Ga0501083_0272399_703_999 88
109 3300049823 Ga0501044_0000587 Ga0501044_0000587_29757_30053 88
110 3300049823 Ga0501044_1408195 Ga0501044_1408195_188_484 88
111 3300060353 Ga0501082_0105261 Ga0501082_0105261_542_838 88
112 3300001990 JGI24737J22298_10083048 JGI24737J22298_100830482 89
113 3300001991 JGI24743J22301_10025535 JGI24743J22301_100255352 89
114 3300002070 JGI24750J21931_1001341 JGI24750J21931_10013413 89
115 3300002075 JGI24738J21930_10062502 JGI24738J21930_100625022 89
116 3300002076 JGI24749J21850_1034635 JGI24749J21850_10346351 89
117 3300002077 JGI24744J21845_10025982 JGI24744J21845_100259822 89
118 3300002239 JGI24034J26672_10015667 JGI24034J26672_100156672 89
119 3300002244 JGI24742J22300_10001929 JGI24742J22300_100019292 89
120 3300002459 JGI24751J29686_10014846 JGI24751J29686_100148462 89
121 3300003659 JGI25404J52841_10064658 JGI25404J52841_100646582 89
122 3300005328 Ga0070676_11339488 Ga0070676_113394881 89
123 3300005329 Ga0070683_100115805 Ga0070683_1001158053 89
124 3300005329 Ga0070683_100205026 Ga0070683_1002050263 89
125 3300005330 Ga0070690_100050605 Ga0070690_1000506052 89
126 3300005335 Ga0070666_10129280 Ga0070666_101292802 89
127 3300005336 Ga0070680_100148475 Ga0070680_1001484753 89
128 3300005336 Ga0070680_102019077 Ga0070680_1020190772 89
129 3300005338 Ga0068868_100173786 Ga0068868_1001737862 89
130 3300005339 Ga0070660_101136214 Ga0070660_1011362142 89
131 3300005341 Ga0070691_10034543 Ga0070691_100345432 89
132 3300005343 Ga0070687_100064706 Ga0070687_1000647062 89
133 3300005344 Ga0070661_100222692 Ga0070661_1002226922 89
134 3300005345 Ga0070692_10038798 Ga0070692_100387982 89
135 3300005347 Ga0070668_100087445 Ga0070668_1000874452 89
136 3300005353 Ga0070669_100463089 Ga0070669_1004630892 89
137 3300005354 Ga0070675_100221317 Ga0070675_1002213172 89
138 3300005355 Ga0070671_100177396 Ga0070671_1001773962 89
139 3300005356 Ga0070674_100575308 Ga0070674_1005753082 89
140 3300005364 Ga0070673_100051409 Ga0070673_1000514091 89
141 3300005364 Ga0070673_101388442 Ga0070673_1013884422 89
142 3300005365 Ga0070688_100019755 Ga0070688_1000197553 89
143 3300005366 Ga0070659_100274381 Ga0070659_1002743812 89
144 3300005367 Ga0070667_100760484 Ga0070667_1007604842 89
145 3300005406 Ga0070703_10319443 Ga0070703_103194431 89
146 3300005435 Ga0070714_100351433 Ga0070714_1003514332 89
147 3300005436 Ga0070713_100434942 Ga0070713_1004349422 89
148 3300005436 Ga0070713_101218970 Ga0070713_1012189702 89
149 3300005437 Ga0070710_10269330 Ga0070710_102693303 89
150 3300005439 Ga0070711_100829849 Ga0070711_1008298492 89
151 3300005440 Ga0070705_100460808 Ga0070705_1004608081 89
152 3300005441 Ga0070700_100157106 Ga0070700_1001571062 89
153 3300005444 Ga0070694_100133382 Ga0070694_1001333823 89
154 3300005444 Ga0070694_101490107 Ga0070694_1014901072 89
155 3300005445 Ga0070708_101890748 Ga0070708_1018907481 89
156 3300005455 Ga0070663_100337562 Ga0070663_1003375622 89
157 3300005456 Ga0070678_100189872 Ga0070678_1001898722 89
158 3300005457 Ga0070662_100037565 Ga0070662_1000375652 89
159 3300005459 Ga0068867_100041718 Ga0068867_1000417183 89
160 3300005530 Ga0070679_100604774 Ga0070679_1006047742 89
161 3300005530 Ga0070679_100978525 Ga0070679_1009785252 89
162 3300005535 Ga0070684_100126352 Ga0070684_1001263523 89
163 3300005535 Ga0070684_100165924 Ga0070684_1001659242 89
164 3300005539 Ga0068853_100600650 Ga0068853_1006006502 89
165 3300005543 Ga0070672_100151698 Ga0070672_1001516982 89
166 3300005544 Ga0070686_100287153 Ga0070686_1002871532 89
167 3300005544 Ga0070686_100448579 Ga0070686_1004485791 89
168 3300005546 Ga0070696_100011790 Ga0070696_1000117906 89
169 3300005546 Ga0070696_101249308 Ga0070696_1012493081 89
170 3300005547 Ga0070693_100205167 Ga0070693_1002051672 89
171 3300005547 Ga0070693_101458945 Ga0070693_1014589451 89
172 3300005548 Ga0070665_100210003 Ga0070665_1002100033 89
173 3300005549 Ga0070704_100003037 Ga0070704_1000030375 89
174 3300005563 Ga0068855_100157074 Ga0068855_1001570745 89
175 3300005563 Ga0068855_100546820 Ga0068855_1005468201 89
176 3300005564 Ga0070664_100289865 Ga0070664_1002898652 89
177 3300005578 Ga0068854_100071551 Ga0068854_1000715512 89
178 3300005614 Ga0068856_100548702 Ga0068856_1005487022 89
179 3300005616 Ga0068852_100777694 Ga0068852_1007776942 89
180 3300005617 Ga0068859_100077463 Ga0068859_1000774633 89
181 3300005618 Ga0068864_100005603 Ga0068864_1000056032 89
182 3300005718 Ga0068866_10048175 Ga0068866_100481752 89
183 3300005719 Ga0068861_100329960 Ga0068861_1003299601 89
184 3300005834 Ga0068851_10049054 Ga0068851_100490542 89
185 3300005840 Ga0068870_10125530 Ga0068870_101255302 89
186 3300005841 Ga0068863_100090051 Ga0068863_1000900513 89
187 3300005842 Ga0068858_100124350 Ga0068858_1001243503 89
188 3300005843 Ga0068860_100056993 Ga0068860_1000569933 89
189 3300005844 Ga0068862_100123793 Ga0068862_1001237931 89
190 3300005844 Ga0068862_100599485 Ga0068862_1005994852 89
191 3300005983 Ga0081540_1000008 Ga0081540_1000008144 89
192 3300006028 Ga0070717_11550002 Ga0070717_115500022 89
193 3300006028 Ga0070717_12148950 Ga0070717_121489501 89
194 3300006038 Ga0075365_10444672 Ga0075365_104446722 89
195 3300006163 Ga0070715_10154817 Ga0070715_101548171 89
196 3300006163 Ga0070715_10483732 Ga0070715_104837322 89
197 3300006173 Ga0070716_100420967 Ga0070716_1004209672 89
198 3300006175 Ga0070712_100036653 Ga0070712_1000366533 89
199 3300006175 Ga0070712_100796922 Ga0070712_1007969222 89
200 3300006237 Ga0097621_100239229 Ga0097621_1002392293 89
201 3300006358 Ga0068871_100575992 Ga0068871_1005759922 89
202 3300006852 Ga0075433_10128386 Ga0075433_101283863 89
203 3300006852 Ga0075433_11172471 Ga0075433_111724711 89
204 3300006871 Ga0075434_100118738 Ga0075434_1001187383 89
205 3300006871 Ga0075434_100168202 Ga0075434_1001682021 89
206 3300006871 Ga0075434_100381912 Ga0075434_1003819123 89
207 3300006881 Ga0068865_100073958 Ga0068865_1000739583 89
208 3300006931 Ga0097620_100077464 Ga0097620_1000774643 89
209 3300007076 Ga0075435_100004091 Ga0075435_10000409110 89
210 3300009093 Ga0105240_11185402 Ga0105240_111854021 89
211 3300009101 Ga0105247_10184604 Ga0105247_101846041 89
212 3300009174 Ga0105241_10067576 Ga0105241_100675764 89
213 3300009174 Ga0105241_10112609 Ga0105241_101126093 89
214 3300009174 Ga0105241_11355790 Ga0105241_113557902 89
215 3300009176 Ga0105242_10424632 Ga0105242_104246322 89
216 3300009177 Ga0105248_10247838 Ga0105248_102478382 89
217 3300009177 Ga0105248_11265892 Ga0105248_112658922 89
218 3300009545 Ga0105237_11561853 Ga0105237_115618532 89
219 3300009545 Ga0105237_12266513 Ga0105237_122665132 89
220 3300009551 Ga0105238_10311325 Ga0105238_103113252 89
221 3300009551 Ga0105238_11170507 Ga0105238_111705071 89
222 3300009553 Ga0105249_10000905 Ga0105249_100009057 89
223 3300009553 Ga0105249_10507336 Ga0105249_105073361 89
224 3300010375 Ga0105239_10220786 Ga0105239_102207861 89
225 3300011119 Ga0105246_10187076 Ga0105246_101870762 89
226 3300013296 Ga0157374_11002813 Ga0157374_110028132 89
227 3300013297 Ga0157378_10053607 Ga0157378_100536073 89
228 3300013306 Ga0163162_10217253 Ga0163162_102172532 89
229 3300013306 Ga0163162_10605755 Ga0163162_106057552 89
230 3300013308 Ga0157375_11418558 Ga0157375_114185581 89
231 3300014325 Ga0163163_10056522 Ga0163163_100565224 89
232 3300014326 Ga0157380_10363205 Ga0157380_103632051 89
233 3300014745 Ga0157377_10018475 Ga0157377_100184753 89
234 3300014968 Ga0157379_10171571 Ga0157379_101715713 89
235 3300014969 Ga0157376_10277065 Ga0157376_102770653 89
236 3300014969 Ga0157376_11512421 Ga0157376_115124211 89
237 3300017792 Ga0163161_11205958 Ga0163161_112059582 89
238 3300025321 Ga0207656_10229552 Ga0207656_102295522 89
239 3300025893 Ga0207682_10114400 Ga0207682_101144002 89
240 3300025898 Ga0207692_10183794 Ga0207692_101837942 89
241 3300025899 Ga0207642_10239780 Ga0207642_102397801 89
242 3300025900 Ga0207710_10020902 Ga0207710_100209022 89
243 3300025901 Ga0207688_10002291 Ga0207688_100022913 89
244 3300025903 Ga0207680_10161096 Ga0207680_101610962 89
245 3300025904 Ga0207647_10023557 Ga0207647_100235573 89
246 3300025905 Ga0207685_10036859 Ga0207685_100368592 89
247 3300025905 Ga0207685_10495790 Ga0207685_104957901 89
248 3300025907 Ga0207645_10062167 Ga0207645_100621674 89
249 3300025908 Ga0207643_10024520 Ga0207643_100245203 89
250 3300025911 Ga0207654_10033105 Ga0207654_100331054 89
251 3300025914 Ga0207671_11472425 Ga0207671_114724251 89
252 3300025915 Ga0207693_10047415 Ga0207693_100474154 89
253 3300025915 Ga0207693_10128967 Ga0207693_101289673 89
254 3300025915 Ga0207693_10877279 Ga0207693_108772791 89
255 3300025916 Ga0207663_11596646 Ga0207663_115966461 89
256 3300025917 Ga0207660_10212170 Ga0207660_102121702 89
257 3300025917 Ga0207660_11308975 Ga0207660_113089751 89
258 3300025918 Ga0207662_10003397 Ga0207662_100033973 89
259 3300025919 Ga0207657_10048757 Ga0207657_100487576 89
260 3300025920 Ga0207649_10567042 Ga0207649_105670421 89
261 3300025924 Ga0207694_10485853 Ga0207694_104858532 89
262 3300025924 Ga0207694_11465133 Ga0207694_114651332 89
263 3300025927 Ga0207687_10873675 Ga0207687_108736752 89
264 3300025928 Ga0207700_10472414 Ga0207700_104724142 89
265 3300025929 Ga0207664_11124598 Ga0207664_111245981 89
266 3300025932 Ga0207690_10538355 Ga0207690_105383552 89
267 3300025933 Ga0207706_10074129 Ga0207706_100741291 89
268 3300025934 Ga0207686_10118332 Ga0207686_101183323 89
269 3300025935 Ga0207709_10359365 Ga0207709_103593651 89
270 3300025935 Ga0207709_11059281 Ga0207709_110592812 89
271 3300025936 Ga0207670_10104197 Ga0207670_101041973 89
272 3300025937 Ga0207669_10028791 Ga0207669_100287912 89
273 3300025938 Ga0207704_10047933 Ga0207704_100479332 89
274 3300025939 Ga0207665_10055173 Ga0207665_100551732 89
275 3300025940 Ga0207691_10015850 Ga0207691_100158502 89
276 3300025941 Ga0207711_10273311 Ga0207711_102733112 89
277 3300025942 Ga0207689_10113511 Ga0207689_101135112 89
278 3300025944 Ga0207661_10555000 Ga0207661_105550002 89
279 3300025945 Ga0207679_10265519 Ga0207679_102655192 89
280 3300025949 Ga0207667_10050154 Ga0207667_100501546 89
281 3300025960 Ga0207651_10024143 Ga0207651_100241433 89
282 3300025960 Ga0207651_11172561 Ga0207651_111725612 89
283 3300025961 Ga0207712_10004862 Ga0207712_100048627 89
284 3300025961 Ga0207712_10121746 Ga0207712_101217462 89
285 3300025972 Ga0207668_10115721 Ga0207668_101157212 89
286 3300025972 Ga0207668_10529973 Ga0207668_105299732 89
287 3300025981 Ga0207640_10722042 Ga0207640_107220422 89
288 3300025986 Ga0207658_10278849 Ga0207658_102788492 89
289 3300026023 Ga0207677_10055397 Ga0207677_100553973 89
290 3300026023 Ga0207677_11425546 Ga0207677_114255462 89
291 3300026035 Ga0207703_10012740 Ga0207703_100127407 89
292 3300026041 Ga0207639_10367285 Ga0207639_103672852 89
293 3300026067 Ga0207678_10038146 Ga0207678_100381463 89
294 3300026075 Ga0207708_10030243 Ga0207708_100302434 89
295 3300026078 Ga0207702_11557536 Ga0207702_115575362 89
296 3300026088 Ga0207641_10515635 Ga0207641_105156352 89
297 3300026089 Ga0207648_10012760 Ga0207648_100127607 89
298 3300026095 Ga0207676_10047716 Ga0207676_100477163 89
299 3300026116 Ga0207674_10250716 Ga0207674_102507162 89
300 3300026118 Ga0207675_100002876 Ga0207675_1000028768 89
301 3300026121 Ga0207683_10023595 Ga0207683_100235956 89
302 3300028379 Ga0268266_10045805 Ga0268266_100458053 89
303 3300028380 Ga0268265_10027056 Ga0268265_100270563 89
304 3300028380 Ga0268265_11191083 Ga0268265_111910832 89
305 3300031238 Ga0265332_10278017 Ga0265332_102780171 89
306 3300031247 Ga0265340_10296913 Ga0265340_102969131 89
307 3300031249 Ga0265339_10142168 Ga0265339_101421682 89
308 3300031250 Ga0265331_10071212 Ga0265331_100712122 89
309 3300031344 Ga0265316_10101358 Ga0265316_101013582 89
310 3300031548 Ga0307408_101153673 Ga0307408_1011536732 89
311 3300031731 Ga0307405_11497847 Ga0307405_114978472 89
312 3300031852 Ga0307410_10239231 Ga0307410_102392313 89
313 3300031903 Ga0307407_10230380 Ga0307407_102303802 89
314 3300031995 Ga0307409_101428041 Ga0307409_1014280412 89
315 3300032005 Ga0307411_10756025 Ga0307411_107560252 89
316 3300035083 Ga0373926_0067171 Ga0373926_0067171_444_752 89
317 3300035091 Ga0373951_0072830 Ga0373951_0072830_350_649 89
318 3300035170 Ga0373943_0308759 Ga0373943_0308759_93_392 89
319 3300035171 Ga0373946_0380143 Ga0373946_0380143_195_503 89
320 3300035410 Ga0373924_0413962 Ga0373924_0413962_30_329 89
321 3300035692 Ga0373935_0281159 Ga0373935_0281159_525_833 89
322 3300035695 Ga0373927_0072933 Ga0373927_0072933_20_319 89
323 3300035695 Ga0373927_0161516 Ga0373927_0161516_91_390 89
324 3300035695 Ga0373927_0208007 Ga0373927_0208007_373_681 89
325 3300035725 Ga0373947_0190914 Ga0373947_0190914_423_722 89
326 3300035725 Ga0373947_0639401 Ga0373947_0639401_134_433 89
327 3300037068 Ga0373925_0075656 Ga0373925_0075656_498_797 89
328 3300037068 Ga0373925_0165413 Ga0373925_0165413_471_770 89
329 3300037068 Ga0373925_0422570 Ga0373925_0422570_216_524 89
330 3300037466 Ga0395898_1979984 Ga0395898_1979984_93_392 89
331 3300041452 Ga0451793_0517916 Ga0451793_0517916_55_354 89
332 3300046455 Ga0495603_0036999 Ga0495603_0036999_2601_2909 89
333 3300046458 Ga0495591_073226 Ga0495591_073226_39_338 89
334 3300046459 Ga0495629_0967854 Ga0495629_0967854_242_541 89
335 3300046472 Ga0495580_0352741 Ga0495580_0352741_119_427 89
336 3300046476 Ga0495662_0343201 Ga0495662_0343201_33_332 89
337 3300046477 Ga0495664_0437337 Ga0495664_0437337_34_333 89
338 3300046491 Ga0495584_0133481 Ga0495584_0133481_16_315 89
339 3300046500 Ga0495596_0207950 Ga0495596_0207950_333_632 89
340 3300046514 Ga0495618_0005416 Ga0495618_0005416_1998_2297 89
341 3300046531 Ga0495665_0362674 Ga0495665_0362674_130_429 89
342 3300046533 Ga0495640_0058303 Ga0495640_0058303_2059_2358 89
343 3300046615 Ga0495656_0215066 Ga0495656_0215066_48_347 89
344 3300046642 Ga0495634_0007278 Ga0495634_0007278_1291_1590 89
345 3300046642 Ga0495634_0182003 Ga0495634_0182003_582_881 89
346 3300046663 Ga0495635_0162211 Ga0495635_0162211_720_1019 89
347 3300046683 Ga0495658_0971465 Ga0495658_0971465_225_524 89
348 3300046684 Ga0495669_0282768 Ga0495669_0282768_58_357 89
349 3300046689 Ga0495613_0688658 Ga0495613_0688658_41_340 89
350 3300046689 Ga0495613_1064924 Ga0495613_1064924_132_431 89
351 3300046694 Ga0495649_0059244 Ga0495649_0059244_1417_1716 89
352 3300046794 Ga0495589_0103827 Ga0495589_0103827_40_339 89
353 3300047315 Ga0495581_0055853 Ga0495581_0055853_106_405 89
354 3300047315 Ga0495581_0274980 Ga0495581_0274980_254_562 89
355 3300047319 Ga0495674_0094472 Ga0495674_0094472_1318_1617 89
356 3300047320 Ga0495672_0250442 Ga0495672_0250442_64_363 89
357 3300047445 Ga0495677_0139985 Ga0495677_0139985_333_632 89
358 3300047470 Ga0495681_0104800 Ga0495681_0104800_349_648 89
359 3300047471 Ga0495684_0489647 Ga0495684_0489647_511_810 89
360 3300048091 Ga0495626_0170403 Ga0495626_0170403_260_559 89
361 3300048903 Ga0496100_0004121 Ga0496100_0004121_6564_6863 89
362 3300048904 Ga0496101_0002301 Ga0496101_0002301_10266_10565 89
363 3300048904 Ga0496101_0174536 Ga0496101_0174536_305_604 89
364 3300048904 Ga0496101_0474792 Ga0496101_0474792_523_822 89
365 3300048905 Ga0496102_0001907 Ga0496102_0001907_7475_7774 89
366 3300048905 Ga0496102_0636578 Ga0496102_0636578_229_528 89
367 3300048906 Ga0496103_0005408 Ga0496103_0005408_7321_7620 89
368 3300048906 Ga0496103_0090853 Ga0496103_0090853_1433_1732 89
369 3300048907 Ga0496104_0003321 Ga0496104_0003321_12992_13291 89
370 3300048907 Ga0496104_0113207 Ga0496104_0113207_1722_2021 89
371 3300048907 Ga0496104_0605768 Ga0496104_0605768_497_796 89
372 3300048908 Ga0496105_0011008 Ga0496105_0011008_6207_6506 89
373 3300048909 Ga0496106_0001903 Ga0496106_0001903_8540_8839 89
374 3300048909 Ga0496106_0050355 Ga0496106_0050355_1212_1511 89
375 3300048910 Ga0496107_0000742 Ga0496107_0000742_6455_6754 89
376 3300048910 Ga0496107_0048198 Ga0496107_0048198_1176_1475 89
377 3300048911 Ga0496108_0005149 Ga0496108_0005149_6922_7221 89
378 3300048911 Ga0496108_0012312 Ga0496108_0012312_766_1065 89
379 3300048912 Ga0496109_0002185 Ga0496109_0002185_5980_6279 89
380 3300048912 Ga0496109_0045609 Ga0496109_0045609_763_1062 89
381 3300048912 Ga0496109_0087085 Ga0496109_0087085_1153_1452 89
382 3300048913 Ga0496110_0001267 Ga0496110_0001267_6954_7253 89
383 3300048913 Ga0496110_0001439 Ga0496110_0001439_7018_7317 89
384 3300048913 Ga0496110_0148733 Ga0496110_0148733_1234_1533 89
385 3300048914 Ga0496111_0005865 Ga0496111_0005865_5495_5794 89
386 3300048914 Ga0496111_0006191 Ga0496111_0006191_6591_6890 89
387 3300048915 Ga0496112_0002066 Ga0496112_0002066_13105_13404 89
388 3300048915 Ga0496112_0019496 Ga0496112_0019496_4796_5095 89
389 3300048915 Ga0496112_0126841 Ga0496112_0126841_305_604 89
390 3300048916 Ga0496113_0068732 Ga0496113_0068732_1414_1713 89
391 3300048916 Ga0496113_0085245 Ga0496113_0085245_545_844 89
392 3300048917 Ga0496114_0067365 Ga0496114_0067365_672_971 89
393 3300048917 Ga0496114_0269161 Ga0496114_0269161_34_333 89
394 3300048917 Ga0496114_0405911 Ga0496114_0405911_749_1048 89
395 3300048918 Ga0496115_0336407 Ga0496115_0336407_250_549 89
396 3300048918 Ga0496115_0400705 Ga0496115_0400705_440_739 89
397 3300048918 Ga0496115_0704442 Ga0496115_0704442_163_462 89
398 3300049568 Ga0501031_0050661 Ga0501031_0050661_782_1081 89
399 3300049570 Ga0501033_0125882 Ga0501033_0125882_868_1167 89
400 3300049571 Ga0501034_0053224 Ga0501034_0053224_2770_3069 89
401 3300049572 Ga0501036_0026331 Ga0501036_0026331_1935_2234 89
402 3300049573 Ga0501037_0086237 Ga0501037_0086237_392_691 89
403 3300049574 Ga0501038_0010512 Ga0501038_0010512_3011_3310 89
404 3300049575 Ga0501039_0708378 Ga0501039_0708378_47_346 89
405 3300049579 Ga0501043_0068702 Ga0501043_0068702_2343_2642 89
406 3300049581 Ga0501047_0040658 Ga0501047_0040658_2142_2441 89
407 3300049585 Ga0501069_0248815 Ga0501069_0248815_93_392 89
408 3300049586 Ga0501070_1039113 Ga0501070_1039113_204_503 89
409 3300049589 Ga0501073_0129310 Ga0501073_0129310_987_1286 89
410 3300049592 Ga0501076_0477887 Ga0501076_0477887_565_864 89
411 3300049593 Ga0501077_0232710 Ga0501077_0232710_592_891 89
412 3300049742 Ga0501080_0003899 Ga0501080_0003899_7262_7561 89
413 3300049823 Ga0501044_0017933 Ga0501044_0017933_3697_3996 89
414 3300050512 nmdc:mga0n895_169692_c1 nmdc:mga0n895_169692_c1_1740_2042 89
415 3300050512 nmdc:mga0n895_342855_c1 nmdc:mga0n895_342855_c1_660_959 89
416 3300050513 nmdc:mga0rr50_12010_c1 nmdc:mga0rr50_12010_c1_4595_4897 89
417 3300050515 nmdc:mga0a205_388535_c1 nmdc:mga0a205_388535_c1_830_1132 89
418 3300053077 Ga0495601_0000886 Ga0495601_0000886_463_762 89
419 3300053078 Ga0495612_0094419 Ga0495612_0094419_567_866 89
420 3300053085 Ga0495619_0209324 Ga0495619_0209324_166_465 89
421 3300053085 Ga0495619_0287657 Ga0495619_0287657_138_437 89
422 3300060353 Ga0501082_0099629 Ga0501082_0099629_1089_1388 89
423 2209111006 2214881028 2213933136 90
424 3300003911 JGI25405J52794_10004873 JGI25405J52794_100048733 90
425 3300005328 Ga0070676_10567433 Ga0070676_105674331 90
426 3300005331 Ga0070670_100596065 Ga0070670_1005960652 90
427 3300005335 Ga0070666_10023216 Ga0070666_100232166 90
428 3300005339 Ga0070660_100884455 Ga0070660_1008844551 90
429 3300005340 Ga0070689_100202762 Ga0070689_1002027622 90
430 3300005343 Ga0070687_100175550 Ga0070687_1001755502 90
431 3300005347 Ga0070668_100535529 Ga0070668_1005355292 90
432 3300005355 Ga0070671_100778361 Ga0070671_1007783611 90
433 3300005356 Ga0070674_100305946 Ga0070674_1003059462 90
434 3300005364 Ga0070673_100092739 Ga0070673_1000927392 90
435 3300005434 Ga0070709_10003717 Ga0070709_100037175 90
436 3300005434 Ga0070709_11426750 Ga0070709_114267502 90
437 3300005435 Ga0070714_100027177 Ga0070714_1000271773 90
438 3300005436 Ga0070713_100004110 Ga0070713_10000411010 90
439 3300005437 Ga0070710_10005634 Ga0070710_100056341 90
440 3300005439 Ga0070711_100911483 Ga0070711_1009114832 90
441 3300005440 Ga0070705_100762615 Ga0070705_1007626152 90
442 3300005441 Ga0070700_100964888 Ga0070700_1009648881 90
443 3300005455 Ga0070663_100889703 Ga0070663_1008897032 90
444 3300005456 Ga0070678_100323936 Ga0070678_1003239362 90
445 3300005459 Ga0068867_100301491 Ga0068867_1003014912 90
446 3300005535 Ga0070684_100263281 Ga0070684_1002632812 90
447 3300005539 Ga0068853_101156250 Ga0068853_1011562502 90
448 3300005564 Ga0070664_100018435 Ga0070664_1000184355 90
449 3300005564 Ga0070664_101270056 Ga0070664_1012700561 90
450 3300005617 Ga0068859_100498048 Ga0068859_1004980483 90
451 3300005618 Ga0068864_100194705 Ga0068864_1001947052 90
452 3300005841 Ga0068863_100199880 Ga0068863_1001998802 90
453 3300005937 Ga0081455_10002167 Ga0081455_1000216723 90
454 3300006028 Ga0070717_10002524 Ga0070717_100025247 90
455 3300006163 Ga0070715_10035898 Ga0070715_100358982 90
456 3300006173 Ga0070716_100243226 Ga0070716_1002432262 90
457 3300006175 Ga0070712_100112330 Ga0070712_1001123303 90
458 3300006175 Ga0070712_100270553 Ga0070712_1002705532 90
459 3300006186 Ga0075369_10533538 Ga0075369_105335381 90
460 3300006237 Ga0097621_101486726 Ga0097621_1014867262 90
461 3300006358 Ga0068871_100159680 Ga0068871_1001596801 90
462 3300006871 Ga0075434_100086382 Ga0075434_1000863823 90
463 3300006914 Ga0075436_101210603 Ga0075436_1012106032 90
464 3300006931 Ga0097620_100498060 Ga0097620_1004980602 90
465 3300007076 Ga0075435_101175962 Ga0075435_1011759621 90
466 3300007265 Ga0099794_10748027 Ga0099794_107480272 90
467 3300009011 Ga0105251_10034356 Ga0105251_100343561 90
468 3300009092 Ga0105250_10079947 Ga0105250_100799472 90
469 3300009148 Ga0105243_10932966 Ga0105243_109329662 90
470 3300009174 Ga0105241_10132301 Ga0105241_101323012 90
471 3300009176 Ga0105242_10124133 Ga0105242_101241332 90
472 3300009177 Ga0105248_12998841 Ga0105248_129988411 90
473 3300009553 Ga0105249_12019285 Ga0105249_120192852 90
474 3300010375 Ga0105239_13325708 Ga0105239_133257082 90
475 3300011119 Ga0105246_10412995 Ga0105246_104129952 90
476 3300012476 Ga0157344_1003810 Ga0157344_10038101 90
477 3300013105 Ga0157369_11147123 Ga0157369_111471232 90
478 3300013296 Ga0157374_10173224 Ga0157374_101732243 90
479 3300013306 Ga0163162_10433602 Ga0163162_104336023 90
480 3300014325 Ga0163163_11210663 Ga0163163_112106632 90
481 3300014326 Ga0157380_10644661 Ga0157380_106446612 90
482 3300014497 Ga0182008_10252942 Ga0182008_102529422 90
483 3300014745 Ga0157377_10088941 Ga0157377_100889413 90
484 3300014968 Ga0157379_10551277 Ga0157379_105512772 90
485 3300014969 Ga0157376_10898082 Ga0157376_108980822 90
486 3300025735 Ga0207713_1046555 Ga0207713_10465552 90
487 3300025898 Ga0207692_10027430 Ga0207692_100274301 90
488 3300025900 Ga0207710_10035279 Ga0207710_100352793 90
489 3300025901 Ga0207688_10170276 Ga0207688_101702762 90
490 3300025905 Ga0207685_10019025 Ga0207685_100190252 90
491 3300025906 Ga0207699_10001254 Ga0207699_100012547 90
492 3300025906 Ga0207699_10525795 Ga0207699_105257952 90
493 3300025911 Ga0207654_10299084 Ga0207654_102990842 90
494 3300025915 Ga0207693_10033262 Ga0207693_100332625 90
495 3300025916 Ga0207663_10496535 Ga0207663_104965351 90
496 3300025916 Ga0207663_11720471 Ga0207663_117204712 90
497 3300025919 Ga0207657_10413513 Ga0207657_104135132 90
498 3300025925 Ga0207650_10230663 Ga0207650_102306632 90
499 3300025926 Ga0207659_10254859 Ga0207659_102548592 90
500 3300025928 Ga0207700_10001346 Ga0207700_1000134610 90
501 3300025929 Ga0207664_10034782 Ga0207664_100347823 90
502 3300025931 Ga0207644_10555613 Ga0207644_105556132 90
503 3300025933 Ga0207706_10047303 Ga0207706_100473032 90
504 3300025933 Ga0207706_11601959 Ga0207706_116019592 90
505 3300025934 Ga0207686_10593998 Ga0207686_105939982 90
506 3300025939 Ga0207665_10004253 Ga0207665_100042538 90
507 3300025941 Ga0207711_10873998 Ga0207711_108739982 90
508 3300025961 Ga0207712_10283870 Ga0207712_102838702 90
509 3300025972 Ga0207668_10379657 Ga0207668_103796572 90
510 3300026035 Ga0207703_10894394 Ga0207703_108943942 90
511 3300026041 Ga0207639_10364778 Ga0207639_103647782 90
512 3300026075 Ga0207708_11071894 Ga0207708_110718942 90
513 3300026078 Ga0207702_10037988 Ga0207702_100379883 90
514 3300026089 Ga0207648_10243918 Ga0207648_102439182 90
515 3300026118 Ga0207675_100068525 Ga0207675_1000685252 90
516 3300026121 Ga0207683_10658365 Ga0207683_106583652 90
517 3300028379 Ga0268266_10369073 Ga0268266_103690733 90
518 3300035083 Ga0373926_0006770 Ga0373926_0006770_3078_3377 90
519 3300035086 Ga0373934_0109789 Ga0373934_0109789_227_526 90
520 3300035088 Ga0373940_0021083 Ga0373940_0021083_1133_1432 90
521 3300035089 Ga0373944_0001887 Ga0373944_0001887_2964_3263 90
522 3300035089 Ga0373944_0009056 Ga0373944_0009056_1076_1375 90
523 3300035111 Ga0373923_0004951 Ga0373923_0004951_4152_4451 90
524 3300035111 Ga0373923_0028384 Ga0373923_0028384_155_454 90
525 3300035112 Ga0373932_0427568 Ga0373932_0427568_183_482 90
526 3300035113 Ga0373936_0003385 Ga0373936_0003385_1703_2002 90
527 3300035116 Ga0373945_0001184 Ga0373945_0001184_6496_6795 90
528 3300035116 Ga0373945_0004059 Ga0373945_0004059_2620_2919 90
529 3300035117 Ga0373953_0092979 Ga0373953_0092979_610_909 90
530 3300035118 Ga0373954_0017433 Ga0373954_0017433_1232_1531 90
531 3300035118 Ga0373954_0176850 Ga0373954_0176850_457_756 90
532 3300035120 Ga0373957_0023742 Ga0373957_0023742_485_784 90
533 3300035170 Ga0373943_0007904 Ga0373943_0007904_2134_2433 90
534 3300035170 Ga0373943_0089848 Ga0373943_0089848_608_907 90
535 3300035170 Ga0373943_0677614 Ga0373943_0677614_61_363 90
536 3300035171 Ga0373946_0001521 Ga0373946_0001521_4001_4300 90
537 3300035171 Ga0373946_0008101 Ga0373946_0008101_1564_1863 90
538 3300035172 Ga0373955_0023108 Ga0373955_0023108_1184_1483 90
539 3300035242 Ga0373962_0140516 Ga0373962_0140516_260_559 90
540 3300035410 Ga0373924_0002712 Ga0373924_0002712_447_746 90
541 3300035691 Ga0373931_0004834 Ga0373931_0004834_5649_5948 90
542 3300035692 Ga0373935_0001406 Ga0373935_0001406_8200_8499 90
543 3300035692 Ga0373935_0035255 Ga0373935_0035255_1417_1716 90
544 3300035695 Ga0373927_0003933 Ga0373927_0003933_3470_3769 90
545 3300035695 Ga0373927_0038572 Ga0373927_0038572_1242_1541 90
546 3300035724 Ga0373933_0023914 Ga0373933_0023914_1159_1458 90
547 3300035725 Ga0373947_0003263 Ga0373947_0003263_3394_3693 90
548 3300035725 Ga0373947_0007599 Ga0373947_0007599_2797_3096 90
549 3300035725 Ga0373947_0904139 Ga0373947_0904139_140_442 90
550 3300036401 Ga0373937_0084788 Ga0373937_0084788_1407_1706 90
551 3300037068 Ga0373925_0017905 Ga0373925_0017905_1009_1308 90
552 3300037068 Ga0373925_0079818 Ga0373925_0079818_1004_1303 90
553 3300044901 Ga0466960_0428184 Ga0466960_0428184_250_549 90
554 3300046452 Ga0495617_037668 Ga0495617_037668_1016_1315 90
555 3300046454 Ga0495592_0052256 Ga0495592_0052256_1833_2132 90
556 3300046455 Ga0495603_0056534 Ga0495603_0056534_1810_2109 90
557 3300046458 Ga0495591_099477 Ga0495591_099477_157_456 90
558 3300046459 Ga0495629_0014941 Ga0495629_0014941_2550_2849 90
559 3300046459 Ga0495629_0026104 Ga0495629_0026104_2797_3096 90
560 3300046461 Ga0495641_0041321 Ga0495641_0041321_1797_2096 90
561 3300046462 Ga0495651_0016437 Ga0495651_0016437_2075_2374 90
562 3300046463 Ga0495653_0005878 Ga0495653_0005878_7643_7942 90
563 3300046463 Ga0495653_0129270 Ga0495653_0129270_553_852 90
564 3300046472 Ga0495580_0059600 Ga0495580_0059600_437_736 90
565 3300046473 Ga0495582_0099607 Ga0495582_0099607_47_346 90
566 3300046473 Ga0495582_0603397 Ga0495582_0603397_320_625 90
567 3300046475 Ga0495639_0005083 Ga0495639_0005083_2128_2427 90
568 3300046475 Ga0495639_0075971 Ga0495639_0075971_297_596 90
569 3300046476 Ga0495662_0018751 Ga0495662_0018751_1608_1907 90
570 3300046476 Ga0495662_0087217 Ga0495662_0087217_417_716 90
571 3300046477 Ga0495664_0001034 Ga0495664_0001034_3305_3604 90
572 3300046477 Ga0495664_0061834 Ga0495664_0061834_1883_2182 90
573 3300046491 Ga0495584_0010382 Ga0495584_0010382_3643_3942 90
574 3300046492 Ga0495585_0002702 Ga0495585_0002702_7153_7452 90
575 3300046499 Ga0495594_0084341 Ga0495594_0084341_1065_1364 90
576 3300046501 Ga0495607_0043119 Ga0495607_0043119_1630_1929 90
577 3300046506 Ga0495583_0331447 Ga0495583_0331447_85_384 90
578 3300046511 Ga0495608_0023329 Ga0495608_0023329_2031_2330 90
579 3300046514 Ga0495618_0009681 Ga0495618_0009681_4487_4786 90
580 3300046514 Ga0495618_0017145 Ga0495618_0017145_2733_3032 90
581 3300046516 Ga0495628_0023643 Ga0495628_0023643_949_1248 90
582 3300046516 Ga0495628_0160286 Ga0495628_0160286_12_311 90
583 3300046517 Ga0495630_0026988 Ga0495630_0026988_2955_3254 90
584 3300046517 Ga0495630_0116373 Ga0495630_0116373_517_816 90
585 3300046523 Ga0495644_0000510 Ga0495644_0000510_5808_6107 90
586 3300046526 Ga0495666_0004543 Ga0495666_0004543_3642_3941 90
587 3300046529 Ga0495652_0012180 Ga0495652_0012180_4093_4392 90
588 3300046529 Ga0495652_0018127 Ga0495652_0018127_1238_1537 90
589 3300046531 Ga0495665_0002324 Ga0495665_0002324_7174_7473 90
590 3300046531 Ga0495665_0168889 Ga0495665_0168889_133_432 90
591 3300046533 Ga0495640_0008356 Ga0495640_0008356_6213_6512 90
592 3300046533 Ga0495640_0021657 Ga0495640_0021657_2878_3177 90
593 3300046535 Ga0495586_0012180 Ga0495586_0012180_3014_3313 90
594 3300046536 Ga0495587_0009020 Ga0495587_0009020_4094_4393 90
595 3300046537 Ga0495598_0001168 Ga0495598_0001168_1768_2067 90
596 3300046538 Ga0495609_0040488 Ga0495609_0040488_169_468 90
597 3300046543 Ga0495645_0015262 Ga0495645_0015262_1768_2067 90
598 3300046543 Ga0495645_0258761 Ga0495645_0258761_277_576 90
599 3300046557 Ga0495622_0028237 Ga0495622_0028237_2107_2406 90
600 3300046558 Ga0495633_0005507 Ga0495633_0005507_5793_6092 90
601 3300046559 Ga0495667_0004324 Ga0495667_0004324_6227_6526 90
602 3300046642 Ga0495634_0018647 Ga0495634_0018647_4473_4772 90
603 3300046642 Ga0495634_0069154 Ga0495634_0069154_1775_2074 90
604 3300046648 Ga0495611_0004254 Ga0495611_0004254_3238_3537 90
605 3300046660 Ga0495625_0258092 Ga0495625_0258092_139_441 90
606 3300046663 Ga0495635_0007226 Ga0495635_0007226_4663_4962 90
607 3300046663 Ga0495635_0092738 Ga0495635_0092738_146_445 90
608 3300046665 Ga0495661_0085906 Ga0495661_0085906_417_716 90
609 3300046674 Ga0495588_0001938 Ga0495588_0001938_7536_7835 90
610 3300046678 Ga0495599_0025038 Ga0495599_0025038_1331_1630 90
611 3300046678 Ga0495599_0037081 Ga0495599_0037081_1755_2054 90
612 3300046679 Ga0495623_0516505 Ga0495623_0516505_53_352 90
613 3300046680 Ga0495646_0061436 Ga0495646_0061436_1440_1739 90
614 3300046680 Ga0495646_0075503 Ga0495646_0075503_309_608 90
615 3300046681 Ga0495647_0107629 Ga0495647_0107629_48_347 90
616 3300046681 Ga0495647_0251045 Ga0495647_0251045_380_679 90
617 3300046681 Ga0495647_0413171 Ga0495647_0413171_158_463 90
618 3300046683 Ga0495658_0035402 Ga0495658_0035402_1416_1715 90
619 3300046683 Ga0495658_0055302 Ga0495658_0055302_621_920 90
620 3300046689 Ga0495613_0043387 Ga0495613_0043387_1183_1482 90
621 3300046689 Ga0495613_0162977 Ga0495613_0162977_697_996 90
622 3300046690 Ga0495624_0027240 Ga0495624_0027240_516_815 90
623 3300046690 Ga0495624_0099022 Ga0495624_0099022_1449_1748 90
624 3300046691 Ga0495670_0003427 Ga0495670_0003427_3820_4119 90
625 3300046794 Ga0495589_0042744 Ga0495589_0042744_1633_1932 90
626 3300046809 Ga0495600_0000758 Ga0495600_0000758_1850_2149 90
627 3300047315 Ga0495581_0002122 Ga0495581_0002122_7174_7473 90
628 3300047317 Ga0495604_0006519 Ga0495604_0006519_7726_8025 90
629 3300047318 Ga0495636_0322726 Ga0495636_0322726_409_708 90
630 3300047319 Ga0495674_0003621 Ga0495674_0003621_11306_11605 90
631 3300047319 Ga0495674_0025009 Ga0495674_0025009_3997_4296 90
632 3300047321 Ga0495676_0074467 Ga0495676_0074467_1320_1619 90
633 3300047321 Ga0495676_0090087 Ga0495676_0090087_1585_1884 90
634 3300047322 Ga0495680_0006335 Ga0495680_0006335_3221_3520 90
635 3300047322 Ga0495680_0192123 Ga0495680_0192123_281_580 90
636 3300047323 Ga0495683_0207585 Ga0495683_0207585_26_325 90
637 3300047444 Ga0495675_0063137 Ga0495675_0063137_1205_1504 90
638 3300047446 Ga0495679_009932 Ga0495679_009932_2263_2562 90
639 3300047471 Ga0495684_0002702 Ga0495684_0002702_10948_11247 90
640 3300047471 Ga0495684_0107676 Ga0495684_0107676_772_1071 90
641 3300047673 Ga0495593_0029008 Ga0495593_0029008_1736_2035 90
642 3300047673 Ga0495593_0133338 Ga0495593_0133338_522_821 90
643 3300048088 Ga0495602_0122404 Ga0495602_0122404_804_1103 90
644 3300048089 Ga0495614_0063042 Ga0495614_0063042_533_832 90
645 3300048903 Ga0496100_0018910 Ga0496100_0018910_2895_3194 90
646 3300048904 Ga0496101_0022121 Ga0496101_0022121_1094_1393 90
647 3300048905 Ga0496102_0211431 Ga0496102_0211431_1094_1393 90
648 3300048906 Ga0496103_0031406 Ga0496103_0031406_885_1184 90
649 3300048907 Ga0496104_0259799 Ga0496104_0259799_475_774 90
650 3300048908 Ga0496105_0143115 Ga0496105_0143115_575_874 90
651 3300048909 Ga0496106_0168933 Ga0496106_0168933_831_1130 90
652 3300048910 Ga0496107_0067308 Ga0496107_0067308_155_454 90
653 3300048911 Ga0496108_0223913 Ga0496108_0223913_1094_1393 90
654 3300048912 Ga0496109_0013309 Ga0496109_0013309_5736_6035 90
655 3300048914 Ga0496111_0198510 Ga0496111_0198510_99_398 90
656 3300048914 Ga0496111_0213186 Ga0496111_0213186_179_478 90
657 3300048915 Ga0496112_0192675 Ga0496112_0192675_607_906 90
658 3300048916 Ga0496113_0167417 Ga0496113_0167417_1094_1393 90
659 3300048917 Ga0496114_0060481 Ga0496114_0060481_2067_2366 90
660 3300048918 Ga0496115_0183612 Ga0496115_0183612_1241_1540 90
661 3300049568 Ga0501031_0055109 Ga0501031_0055109_2094_2396 90
662 3300049574 Ga0501038_0342947 Ga0501038_0342947_459_761 90
663 3300049576 Ga0501040_0574537 Ga0501040_0574537_51_353 90
664 3300049587 Ga0501071_0084581 Ga0501071_0084581_1451_1753 90
665 3300049590 Ga0501074_0048380 Ga0501074_0048380_131_433 90
666 3300049591 Ga0501075_0027790 Ga0501075_0027790_2350_2652 90
667 3300049592 Ga0501076_0011514 Ga0501076_0011514_5598_5900 90
668 3300049741 Ga0501079_0086821 Ga0501079_0086821_578_880 90
669 3300049742 Ga0501080_0003855 Ga0501080_0003855_10447_10749 90
670 3300049822 Ga0501035_0211044 Ga0501035_0211044_872_1174 90
671 3300050512 nmdc:mga0n895_385564_c1 nmdc:mga0n895_385564_c1_223_522 90
672 3300050512 nmdc:mga0n895_94584_c1 nmdc:mga0n895_94584_c1_1870_2169 90
673 3300050513 nmdc:mga0rr50_139729_c1 nmdc:mga0rr50_139729_c1_1610_1909 90
674 3300050514 nmdc:mga08x19_188283_c1 nmdc:mga08x19_188283_c1_624_923 90
675 3300053077 Ga0495601_0000489 Ga0495601_0000489_7648_7947 90
676 3300053077 Ga0495601_0024445 Ga0495601_0024445_2015_2314 90
677 3300053078 Ga0495612_0003322 Ga0495612_0003322_2973_3272 90
678 3300053078 Ga0495612_0004147 Ga0495612_0004147_3829_4128 90
679 3300053084 Ga0495595_0005839 Ga0495595_0005839_2797_3096 90
680 3300053084 Ga0495595_0397820 Ga0495595_0397820_134_433 90
681 3300053085 Ga0495619_0000918 Ga0495619_0000918_9414_9713 90
682 3300053094 Ga0500566_0077295 Ga0500566_0077295_1534_1833 90
683 3300054114 Ga0501084_0177788 Ga0501084_0177788_49_351 90
684 3300054114 Ga0501084_1270286 Ga0501084_1270286_58_360 90
685 3300060353 Ga0501082_0391088 Ga0501082_0391088_483_785 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19663

DUF6166

Family of unknown function (DUF6166)

11

102

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lo0-assembly1.cif.gz_B solution structure of the get5 carboxyl domain from a. fumigatus 0.7008 37 69
1r6o-assembly2.cif.gz_D atp-dependent clp protease atp-binding subunit clpa/atp-dependent clp protease adaptor protein clps 0.6596 35 64
1mbx-assembly1.cif.gz_C crystal structure analysis of clpsn with transition metal ion bound 0.5965 32 64
7xxs-assembly1.cif.gz_A hapr mutant i141v 0.5631 37 65
6vz0-assembly1.cif.gz_A c-terminal domain of mouse surfactant protein b crystallized at high ph 0.538 37 87
ID Description Score Start End Superfamily
af_Q9VDR4_1380_1622_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7137 35 62 3.40.50.300
1tfeA02 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1; 0.7054 36 69 1.10.286.20
1aipC02 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1; 0.7042 37 69 1.10.286.20
2lo0B00 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;Get5 dimerization domain 0.7008 37 69 1.10.286.70
af_Q9C8W7_33_125_3.30.70.80 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Peptidase S8 propeptide/proteinase inhibitor I9 0.684 27 54 3.30.70.80
ID Description Score Start End GO Terms
AF-X1RWV0-F1-model_v4 Uncharacterized protein 0.9429 39 89
AF-F7QRK1-F1-model_v4 Uncharacterized protein 0.8475 38 90
AF-A0A2D6X9W4-F1-model_v4 Uncharacterized protein 0.8267 27 89
AF-A0A5C7PP70-F1-model_v4 Uncharacterized protein 0.8206 27 89
AF-F7QRK1-F1-model_v4 Uncharacterized protein 0.82 38 90

Feature Viewer

pLDDT pTM Quality
66.12 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map