F475110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 685 | 371 | 685 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10592365|Ga0070681_105923652 |
| Length | 105 |
| Sequence | VSQKGQVMATYEGKRTIDGLVVTADGKRLDEHYEVKRFTKYGFEWTYEGESPQQLALAILYDHLGDKDRAIRMSEPFMRKVVANLDNDWTLRGEDVAAFVAGAGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 233 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 234 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 369 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.75 |
| Nodule | 0 |
| Rhizoplane | 8.47 |
| Rhizosphere | 89.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214881028 | 2209111006 | Unclassified | 578 |
| 2 | JGI24737J22298_10083048 | 3300001990 | Bacteria | 953 |
| 3 | JGI24743J22301_10025535 | 3300001991 | Bacteria | 1145 |
| 4 | JGI24750J21931_1001341 | 3300002070 | Bacteria | 3090 |
| 5 | JGI24738J21930_10062502 | 3300002075 | Unclassified | 765 |
| 6 | JGI24749J21850_1034635 | 3300002076 | Bacteria | 731 |
| 7 | JGI24744J21845_10025982 | 3300002077 | Unclassified | 1139 |
| 8 | JGI24034J26672_10015667 | 3300002239 | Unclassified | 1162 |
| 9 | JGI24742J22300_10001929 | 3300002244 | Bacteria | 3302 |
| 10 | JGI24751J29686_10014846 | 3300002459 | Bacteria | 1607 |
| 11 | JGI25153J46596_10000711 | 3300003215 | Bacteria | 20338 |
| 12 | JGI25404J52841_10064658 | 3300003659 | Bacteria | 765 |
| 13 | JGI25405J52794_10004873 | 3300003911 | Bacteria | 2405 |
| 14 | Ga0065707_10543569 | 3300005295 | Bacteria | 726 |
| 15 | Ga0070676_10567433 | 3300005328 | Unclassified | 814 |
| 16 | Ga0070676_10694783 | 3300005328 | Bacteria | 742 |
| 17 | Ga0070676_11339488 | 3300005328 | Unclassified | 548 |
| 18 | Ga0070683_100115805 | 3300005329 | Bacteria | 2530 |
| 19 | Ga0070683_100205026 | 3300005329 | Bacteria | 1873 |
| 20 | Ga0070690_100050605 | 3300005330 | Bacteria | 2651 |
| 21 | Ga0070670_100596065 | 3300005331 | Unclassified | 988 |
| 22 | Ga0070666_10023216 | 3300005335 | Bacteria | 4036 |
| 23 | Ga0070666_10129280 | 3300005335 | Bacteria | 1754 |
| 24 | Ga0070680_100148475 | 3300005336 | Bacteria | 1968 |
| 25 | Ga0070680_102019077 | 3300005336 | Bacteria | 500 |
| 26 | Ga0068868_100173786 | 3300005338 | Bacteria | 1784 |
| 27 | Ga0070660_100884455 | 3300005339 | Bacteria | 753 |
| 28 | Ga0070660_101136214 | 3300005339 | Bacteria | 661 |
| 29 | Ga0070689_100202762 | 3300005340 | Bacteria | 1620 |
| 30 | Ga0070691_10034543 | 3300005341 | Bacteria | 2380 |
| 31 | Ga0070687_100064706 | 3300005343 | Bacteria | 1943 |
| 32 | Ga0070687_100175550 | 3300005343 | Unclassified | 1279 |
| 33 | Ga0070661_100222692 | 3300005344 | Bacteria | 1448 |
| 34 | Ga0070692_10038798 | 3300005345 | Bacteria | 2429 |
| 35 | Ga0070668_100087445 | 3300005347 | Bacteria | 2452 |
| 36 | Ga0070668_100535529 | 3300005347 | Unclassified | 1018 |
| 37 | Ga0070669_100463089 | 3300005353 | Unclassified | 1047 |
| 38 | Ga0070669_100967319 | 3300005353 | Bacteria | 729 |
| 39 | Ga0070675_100221317 | 3300005354 | Bacteria | 1648 |
| 40 | Ga0070671_100177396 | 3300005355 | Bacteria | 1803 |
| 41 | Ga0070671_100778361 | 3300005355 | Bacteria | 832 |
| 42 | Ga0070674_100305946 | 3300005356 | Bacteria | 1269 |
| 43 | Ga0070674_100575308 | 3300005356 | Bacteria | 948 |
| 44 | Ga0070673_100051409 | 3300005364 | Bacteria | 3227 |
| 45 | Ga0070673_100092739 | 3300005364 | Bacteria | 2471 |
| 46 | Ga0070673_101388442 | 3300005364 | Unclassified | 661 |
| 47 | Ga0070688_100019755 | 3300005365 | Bacteria | 3906 |
| 48 | Ga0070659_100274381 | 3300005366 | Bacteria | 1401 |
| 49 | Ga0070667_100760484 | 3300005367 | Unclassified | 898 |
| 50 | Ga0070703_10319443 | 3300005406 | Bacteria | 653 |
| 51 | Ga0070709_10003717 | 3300005434 | Bacteria | 8199 |
| 52 | Ga0070709_11426750 | 3300005434 | Bacteria | 561 |
| 53 | Ga0070714_100027177 | 3300005435 | Bacteria | 4735 |
| 54 | Ga0070714_100351433 | 3300005435 | Unclassified | 1385 |
| 55 | Ga0070713_100004110 | 3300005436 | Bacteria | 9698 |
| 56 | Ga0070713_100434942 | 3300005436 | Bacteria | 1230 |
| 57 | Ga0070713_101218970 | 3300005436 | Unclassified | 728 |
| 58 | Ga0070710_10005634 | 3300005437 | Bacteria | 5960 |
| 59 | Ga0070710_10269330 | 3300005437 | Bacteria | 1101 |
| 60 | Ga0070711_100829849 | 3300005439 | Bacteria | 785 |
| 61 | Ga0070711_100911483 | 3300005439 | Unclassified | 750 |
| 62 | Ga0070705_100460808 | 3300005440 | Bacteria | 956 |
| 63 | Ga0070705_100762615 | 3300005440 | Unclassified | 766 |
| 64 | Ga0070700_100157106 | 3300005441 | Bacteria | 1561 |
| 65 | Ga0070700_100964888 | 3300005441 | Unclassified | 698 |
| 66 | Ga0070694_100133382 | 3300005444 | Bacteria | 1797 |
| 67 | Ga0070694_101490107 | 3300005444 | Bacteria | 572 |
| 68 | Ga0070708_101890748 | 3300005445 | Bacteria | 553 |
| 69 | Ga0070663_100337562 | 3300005455 | Bacteria | 1216 |
| 70 | Ga0070663_100889703 | 3300005455 | Unclassified | 768 |
| 71 | Ga0070678_100189872 | 3300005456 | Bacteria | 1688 |
| 72 | Ga0070678_100323936 | 3300005456 | Bacteria | 1317 |
| 73 | Ga0070662_100037565 | 3300005457 | Bacteria | 3434 |
| 74 | Ga0070681_10592365 | 3300005458 | Bacteria | 1023 |
| 75 | Ga0070681_11996703 | 3300005458 | Bacteria | 508 |
| 76 | Ga0068867_100041718 | 3300005459 | Bacteria | 3353 |
| 77 | Ga0068867_100301491 | 3300005459 | Bacteria | 1321 |
| 78 | Ga0070679_100161661 | 3300005530 | Bacteria | 2214 |
| 79 | Ga0070679_100604774 | 3300005530 | Bacteria | 1040 |
| 80 | Ga0070679_100978525 | 3300005530 | Bacteria | 790 |
| 81 | Ga0070684_100126352 | 3300005535 | Bacteria | 2304 |
| 82 | Ga0070684_100165924 | 3300005535 | Bacteria | 2004 |
| 83 | Ga0070684_100263281 | 3300005535 | Bacteria | 1577 |
| 84 | Ga0068853_100600650 | 3300005539 | Bacteria | 1045 |
| 85 | Ga0068853_101156250 | 3300005539 | Unclassified | 747 |
| 86 | Ga0070672_100151698 | 3300005543 | Bacteria | 1917 |
| 87 | Ga0070686_100287153 | 3300005544 | Bacteria | 1215 |
| 88 | Ga0070686_100448579 | 3300005544 | Bacteria | 991 |
| 89 | Ga0070696_100011790 | 3300005546 | Bacteria | 5858 |
| 90 | Ga0070696_101249308 | 3300005546 | Bacteria | 629 |
| 91 | Ga0070693_100205167 | 3300005547 | Unclassified | 1283 |
| 92 | Ga0070693_101458945 | 3300005547 | Bacteria | 533 |
| 93 | Ga0070665_100210003 | 3300005548 | Bacteria | 1947 |
| 94 | Ga0070704_100003037 | 3300005549 | Bacteria | 9551 |
| 95 | Ga0068855_100157074 | 3300005563 | Bacteria | 2583 |
| 96 | Ga0068855_100546820 | 3300005563 | Unclassified | 1254 |
| 97 | Ga0070664_100018435 | 3300005564 | Bacteria | 5734 |
| 98 | Ga0070664_100289865 | 3300005564 | Bacteria | 1477 |
| 99 | Ga0070664_101270056 | 3300005564 | Bacteria | 695 |
| 100 | Ga0068854_100071551 | 3300005578 | Bacteria | 2537 |
| 101 | Ga0068856_100548702 | 3300005614 | Bacteria | 1177 |
| 102 | Ga0068852_100766955 | 3300005616 | Bacteria | 977 |
| 103 | Ga0068852_100777694 | 3300005616 | Bacteria | 970 |
| 104 | Ga0068859_100077463 | 3300005617 | Bacteria | 3365 |
| 105 | Ga0068859_100498048 | 3300005617 | Unclassified | 1313 |
| 106 | Ga0068864_100005603 | 3300005618 | Bacteria | 10294 |
| 107 | Ga0068864_100194705 | 3300005618 | Bacteria | 1859 |
| 108 | Ga0068866_10048175 | 3300005718 | Bacteria | 2153 |
| 109 | Ga0068861_100329960 | 3300005719 | Unclassified | 1331 |
| 110 | Ga0068861_101625783 | 3300005719 | Bacteria | 637 |
| 111 | Ga0068851_10049054 | 3300005834 | Bacteria | 2141 |
| 112 | Ga0068870_10125530 | 3300005840 | Bacteria | 1484 |
| 113 | Ga0068863_100090051 | 3300005841 | Bacteria | 2909 |
| 114 | Ga0068863_100199880 | 3300005841 | Bacteria | 1922 |
| 115 | Ga0068858_100124350 | 3300005842 | Bacteria | 2414 |
| 116 | Ga0068860_100056993 | 3300005843 | Bacteria | 3713 |
| 117 | Ga0068862_100123793 | 3300005844 | Bacteria | 2281 |
| 118 | Ga0068862_100599485 | 3300005844 | Bacteria | 1057 |
| 119 | Ga0081455_10002167 | 3300005937 | Bacteria | 23428 |
| 120 | Ga0081455_10115039 | 3300005937 | Bacteria | 2130 |
| 121 | Ga0081540_1000008 | 3300005983 | Bacteria | 203702 |
| 122 | Ga0070717_10002524 | 3300006028 | Bacteria | 12888 |
| 123 | Ga0070717_11550002 | 3300006028 | Bacteria | 601 |
| 124 | Ga0070717_12148950 | 3300006028 | Bacteria | 502 |
| 125 | Ga0075365_10444672 | 3300006038 | Bacteria | 915 |
| 126 | Ga0070715_10035898 | 3300006163 | Bacteria | 2041 |
| 127 | Ga0070715_10154817 | 3300006163 | Unclassified | 1127 |
| 128 | Ga0070715_10483732 | 3300006163 | Bacteria | 705 |
| 129 | Ga0070716_100243226 | 3300006173 | Bacteria | 1221 |
| 130 | Ga0070716_100420967 | 3300006173 | Bacteria | 966 |
| 131 | Ga0070712_100036653 | 3300006175 | Bacteria | 3339 |
| 132 | Ga0070712_100112330 | 3300006175 | Bacteria | 2035 |
| 133 | Ga0070712_100270553 | 3300006175 | Bacteria | 1365 |
| 134 | Ga0070712_100796922 | 3300006175 | Bacteria | 810 |
| 135 | Ga0070712_101540531 | 3300006175 | Unclassified | 581 |
| 136 | Ga0075369_10533538 | 3300006186 | Unclassified | 559 |
| 137 | Ga0097621_100239229 | 3300006237 | Bacteria | 1587 |
| 138 | Ga0097621_101486726 | 3300006237 | Unclassified | 642 |
| 139 | Ga0075370_10470580 | 3300006353 | Bacteria | 757 |
| 140 | Ga0075370_10595282 | 3300006353 | Unclassified | 670 |
| 141 | Ga0068871_100159680 | 3300006358 | Bacteria | 1927 |
| 142 | Ga0068871_100575992 | 3300006358 | Unclassified | 1022 |
| 143 | Ga0075428_100002840 | 3300006844 | Bacteria | 18885 |
| 144 | Ga0075428_102131069 | 3300006844 | Unclassified | 579 |
| 145 | Ga0075430_100094409 | 3300006846 | Bacteria | 2501 |
| 146 | Ga0075431_100001610 | 3300006847 | Bacteria | 21067 |
| 147 | Ga0075433_10128386 | 3300006852 | Bacteria | 2252 |
| 148 | Ga0075433_11172471 | 3300006852 | Bacteria | 667 |
| 149 | Ga0075434_100086382 | 3300006871 | Bacteria | 3137 |
| 150 | Ga0075434_100118738 | 3300006871 | Bacteria | 2658 |
| 151 | Ga0075434_100168202 | 3300006871 | Bacteria | 2212 |
| 152 | Ga0075434_100381912 | 3300006871 | Bacteria | 1429 |
| 153 | Ga0075429_100090555 | 3300006880 | Bacteria | 2668 |
| 154 | Ga0068865_100073958 | 3300006881 | Bacteria | 2425 |
| 155 | Ga0075436_101210603 | 3300006914 | Bacteria | 570 |
| 156 | Ga0097620_100077464 | 3300006931 | Bacteria | 3365 |
| 157 | Ga0097620_100498060 | 3300006931 | Unclassified | 1313 |
| 158 | Ga0075435_100004091 | 3300007076 | Bacteria | 9987 |
| 159 | Ga0075435_101175962 | 3300007076 | Bacteria | 671 |
| 160 | Ga0099794_10748027 | 3300007265 | Bacteria | 522 |
| 161 | Ga0105251_10034356 | 3300009011 | Bacteria | 2510 |
| 162 | Ga0105250_10079947 | 3300009092 | Bacteria | 1325 |
| 163 | Ga0105240_11185402 | 3300009093 | Bacteria | 809 |
| 164 | Ga0111539_10003049 | 3300009094 | Bacteria | 22198 |
| 165 | Ga0105247_10184604 | 3300009101 | Bacteria | 1393 |
| 166 | Ga0114129_10001163 | 3300009147 | Bacteria | 34882 |
| 167 | Ga0105243_10932966 | 3300009148 | Unclassified | 866 |
| 168 | Ga0105241_10067576 | 3300009174 | Bacteria | 2767 |
| 169 | Ga0105241_10112609 | 3300009174 | Bacteria | 2180 |
| 170 | Ga0105241_10132301 | 3300009174 | Bacteria | 2021 |
| 171 | Ga0105241_11355790 | 3300009174 | Bacteria | 679 |
| 172 | Ga0105242_10124133 | 3300009176 | Bacteria | 2220 |
| 173 | Ga0105242_10424632 | 3300009176 | Bacteria | 1246 |
| 174 | Ga0105248_10247838 | 3300009177 | Bacteria | 2005 |
| 175 | Ga0105248_11265892 | 3300009177 | Unclassified | 834 |
| 176 | Ga0105248_12998841 | 3300009177 | Unclassified | 538 |
| 177 | Ga0105237_11561853 | 3300009545 | Bacteria | 667 |
| 178 | Ga0105237_12266513 | 3300009545 | Bacteria | 553 |
| 179 | Ga0105238_10311325 | 3300009551 | Bacteria | 1559 |
| 180 | Ga0105238_11170507 | 3300009551 | Bacteria | 793 |
| 181 | Ga0105249_10000905 | 3300009553 | Bacteria | 26200 |
| 182 | Ga0105249_10507336 | 3300009553 | Unclassified | 1252 |
| 183 | Ga0105249_12019285 | 3300009553 | Unclassified | 649 |
| 184 | Ga0105239_10220786 | 3300010375 | Bacteria | 2126 |
| 185 | Ga0105239_13325708 | 3300010375 | Bacteria | 523 |
| 186 | Ga0105246_10187076 | 3300011119 | Bacteria | 1599 |
| 187 | Ga0105246_10412995 | 3300011119 | Bacteria | 1124 |
| 188 | Ga0157344_1003810 | 3300012476 | Unclassified | 870 |
| 189 | Ga0157369_11147123 | 3300013105 | Unclassified | 794 |
| 190 | Ga0157369_12374675 | 3300013105 | Unclassified | 537 |
| 191 | Ga0157374_10173224 | 3300013296 | Bacteria | 2106 |
| 192 | Ga0157374_11002813 | 3300013296 | Unclassified | 854 |
| 193 | Ga0157378_10053607 | 3300013297 | Bacteria | 3591 |
| 194 | Ga0163162_10217253 | 3300013306 | Bacteria | 2042 |
| 195 | Ga0163162_10433602 | 3300013306 | Bacteria | 1446 |
| 196 | Ga0163162_10605755 | 3300013306 | Bacteria | 1221 |
| 197 | Ga0157375_11418558 | 3300013308 | Unclassified | 818 |
| 198 | Ga0163163_10056522 | 3300014325 | Bacteria | 3879 |
| 199 | Ga0163163_11210663 | 3300014325 | Unclassified | 818 |
| 200 | Ga0157380_10363205 | 3300014326 | Unclassified | 1359 |
| 201 | Ga0157380_10644661 | 3300014326 | Bacteria | 1055 |
| 202 | Ga0157380_12533079 | 3300014326 | Bacteria | 579 |
| 203 | Ga0182008_10252942 | 3300014497 | Bacteria | 909 |
| 204 | Ga0157377_10018475 | 3300014745 | Bacteria | 3624 |
| 205 | Ga0157377_10088941 | 3300014745 | Bacteria | 1820 |
| 206 | Ga0157379_10171571 | 3300014968 | Bacteria | 1958 |
| 207 | Ga0157379_10551277 | 3300014968 | Bacteria | 1073 |
| 208 | Ga0157376_10277065 | 3300014969 | Unclassified | 1578 |
| 209 | Ga0157376_10898082 | 3300014969 | Unclassified | 904 |
| 210 | Ga0157376_11512421 | 3300014969 | Bacteria | 704 |
| 211 | Ga0163161_11205958 | 3300017792 | Unclassified | 654 |
| 212 | Ga0197907_11230264 | 3300020069 | Bacteria | 577 |
| 213 | Ga0209758_1000373 | 3300025297 | Bacteria | 78698 |
| 214 | Ga0207426_1139105 | 3300025302 | Bacteria | 579 |
| 215 | Ga0207656_10229552 | 3300025321 | Bacteria | 904 |
| 216 | Ga0207713_1046555 | 3300025735 | Bacteria | 1763 |
| 217 | Ga0207682_10114400 | 3300025893 | Bacteria | 1190 |
| 218 | Ga0207692_10027430 | 3300025898 | Bacteria | 2683 |
| 219 | Ga0207692_10183794 | 3300025898 | Bacteria | 1219 |
| 220 | Ga0207642_10239780 | 3300025899 | Unclassified | 1023 |
| 221 | Ga0207710_10020902 | 3300025900 | Bacteria | 2802 |
| 222 | Ga0207710_10035279 | 3300025900 | Bacteria | 2201 |
| 223 | Ga0207688_10002291 | 3300025901 | Bacteria | 10295 |
| 224 | Ga0207688_10170276 | 3300025901 | Bacteria | 1295 |
| 225 | Ga0207680_10161096 | 3300025903 | Bacteria | 1504 |
| 226 | Ga0207647_10023557 | 3300025904 | Bacteria | 4070 |
| 227 | Ga0207685_10019025 | 3300025905 | Bacteria | 2255 |
| 228 | Ga0207685_10036859 | 3300025905 | Bacteria | 1797 |
| 229 | Ga0207685_10495790 | 3300025905 | Bacteria | 642 |
| 230 | Ga0207699_10001254 | 3300025906 | Bacteria | 12078 |
| 231 | Ga0207699_10525795 | 3300025906 | Bacteria | 856 |
| 232 | Ga0207645_10062167 | 3300025907 | Bacteria | 2385 |
| 233 | Ga0207645_10357608 | 3300025907 | Bacteria | 978 |
| 234 | Ga0207643_10024520 | 3300025908 | Bacteria | 3329 |
| 235 | Ga0207654_10033105 | 3300025911 | Bacteria | 2862 |
| 236 | Ga0207654_10299084 | 3300025911 | Unclassified | 1094 |
| 237 | Ga0207707_11166412 | 3300025912 | Bacteria | 625 |
| 238 | Ga0207671_11472425 | 3300025914 | Bacteria | 526 |
| 239 | Ga0207693_10033262 | 3300025915 | Bacteria | 4069 |
| 240 | Ga0207693_10047415 | 3300025915 | Bacteria | 3376 |
| 241 | Ga0207693_10128967 | 3300025915 | Bacteria | 1988 |
| 242 | Ga0207693_10451968 | 3300025915 | Bacteria | 1004 |
| 243 | Ga0207693_10877279 | 3300025915 | Bacteria | 689 |
| 244 | Ga0207663_10496535 | 3300025916 | Unclassified | 947 |
| 245 | Ga0207663_11596646 | 3300025916 | Unclassified | 525 |
| 246 | Ga0207663_11720471 | 3300025916 | Unclassified | 504 |
| 247 | Ga0207660_10212170 | 3300025917 | Bacteria | 1517 |
| 248 | Ga0207660_11308975 | 3300025917 | Unclassified | 588 |
| 249 | Ga0207662_10003397 | 3300025918 | Bacteria | 8187 |
| 250 | Ga0207662_11192377 | 3300025918 | Bacteria | 541 |
| 251 | Ga0207657_10048757 | 3300025919 | Bacteria | 3696 |
| 252 | Ga0207657_10413513 | 3300025919 | Bacteria | 1060 |
| 253 | Ga0207649_10567042 | 3300025920 | Unclassified | 870 |
| 254 | Ga0207652_10439677 | 3300025921 | Bacteria | 1176 |
| 255 | Ga0207694_10485853 | 3300025924 | Bacteria | 1033 |
| 256 | Ga0207694_11465133 | 3300025924 | Bacteria | 576 |
| 257 | Ga0207650_10230663 | 3300025925 | Bacteria | 1493 |
| 258 | Ga0207659_10254859 | 3300025926 | Bacteria | 1425 |
| 259 | Ga0207687_10873675 | 3300025927 | Bacteria | 769 |
| 260 | Ga0207700_10001346 | 3300025928 | Bacteria | 13937 |
| 261 | Ga0207700_10472414 | 3300025928 | Bacteria | 1107 |
| 262 | Ga0207664_10034782 | 3300025929 | Bacteria | 3883 |
| 263 | Ga0207664_11124598 | 3300025929 | Bacteria | 702 |
| 264 | Ga0207644_10555613 | 3300025931 | Unclassified | 950 |
| 265 | Ga0207690_10538355 | 3300025932 | Unclassified | 948 |
| 266 | Ga0207706_10047303 | 3300025933 | Bacteria | 3807 |
| 267 | Ga0207706_10074129 | 3300025933 | Bacteria | 2993 |
| 268 | Ga0207706_11601959 | 3300025933 | Unclassified | 527 |
| 269 | Ga0207686_10118332 | 3300025934 | Bacteria | 1799 |
| 270 | Ga0207686_10593998 | 3300025934 | Bacteria | 870 |
| 271 | Ga0207709_10359365 | 3300025935 | Unclassified | 1102 |
| 272 | Ga0207709_11059281 | 3300025935 | Bacteria | 665 |
| 273 | Ga0207670_10104197 | 3300025936 | Bacteria | 2031 |
| 274 | Ga0207670_11601493 | 3300025936 | Bacteria | 554 |
| 275 | Ga0207669_10028791 | 3300025937 | Bacteria | 3061 |
| 276 | Ga0207704_10047933 | 3300025938 | Bacteria | 2558 |
| 277 | Ga0207665_10004253 | 3300025939 | Bacteria | 9516 |
| 278 | Ga0207665_10055173 | 3300025939 | Bacteria | 2680 |
| 279 | Ga0207691_10015850 | 3300025940 | Bacteria | 7163 |
| 280 | Ga0207711_10273311 | 3300025941 | Bacteria | 1555 |
| 281 | Ga0207711_10873998 | 3300025941 | Bacteria | 836 |
| 282 | Ga0207689_10113511 | 3300025942 | Bacteria | 2227 |
| 283 | Ga0207661_10555000 | 3300025944 | Bacteria | 1052 |
| 284 | Ga0207679_10265519 | 3300025945 | Bacteria | 1466 |
| 285 | Ga0207667_10050154 | 3300025949 | Bacteria | 4405 |
| 286 | Ga0207667_11605900 | 3300025949 | Bacteria | 619 |
| 287 | Ga0207651_10024143 | 3300025960 | Bacteria | 3755 |
| 288 | Ga0207651_11172561 | 3300025960 | Unclassified | 689 |
| 289 | Ga0207712_10004862 | 3300025961 | Bacteria | 8494 |
| 290 | Ga0207712_10121746 | 3300025961 | Bacteria | 1975 |
| 291 | Ga0207712_10283870 | 3300025961 | Unclassified | 1352 |
| 292 | Ga0207668_10115721 | 3300025972 | Bacteria | 2020 |
| 293 | Ga0207668_10379657 | 3300025972 | Bacteria | 1189 |
| 294 | Ga0207668_10529973 | 3300025972 | Bacteria | 1017 |
| 295 | Ga0207640_10722042 | 3300025981 | Unclassified | 856 |
| 296 | Ga0207658_10278849 | 3300025986 | Bacteria | 1432 |
| 297 | Ga0207658_11219868 | 3300025986 | Bacteria | 688 |
| 298 | Ga0207677_10055397 | 3300026023 | Bacteria | 2711 |
| 299 | Ga0207677_11425546 | 3300026023 | Unclassified | 638 |
| 300 | Ga0207703_10012740 | 3300026035 | Bacteria | 6557 |
| 301 | Ga0207703_10894394 | 3300026035 | Bacteria | 850 |
| 302 | Ga0207639_10364778 | 3300026041 | Bacteria | 1293 |
| 303 | Ga0207639_10367285 | 3300026041 | Bacteria | 1289 |
| 304 | Ga0207678_10038146 | 3300026067 | Bacteria | 4176 |
| 305 | Ga0207708_10030243 | 3300026075 | Bacteria | 4107 |
| 306 | Ga0207708_11071894 | 3300026075 | Unclassified | 702 |
| 307 | Ga0207702_10037988 | 3300026078 | Bacteria | 4033 |
| 308 | Ga0207702_11557536 | 3300026078 | Unclassified | 654 |
| 309 | Ga0207641_10515635 | 3300026088 | Bacteria | 1162 |
| 310 | Ga0207648_10012760 | 3300026089 | Bacteria | 7852 |
| 311 | Ga0207648_10243918 | 3300026089 | Bacteria | 1600 |
| 312 | Ga0207676_10047716 | 3300026095 | Bacteria | 3320 |
| 313 | Ga0207674_10250716 | 3300026116 | Bacteria | 1717 |
| 314 | Ga0207675_100002876 | 3300026118 | Bacteria | 16923 |
| 315 | Ga0207675_100068525 | 3300026118 | Bacteria | 3316 |
| 316 | Ga0207675_101621546 | 3300026118 | Bacteria | 667 |
| 317 | Ga0207683_10023595 | 3300026121 | Bacteria | 5291 |
| 318 | Ga0207683_10658365 | 3300026121 | Unclassified | 970 |
| 319 | Ga0207428_10005326 | 3300027907 | Bacteria | 11998 |
| 320 | Ga0268266_10045805 | 3300028379 | Bacteria | 3743 |
| 321 | Ga0268266_10369073 | 3300028379 | Bacteria | 1351 |
| 322 | Ga0268265_10027056 | 3300028380 | Bacteria | 4088 |
| 323 | Ga0268265_11191083 | 3300028380 | Bacteria | 759 |
| 324 | Ga0265332_10278017 | 3300031238 | Bacteria | 692 |
| 325 | Ga0265340_10296913 | 3300031247 | Bacteria | 717 |
| 326 | Ga0265339_10142168 | 3300031249 | Bacteria | 1220 |
| 327 | Ga0265331_10071212 | 3300031250 | Bacteria | 1627 |
| 328 | Ga0265316_10101358 | 3300031344 | Bacteria | 2187 |
| 329 | Ga0307408_101153673 | 3300031548 | Bacteria | 721 |
| 330 | Ga0307405_11497847 | 3300031731 | Unclassified | 593 |
| 331 | Ga0307410_10239231 | 3300031852 | Bacteria | 1406 |
| 332 | Ga0307406_10662292 | 3300031901 | Unclassified | 868 |
| 333 | Ga0307407_10230380 | 3300031903 | Unclassified | 1258 |
| 334 | Ga0307409_101428041 | 3300031995 | Bacteria | 719 |
| 335 | Ga0307416_101619248 | 3300032002 | Bacteria | 753 |
| 336 | Ga0307411_10756025 | 3300032005 | Bacteria | 852 |
| 337 | Ga0373926_0006770 | 3300035083 | Bacteria | 3808 |
| 338 | Ga0373926_0067171 | 3300035083 | Unclassified | 1314 |
| 339 | Ga0373926_0117565 | 3300035083 | Bacteria | 1001 |
| 340 | Ga0373934_0109789 | 3300035086 | Bacteria | 1118 |
| 341 | Ga0373940_0021083 | 3300035088 | Bacteria | 1662 |
| 342 | Ga0373944_0001887 | 3300035089 | Bacteria | 5300 |
| 343 | Ga0373944_0009056 | 3300035089 | Bacteria | 2693 |
| 344 | Ga0373951_0072830 | 3300035091 | Bacteria | 878 |
| 345 | Ga0373923_0004951 | 3300035111 | Bacteria | 4477 |
| 346 | Ga0373923_0028384 | 3300035111 | Bacteria | 2238 |
| 347 | Ga0373932_0427568 | 3300035112 | Unclassified | 516 |
| 348 | Ga0373936_0003385 | 3300035113 | Bacteria | 5976 |
| 349 | Ga0373936_0102318 | 3300035113 | Bacteria | 1209 |
| 350 | Ga0373945_0001184 | 3300035116 | Bacteria | 7928 |
| 351 | Ga0373945_0004059 | 3300035116 | Bacteria | 4633 |
| 352 | Ga0373945_0055860 | 3300035116 | Bacteria | 1463 |
| 353 | Ga0373953_0092979 | 3300035117 | Bacteria | 1263 |
| 354 | Ga0373954_0017433 | 3300035118 | Bacteria | 3226 |
| 355 | Ga0373954_0176850 | 3300035118 | Bacteria | 1046 |
| 356 | Ga0373957_0023742 | 3300035120 | Bacteria | 2196 |
| 357 | Ga0373943_0007904 | 3300035170 | Bacteria | 4773 |
| 358 | Ga0373943_0018338 | 3300035170 | Bacteria | 3213 |
| 359 | Ga0373943_0089848 | 3300035170 | Bacteria | 1589 |
| 360 | Ga0373943_0308759 | 3300035170 | Bacteria | 899 |
| 361 | Ga0373943_0677614 | 3300035170 | Unclassified | 610 |
| 362 | Ga0373946_0001037 | 3300035171 | Bacteria | 9550 |
| 363 | Ga0373946_0001521 | 3300035171 | Bacteria | 8060 |
| 364 | Ga0373946_0008101 | 3300035171 | Bacteria | 3858 |
| 365 | Ga0373946_0380143 | 3300035171 | Unclassified | 710 |
| 366 | Ga0373955_0023108 | 3300035172 | Bacteria | 3163 |
| 367 | Ga0373962_0140516 | 3300035242 | Bacteria | 784 |
| 368 | Ga0373924_0002712 | 3300035410 | Bacteria | 5976 |
| 369 | Ga0373924_0053467 | 3300035410 | Bacteria | 1678 |
| 370 | Ga0373924_0413962 | 3300035410 | Unclassified | 603 |
| 371 | Ga0373931_0004834 | 3300035691 | Bacteria | 6188 |
| 372 | Ga0373935_0001406 | 3300035692 | Bacteria | 13337 |
| 373 | Ga0373935_0014243 | 3300035692 | Bacteria | 4799 |
| 374 | Ga0373935_0035255 | 3300035692 | Bacteria | 3122 |
| 375 | Ga0373935_0281159 | 3300035692 | Bacteria | 1172 |
| 376 | Ga0373935_0359194 | 3300035692 | Bacteria | 1040 |
| 377 | Ga0373927_0000892 | 3300035695 | Bacteria | 22721 |
| 378 | Ga0373927_0003933 | 3300035695 | Bacteria | 10535 |
| 379 | Ga0373927_0038572 | 3300035695 | Bacteria | 3101 |
| 380 | Ga0373927_0072933 | 3300035695 | Bacteria | 2223 |
| 381 | Ga0373927_0161516 | 3300035695 | Bacteria | 1468 |
| 382 | Ga0373927_0208007 | 3300035695 | Bacteria | 1285 |
| 383 | Ga0373933_0023914 | 3300035724 | Bacteria | 3495 |
| 384 | Ga0373947_0000629 | 3300035725 | Bacteria | 20890 |
| 385 | Ga0373947_0003263 | 3300035725 | Bacteria | 9619 |
| 386 | Ga0373947_0007599 | 3300035725 | Bacteria | 6272 |
| 387 | Ga0373947_0190914 | 3300035725 | Bacteria | 1337 |
| 388 | Ga0373947_0639401 | 3300035725 | Bacteria | 725 |
| 389 | Ga0373947_0904139 | 3300035725 | Unclassified | 603 |
| 390 | Ga0373947_1125483 | 3300035725 | Unclassified | 535 |
| 391 | Ga0373947_1267644 | 3300035725 | Unclassified | 502 |
| 392 | Ga0373937_0084788 | 3300036401 | Bacteria | 2931 |
| 393 | Ga0373925_0003681 | 3300037068 | Bacteria | 11791 |
| 394 | Ga0373925_0017905 | 3300037068 | Bacteria | 5142 |
| 395 | Ga0373925_0075656 | 3300037068 | Bacteria | 2552 |
| 396 | Ga0373925_0079818 | 3300037068 | Bacteria | 2486 |
| 397 | Ga0373925_0165413 | 3300037068 | Bacteria | 1744 |
| 398 | Ga0373925_0422570 | 3300037068 | Unclassified | 1089 |
| 399 | Ga0395898_0324414 | 3300037466 | Bacteria | 1469 |
| 400 | Ga0395898_1979984 | 3300037466 | Unclassified | 502 |
| 401 | Ga0395901_0079286 | 3300038443 | Bacteria | 3429 |
| 402 | Ga0451793_0517916 | 3300041452 | Bacteria | 516 |
| 403 | Ga0439464_0076514 | 3300042439 | Bacteria | 995 |
| 404 | Ga0466960_0428184 | 3300044901 | Unclassified | 766 |
| 405 | Ga0466958_0591265 | 3300045836 | Bacteria | 722 |
| 406 | Ga0495617_037668 | 3300046452 | Bacteria | 1619 |
| 407 | Ga0495592_0052256 | 3300046454 | Bacteria | 3034 |
| 408 | Ga0495603_0036999 | 3300046455 | Bacteria | 2929 |
| 409 | Ga0495603_0056534 | 3300046455 | Bacteria | 2322 |
| 410 | Ga0495591_073226 | 3300046458 | Bacteria | 886 |
| 411 | Ga0495591_099477 | 3300046458 | Bacteria | 722 |
| 412 | Ga0495629_0014941 | 3300046459 | Bacteria | 5579 |
| 413 | Ga0495629_0026104 | 3300046459 | Bacteria | 4151 |
| 414 | Ga0495629_0844630 | 3300046459 | Bacteria | 602 |
| 415 | Ga0495629_0967854 | 3300046459 | Unclassified | 555 |
| 416 | Ga0495641_0041321 | 3300046461 | Bacteria | 2143 |
| 417 | Ga0495651_0016437 | 3300046462 | Bacteria | 5731 |
| 418 | Ga0495653_0005878 | 3300046463 | Bacteria | 10041 |
| 419 | Ga0495653_0129270 | 3300046463 | Bacteria | 1790 |
| 420 | Ga0495580_0053925 | 3300046472 | Bacteria | 2837 |
| 421 | Ga0495580_0059600 | 3300046472 | Bacteria | 2682 |
| 422 | Ga0495580_0352741 | 3300046472 | Unclassified | 996 |
| 423 | Ga0495582_0099607 | 3300046473 | Bacteria | 1626 |
| 424 | Ga0495582_0603397 | 3300046473 | Bacteria | 635 |
| 425 | Ga0495639_0005083 | 3300046475 | Bacteria | 5652 |
| 426 | Ga0495639_0075971 | 3300046475 | Bacteria | 1558 |
| 427 | Ga0495639_0196684 | 3300046475 | Unclassified | 986 |
| 428 | Ga0495662_0018751 | 3300046476 | Bacteria | 3349 |
| 429 | Ga0495662_0087217 | 3300046476 | Bacteria | 1520 |
| 430 | Ga0495662_0343201 | 3300046476 | Bacteria | 734 |
| 431 | Ga0495664_0001034 | 3300046477 | Bacteria | 14381 |
| 432 | Ga0495664_0061834 | 3300046477 | Bacteria | 2229 |
| 433 | Ga0495664_0437337 | 3300046477 | Bacteria | 784 |
| 434 | Ga0495584_0010382 | 3300046491 | Bacteria | 4787 |
| 435 | Ga0495584_0133481 | 3300046491 | Bacteria | 1260 |
| 436 | Ga0495585_0002702 | 3300046492 | Bacteria | 12423 |
| 437 | Ga0495594_0084341 | 3300046499 | Bacteria | 1776 |
| 438 | Ga0495596_0207950 | 3300046500 | Bacteria | 760 |
| 439 | Ga0495607_0043119 | 3300046501 | Bacteria | 2670 |
| 440 | Ga0495583_0331447 | 3300046506 | Bacteria | 602 |
| 441 | Ga0495608_0023329 | 3300046511 | Bacteria | 4240 |
| 442 | Ga0495618_0005416 | 3300046514 | Bacteria | 7782 |
| 443 | Ga0495618_0009681 | 3300046514 | Bacteria | 5818 |
| 444 | Ga0495618_0017145 | 3300046514 | Bacteria | 4438 |
| 445 | Ga0495628_0023643 | 3300046516 | Bacteria | 5042 |
| 446 | Ga0495628_0160286 | 3300046516 | Bacteria | 1710 |
| 447 | Ga0495630_0014775 | 3300046517 | Bacteria | 5693 |
| 448 | Ga0495630_0026988 | 3300046517 | Bacteria | 4256 |
| 449 | Ga0495630_0116373 | 3300046517 | Bacteria | 2026 |
| 450 | Ga0495644_0000510 | 3300046523 | Bacteria | 16598 |
| 451 | Ga0495666_0004543 | 3300046526 | Bacteria | 7014 |
| 452 | Ga0495666_0153262 | 3300046526 | Bacteria | 1071 |
| 453 | Ga0495652_0012180 | 3300046529 | Bacteria | 7768 |
| 454 | Ga0495652_0018127 | 3300046529 | Bacteria | 6283 |
| 455 | Ga0495652_0106455 | 3300046529 | Bacteria | 2265 |
| 456 | Ga0495665_0002324 | 3300046531 | Bacteria | 10269 |
| 457 | Ga0495665_0085230 | 3300046531 | Bacteria | 1660 |
| 458 | Ga0495665_0168889 | 3300046531 | Bacteria | 1139 |
| 459 | Ga0495665_0362674 | 3300046531 | Bacteria | 737 |
| 460 | Ga0495640_0008356 | 3300046533 | Bacteria | 8120 |
| 461 | Ga0495640_0021657 | 3300046533 | Bacteria | 4711 |
| 462 | Ga0495640_0058303 | 3300046533 | Bacteria | 2633 |
| 463 | Ga0495640_0108868 | 3300046533 | Bacteria | 1812 |
| 464 | Ga0495586_0012180 | 3300046535 | Bacteria | 4566 |
| 465 | Ga0495587_0009020 | 3300046536 | Bacteria | 6402 |
| 466 | Ga0495598_0001168 | 3300046537 | Bacteria | 5074 |
| 467 | Ga0495609_0040488 | 3300046538 | Bacteria | 2097 |
| 468 | Ga0495645_0015262 | 3300046543 | Bacteria | 5463 |
| 469 | Ga0495645_0258761 | 3300046543 | Bacteria | 1154 |
| 470 | Ga0495622_0028237 | 3300046557 | Bacteria | 2619 |
| 471 | Ga0495633_0005507 | 3300046558 | Bacteria | 7705 |
| 472 | Ga0495667_0004324 | 3300046559 | Bacteria | 9586 |
| 473 | Ga0495656_0215066 | 3300046615 | Bacteria | 959 |
| 474 | Ga0495634_0007278 | 3300046642 | Bacteria | 8338 |
| 475 | Ga0495634_0018647 | 3300046642 | Bacteria | 4936 |
| 476 | Ga0495634_0069154 | 3300046642 | Bacteria | 2330 |
| 477 | Ga0495634_0182003 | 3300046642 | Bacteria | 1315 |
| 478 | Ga0495634_0208915 | 3300046642 | Bacteria | 1209 |
| 479 | Ga0495611_0004254 | 3300046648 | Bacteria | 6229 |
| 480 | Ga0495625_0258092 | 3300046660 | Bacteria | 1129 |
| 481 | Ga0495635_0007226 | 3300046663 | Bacteria | 7758 |
| 482 | Ga0495635_0092738 | 3300046663 | Bacteria | 2065 |
| 483 | Ga0495635_0162211 | 3300046663 | Bacteria | 1521 |
| 484 | Ga0495635_1077575 | 3300046663 | Unclassified | 509 |
| 485 | Ga0495661_0085906 | 3300046665 | Bacteria | 1802 |
| 486 | Ga0495588_0001938 | 3300046674 | Bacteria | 8837 |
| 487 | Ga0495599_0025038 | 3300046678 | Bacteria | 3734 |
| 488 | Ga0495599_0037081 | 3300046678 | Bacteria | 3063 |
| 489 | Ga0495623_0516505 | 3300046679 | Unclassified | 629 |
| 490 | Ga0495646_0061436 | 3300046680 | Bacteria | 2238 |
| 491 | Ga0495646_0075503 | 3300046680 | Bacteria | 1976 |
| 492 | Ga0495647_0037492 | 3300046681 | Bacteria | 1830 |
| 493 | Ga0495647_0107629 | 3300046681 | Bacteria | 1160 |
| 494 | Ga0495647_0251045 | 3300046681 | Bacteria | 787 |
| 495 | Ga0495647_0413171 | 3300046681 | Unclassified | 621 |
| 496 | Ga0495658_0035402 | 3300046683 | Bacteria | 2746 |
| 497 | Ga0495658_0055302 | 3300046683 | Bacteria | 2260 |
| 498 | Ga0495658_0260796 | 3300046683 | Bacteria | 1091 |
| 499 | Ga0495658_0971465 | 3300046683 | Unclassified | 542 |
| 500 | Ga0495669_0282768 | 3300046684 | Bacteria | 798 |
| 501 | Ga0495613_0024550 | 3300046689 | Bacteria | 4491 |
| 502 | Ga0495613_0043387 | 3300046689 | Bacteria | 3327 |
| 503 | Ga0495613_0162977 | 3300046689 | Bacteria | 1585 |
| 504 | Ga0495613_0688658 | 3300046689 | Bacteria | 674 |
| 505 | Ga0495613_1064924 | 3300046689 | Unclassified | 517 |
| 506 | Ga0495624_0003037 | 3300046690 | Bacteria | 12571 |
| 507 | Ga0495624_0027240 | 3300046690 | Bacteria | 3743 |
| 508 | Ga0495624_0099022 | 3300046690 | Bacteria | 1795 |
| 509 | Ga0495670_0003427 | 3300046691 | Bacteria | 7793 |
| 510 | Ga0495649_0059244 | 3300046694 | Bacteria | 2062 |
| 511 | Ga0495589_0042744 | 3300046794 | Bacteria | 2258 |
| 512 | Ga0495589_0103827 | 3300046794 | Bacteria | 1374 |
| 513 | Ga0495600_0000758 | 3300046809 | Bacteria | 17034 |
| 514 | Ga0495581_0002122 | 3300047315 | Bacteria | 11179 |
| 515 | Ga0495581_0008625 | 3300047315 | Bacteria | 5905 |
| 516 | Ga0495581_0055853 | 3300047315 | Bacteria | 2279 |
| 517 | Ga0495581_0274980 | 3300047315 | Unclassified | 985 |
| 518 | Ga0495604_0006519 | 3300047317 | Bacteria | 9249 |
| 519 | Ga0495636_0322726 | 3300047318 | Bacteria | 725 |
| 520 | Ga0495674_0003621 | 3300047319 | Bacteria | 15039 |
| 521 | Ga0495674_0025009 | 3300047319 | Bacteria | 5479 |
| 522 | Ga0495674_0094472 | 3300047319 | Bacteria | 2550 |
| 523 | Ga0495672_0250442 | 3300047320 | Unclassified | 860 |
| 524 | Ga0495676_0074467 | 3300047321 | Bacteria | 2600 |
| 525 | Ga0495676_0090087 | 3300047321 | Bacteria | 2296 |
| 526 | Ga0495680_0006335 | 3300047322 | Bacteria | 11014 |
| 527 | Ga0495680_0192123 | 3300047322 | Bacteria | 1468 |
| 528 | Ga0495683_0207585 | 3300047323 | Bacteria | 880 |
| 529 | Ga0495675_0063137 | 3300047444 | Bacteria | 2344 |
| 530 | Ga0495677_0139985 | 3300047445 | Unclassified | 929 |
| 531 | Ga0495679_009932 | 3300047446 | Bacteria | 3772 |
| 532 | Ga0495681_0104800 | 3300047470 | Bacteria | 1232 |
| 533 | Ga0495684_0002702 | 3300047471 | Bacteria | 14043 |
| 534 | Ga0495684_0035642 | 3300047471 | Bacteria | 3814 |
| 535 | Ga0495684_0107676 | 3300047471 | Bacteria | 2105 |
| 536 | Ga0495684_0489647 | 3300047471 | Bacteria | 847 |
| 537 | Ga0495593_0010234 | 3300047673 | Bacteria | 5423 |
| 538 | Ga0495593_0029008 | 3300047673 | Bacteria | 3037 |
| 539 | Ga0495593_0133338 | 3300047673 | Bacteria | 1260 |
| 540 | Ga0495602_0122404 | 3300048088 | Bacteria | 2091 |
| 541 | Ga0495614_0063042 | 3300048089 | Bacteria | 1593 |
| 542 | Ga0495626_0170403 | 3300048091 | Bacteria | 908 |
| 543 | Ga0496100_0004121 | 3300048903 | Bacteria | 7665 |
| 544 | Ga0496100_0018910 | 3300048903 | Bacteria | 4099 |
| 545 | Ga0496101_0002301 | 3300048904 | Bacteria | 11683 |
| 546 | Ga0496101_0022121 | 3300048904 | Bacteria | 4374 |
| 547 | Ga0496101_0174536 | 3300048904 | Bacteria | 1652 |
| 548 | Ga0496101_0474792 | 3300048904 | Bacteria | 987 |
| 549 | Ga0496102_0001907 | 3300048905 | Bacteria | 17978 |
| 550 | Ga0496102_0211431 | 3300048905 | Bacteria | 1828 |
| 551 | Ga0496102_0636578 | 3300048905 | Bacteria | 989 |
| 552 | Ga0496103_0005408 | 3300048906 | Bacteria | 7645 |
| 553 | Ga0496103_0031406 | 3300048906 | Bacteria | 3235 |
| 554 | Ga0496103_0090853 | 3300048906 | Bacteria | 1926 |
| 555 | Ga0496104_0003321 | 3300048907 | Bacteria | 13883 |
| 556 | Ga0496104_0113207 | 3300048907 | Unclassified | 2602 |
| 557 | Ga0496104_0259799 | 3300048907 | Bacteria | 1649 |
| 558 | Ga0496104_0605768 | 3300048907 | Unclassified | 1005 |
| 559 | Ga0496105_0005879 | 3300048908 | Bacteria | 9354 |
| 560 | Ga0496105_0011008 | 3300048908 | Bacteria | 7130 |
| 561 | Ga0496105_0143115 | 3300048908 | Bacteria | 1967 |
| 562 | Ga0496106_0001903 | 3300048909 | Bacteria | 15629 |
| 563 | Ga0496106_0050355 | 3300048909 | Bacteria | 3139 |
| 564 | Ga0496106_0168933 | 3300048909 | Bacteria | 1732 |
| 565 | Ga0496107_0000742 | 3300048910 | Bacteria | 18683 |
| 566 | Ga0496107_0048198 | 3300048910 | Bacteria | 3068 |
| 567 | Ga0496107_0067308 | 3300048910 | Bacteria | 2598 |
| 568 | Ga0496108_0005149 | 3300048911 | Bacteria | 10570 |
| 569 | Ga0496108_0012312 | 3300048911 | Bacteria | 6957 |
| 570 | Ga0496108_0170760 | 3300048911 | Bacteria | 1881 |
| 571 | Ga0496108_0223913 | 3300048911 | Bacteria | 1634 |
| 572 | Ga0496109_0002185 | 3300048912 | Bacteria | 16231 |
| 573 | Ga0496109_0013309 | 3300048912 | Bacteria | 7128 |
| 574 | Ga0496109_0045609 | 3300048912 | Bacteria | 3978 |
| 575 | Ga0496109_0075548 | 3300048912 | Bacteria | 3098 |
| 576 | Ga0496109_0087085 | 3300048912 | Bacteria | 2884 |
| 577 | Ga0496110_0001267 | 3300048913 | Bacteria | 18072 |
| 578 | Ga0496110_0001439 | 3300048913 | Bacteria | 17212 |
| 579 | Ga0496110_0148733 | 3300048913 | Bacteria | 2119 |
| 580 | Ga0496110_1290329 | 3300048913 | Bacteria | 639 |
| 581 | Ga0496111_0005865 | 3300048914 | Bacteria | 7920 |
| 582 | Ga0496111_0006191 | 3300048914 | Bacteria | 7749 |
| 583 | Ga0496111_0198510 | 3300048914 | Bacteria | 1491 |
| 584 | Ga0496111_0213186 | 3300048914 | Bacteria | 1434 |
| 585 | Ga0496112_0002066 | 3300048915 | Bacteria | 15919 |
| 586 | Ga0496112_0019496 | 3300048915 | Bacteria | 6403 |
| 587 | Ga0496112_0126841 | 3300048915 | Bacteria | 2522 |
| 588 | Ga0496112_0192675 | 3300048915 | Bacteria | 1999 |
| 589 | Ga0496113_0068732 | 3300048916 | Bacteria | 2688 |
| 590 | Ga0496113_0085245 | 3300048916 | Unclassified | 2426 |
| 591 | Ga0496113_0167417 | 3300048916 | Bacteria | 1739 |
| 592 | Ga0496114_0060481 | 3300048917 | Bacteria | 3166 |
| 593 | Ga0496114_0067365 | 3300048917 | Bacteria | 3003 |
| 594 | Ga0496114_0269161 | 3300048917 | Unclassified | 1501 |
| 595 | Ga0496114_0405911 | 3300048917 | Bacteria | 1206 |
| 596 | Ga0496115_0183612 | 3300048918 | Bacteria | 1728 |
| 597 | Ga0496115_0336407 | 3300048918 | Bacteria | 1232 |
| 598 | Ga0496115_0400705 | 3300048918 | Unclassified | 1113 |
| 599 | Ga0496115_0704442 | 3300048918 | Unclassified | 793 |
| 600 | Ga0496126_0923403 | 3300048929 | Bacteria | 660 |
| 601 | Ga0501031_0050661 | 3300049568 | Bacteria | 2705 |
| 602 | Ga0501031_0055109 | 3300049568 | Bacteria | 2591 |
| 603 | Ga0501032_0022579 | 3300049569 | Bacteria | 4360 |
| 604 | Ga0501033_0125882 | 3300049570 | Bacteria | 1858 |
| 605 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 606 | Ga0501034_0053224 | 3300049571 | Bacteria | 4077 |
| 607 | Ga0501034_0167100 | 3300049571 | Bacteria | 2168 |
| 608 | Ga0501036_0004475 | 3300049572 | Bacteria | 11297 |
| 609 | Ga0501036_0026331 | 3300049572 | Bacteria | 4908 |
| 610 | Ga0501036_0833797 | 3300049572 | Bacteria | 758 |
| 611 | Ga0501037_0025692 | 3300049573 | Bacteria | 4350 |
| 612 | Ga0501037_0086237 | 3300049573 | Bacteria | 2273 |
| 613 | Ga0501038_0010512 | 3300049574 | Bacteria | 8465 |
| 614 | Ga0501038_0202241 | 3300049574 | Bacteria | 1593 |
| 615 | Ga0501038_0342947 | 3300049574 | Unclassified | 1165 |
| 616 | Ga0501039_0030967 | 3300049575 | Bacteria | 4125 |
| 617 | Ga0501039_0708378 | 3300049575 | Bacteria | 787 |
| 618 | Ga0501040_0574537 | 3300049576 | Unclassified | 814 |
| 619 | Ga0501043_0022339 | 3300049579 | Bacteria | 4963 |
| 620 | Ga0501043_0068702 | 3300049579 | Bacteria | 2782 |
| 621 | Ga0501046_0281789 | 3300049580 | Bacteria | 1217 |
| 622 | Ga0501047_0000100 | 3300049581 | Bacteria | 105717 |
| 623 | Ga0501047_0040658 | 3300049581 | Bacteria | 4496 |
| 624 | Ga0501048_0000083 | 3300049582 | Bacteria | 49621 |
| 625 | Ga0501068_0368335 | 3300049584 | Bacteria | 924 |
| 626 | Ga0501069_0248815 | 3300049585 | Bacteria | 1037 |
| 627 | Ga0501070_0009312 | 3300049586 | Bacteria | 8307 |
| 628 | Ga0501070_0439238 | 3300049586 | Bacteria | 1053 |
| 629 | Ga0501070_1039113 | 3300049586 | Unclassified | 634 |
| 630 | Ga0501071_0084581 | 3300049587 | Bacteria | 2325 |
| 631 | Ga0501073_0085335 | 3300049589 | Bacteria | 2197 |
| 632 | Ga0501073_0129310 | 3300049589 | Bacteria | 1750 |
| 633 | Ga0501074_0048380 | 3300049590 | Bacteria | 3072 |
| 634 | Ga0501074_0064991 | 3300049590 | Bacteria | 2626 |
| 635 | Ga0501075_0027790 | 3300049591 | Bacteria | 4171 |
| 636 | Ga0501076_0011514 | 3300049592 | Bacteria | 6593 |
| 637 | Ga0501076_0477887 | 3300049592 | Unclassified | 1027 |
| 638 | Ga0501077_0232710 | 3300049593 | Unclassified | 1171 |
| 639 | Ga0501079_0086821 | 3300049741 | Bacteria | 2421 |
| 640 | Ga0501080_0000030 | 3300049742 | Bacteria | 87736 |
| 641 | Ga0501080_0003855 | 3300049742 | Bacteria | 13252 |
| 642 | Ga0501080_0003899 | 3300049742 | Bacteria | 13209 |
| 643 | Ga0501080_1035702 | 3300049742 | Bacteria | 711 |
| 644 | Ga0501083_0022286 | 3300049744 | Bacteria | 4395 |
| 645 | Ga0501083_0272399 | 3300049744 | Bacteria | 1101 |
| 646 | Ga0501035_0211044 | 3300049822 | Bacteria | 1661 |
| 647 | Ga0501044_0000587 | 3300049823 | Bacteria | 44137 |
| 648 | Ga0501044_0017933 | 3300049823 | Bacteria | 7591 |
| 649 | Ga0501044_1408195 | 3300049823 | Bacteria | 563 |
| 650 | nmdc:mga03n38_359880_c1 | 3300050490 | Bacteria | 793 |
| 651 | nmdc:mga07m45_228300_c2 | 3300050496 | Unclassified | 670 |
| 652 | nmdc:mga05p37_928_c1 | 3300050507 | Bacteria | 33059 |
| 653 | nmdc:mga09592_38098_c1 | 3300050508 | Bacteria | 4035 |
| 654 | nmdc:mga0qj67_32315_c1 | 3300050509 | Bacteria | 4080 |
| 655 | nmdc:mga06r32_795_c1 | 3300050510 | Bacteria | 27918 |
| 656 | nmdc:mga08y16_2587_c1 | 3300050511 | Bacteria | 18610 |
| 657 | nmdc:mga0n895_169692_c1 | 3300050512 | Bacteria | 2214 |
| 658 | nmdc:mga0n895_342855_c1 | 3300050512 | Bacteria | 1513 |
| 659 | nmdc:mga0n895_385564_c1 | 3300050512 | Bacteria | 1418 |
| 660 | nmdc:mga0n895_94584_c1 | 3300050512 | Bacteria | 2992 |
| 661 | nmdc:mga0rr50_12010_c1 | 3300050513 | Bacteria | 5575 |
| 662 | nmdc:mga0rr50_139729_c1 | 3300050513 | Bacteria | 1947 |
| 663 | nmdc:mga08x19_188283_c1 | 3300050514 | Bacteria | 1411 |
| 664 | nmdc:mga0a205_388535_c1 | 3300050515 | Bacteria | 1260 |
| 665 | Ga0495601_0000489 | 3300053077 | Bacteria | 20787 |
| 666 | Ga0495601_0000886 | 3300053077 | Bacteria | 16328 |
| 667 | Ga0495601_0024445 | 3300053077 | Bacteria | 3720 |
| 668 | Ga0495612_0003322 | 3300053078 | Bacteria | 6669 |
| 669 | Ga0495612_0004147 | 3300053078 | Bacteria | 6003 |
| 670 | Ga0495612_0094419 | 3300053078 | Bacteria | 1269 |
| 671 | Ga0495595_0005839 | 3300053084 | Bacteria | 4986 |
| 672 | Ga0495595_0397820 | 3300053084 | Bacteria | 698 |
| 673 | Ga0495619_0000918 | 3300053085 | Bacteria | 19328 |
| 674 | Ga0495619_0036833 | 3300053085 | Bacteria | 3187 |
| 675 | Ga0495619_0209324 | 3300053085 | Bacteria | 1350 |
| 676 | Ga0495619_0287657 | 3300053085 | Bacteria | 1139 |
| 677 | Ga0500566_0077295 | 3300053094 | Bacteria | 1859 |
| 678 | Ga0500642_0245807 | 3300053130 | Bacteria | 823 |
| 679 | Ga0500652_085912 | 3300053131 | Bacteria | 1312 |
| 680 | Ga0501084_0177788 | 3300054114 | Unclassified | 1796 |
| 681 | Ga0501084_1270286 | 3300054114 | Unclassified | 617 |
| 682 | Ga0501082_0099629 | 3300060353 | Bacteria | 2513 |
| 683 | Ga0501082_0105261 | 3300060353 | Bacteria | 2441 |
| 684 | Ga0501082_0391088 | 3300060353 | Bacteria | 1213 |
| 685 | Ga0501082_0590491 | 3300060353 | Bacteria | 972 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049742 | Ga0501080_1035702 | Ga0501080_1035702_389_649 | 77 |
| 2 | 3300020069 | Ga0197907_11230264 | Ga0197907_112302641 | 84 |
| 3 | 3300046475 | Ga0495639_0196684 | Ga0495639_0196684_336_626 | 86 |
| 4 | 3300003215 | JGI25153J46596_10000711 | JGI25153J46596_1000071114 | 87 |
| 5 | 3300005295 | Ga0065707_10543569 | Ga0065707_105435691 | 87 |
| 6 | 3300005328 | Ga0070676_10694783 | Ga0070676_106947831 | 87 |
| 7 | 3300005353 | Ga0070669_100967319 | Ga0070669_1009673192 | 87 |
| 8 | 3300005458 | Ga0070681_11996703 | Ga0070681_119967031 | 87 |
| 9 | 3300005719 | Ga0068861_101625783 | Ga0068861_1016257831 | 87 |
| 10 | 3300006175 | Ga0070712_101540531 | Ga0070712_1015405312 | 87 |
| 11 | 3300006353 | Ga0075370_10470580 | Ga0075370_104705802 | 87 |
| 12 | 3300006353 | Ga0075370_10595282 | Ga0075370_105952821 | 87 |
| 13 | 3300006844 | Ga0075428_100002840 | Ga0075428_1000028403 | 87 |
| 14 | 3300006844 | Ga0075428_102131069 | Ga0075428_1021310691 | 87 |
| 15 | 3300006846 | Ga0075430_100094409 | Ga0075430_1000944092 | 87 |
| 16 | 3300006847 | Ga0075431_100001610 | Ga0075431_1000016103 | 87 |
| 17 | 3300006880 | Ga0075429_100090555 | Ga0075429_1000905552 | 87 |
| 18 | 3300009094 | Ga0111539_10003049 | Ga0111539_100030493 | 87 |
| 19 | 3300009147 | Ga0114129_10001163 | Ga0114129_100011633 | 87 |
| 20 | 3300014326 | Ga0157380_12533079 | Ga0157380_125330791 | 87 |
| 21 | 3300025297 | Ga0209758_1000373 | Ga0209758_100037346 | 87 |
| 22 | 3300025302 | Ga0207426_1139105 | Ga0207426_11391052 | 87 |
| 23 | 3300025907 | Ga0207645_10357608 | Ga0207645_103576082 | 87 |
| 24 | 3300025915 | Ga0207693_10451968 | Ga0207693_104519682 | 87 |
| 25 | 3300025918 | Ga0207662_11192377 | Ga0207662_111923772 | 87 |
| 26 | 3300025986 | Ga0207658_11219868 | Ga0207658_112198682 | 87 |
| 27 | 3300026118 | Ga0207675_101621546 | Ga0207675_1016215462 | 87 |
| 28 | 3300027907 | Ga0207428_10005326 | Ga0207428_1000532614 | 87 |
| 29 | 3300035083 | Ga0373926_0117565 | Ga0373926_0117565_560_853 | 87 |
| 30 | 3300035113 | Ga0373936_0102318 | Ga0373936_0102318_749_1042 | 87 |
| 31 | 3300035116 | Ga0373945_0055860 | Ga0373945_0055860_334_627 | 87 |
| 32 | 3300035170 | Ga0373943_0018338 | Ga0373943_0018338_965_1258 | 87 |
| 33 | 3300035171 | Ga0373946_0001037 | Ga0373946_0001037_5769_6062 | 87 |
| 34 | 3300035410 | Ga0373924_0053467 | Ga0373924_0053467_118_411 | 87 |
| 35 | 3300035692 | Ga0373935_0014243 | Ga0373935_0014243_47_340 | 87 |
| 36 | 3300035695 | Ga0373927_0000892 | Ga0373927_0000892_4593_4886 | 87 |
| 37 | 3300035725 | Ga0373947_0000629 | Ga0373947_0000629_7339_7632 | 87 |
| 38 | 3300037068 | Ga0373925_0003681 | Ga0373925_0003681_10217_10510 | 87 |
| 39 | 3300037466 | Ga0395898_0324414 | Ga0395898_0324414_47_340 | 87 |
| 40 | 3300038443 | Ga0395901_0079286 | Ga0395901_0079286_1487_1780 | 87 |
| 41 | 3300042439 | Ga0439464_0076514 | Ga0439464_0076514_261_554 | 87 |
| 42 | 3300046459 | Ga0495629_0844630 | Ga0495629_0844630_118_411 | 87 |
| 43 | 3300046472 | Ga0495580_0053925 | Ga0495580_0053925_1263_1556 | 87 |
| 44 | 3300046517 | Ga0495630_0014775 | Ga0495630_0014775_1077_1370 | 87 |
| 45 | 3300046526 | Ga0495666_0153262 | Ga0495666_0153262_150_443 | 87 |
| 46 | 3300046529 | Ga0495652_0106455 | Ga0495652_0106455_1795_2088 | 87 |
| 47 | 3300046531 | Ga0495665_0085230 | Ga0495665_0085230_1230_1523 | 87 |
| 48 | 3300046533 | Ga0495640_0108868 | Ga0495640_0108868_1424_1717 | 87 |
| 49 | 3300046642 | Ga0495634_0208915 | Ga0495634_0208915_106_399 | 87 |
| 50 | 3300046663 | Ga0495635_1077575 | Ga0495635_1077575_187_480 | 87 |
| 51 | 3300046681 | Ga0495647_0037492 | Ga0495647_0037492_506_799 | 87 |
| 52 | 3300046683 | Ga0495658_0260796 | Ga0495658_0260796_355_648 | 87 |
| 53 | 3300046689 | Ga0495613_0024550 | Ga0495613_0024550_1566_1859 | 87 |
| 54 | 3300046690 | Ga0495624_0003037 | Ga0495624_0003037_5054_5347 | 87 |
| 55 | 3300047315 | Ga0495581_0008625 | Ga0495581_0008625_967_1260 | 87 |
| 56 | 3300047471 | Ga0495684_0035642 | Ga0495684_0035642_2057_2350 | 87 |
| 57 | 3300047673 | Ga0495593_0010234 | Ga0495593_0010234_1651_1944 | 87 |
| 58 | 3300048929 | Ga0496126_0923403 | Ga0496126_0923403_122_415 | 87 |
| 59 | 3300050490 | nmdc:mga03n38_359880_c1 | nmdc:mga03n38_359880_c1_307_600 | 87 |
| 60 | 3300050496 | nmdc:mga07m45_228300_c2 | nmdc:mga07m45_228300_c2_342_635 | 87 |
| 61 | 3300050507 | nmdc:mga05p37_928_c1 | nmdc:mga05p37_928_c1_1605_1898 | 87 |
| 62 | 3300050508 | nmdc:mga09592_38098_c1 | nmdc:mga09592_38098_c1_2643_2936 | 87 |
| 63 | 3300050509 | nmdc:mga0qj67_32315_c1 | nmdc:mga0qj67_32315_c1_2201_2494 | 87 |
| 64 | 3300050510 | nmdc:mga06r32_795_c1 | nmdc:mga06r32_795_c1_1585_1878 | 87 |
| 65 | 3300050511 | nmdc:mga08y16_2587_c1 | nmdc:mga08y16_2587_c1_16713_17006 | 87 |
| 66 | 3300053085 | Ga0495619_0036833 | Ga0495619_0036833_706_999 | 87 |
| 67 | 3300053130 | Ga0500642_0245807 | Ga0500642_0245807_412_705 | 87 |
| 68 | 3300053131 | Ga0500652_085912 | Ga0500652_085912_561_854 | 87 |
| 69 | 3300060353 | Ga0501082_0590491 | Ga0501082_0590491_158_457 | 87 |
| 70 | 3300005458 | Ga0070681_10592365 | Ga0070681_105923652 | 88 |
| 71 | 3300005530 | Ga0070679_100161661 | Ga0070679_1001616612 | 88 |
| 72 | 3300005616 | Ga0068852_100766955 | Ga0068852_1007669552 | 88 |
| 73 | 3300005937 | Ga0081455_10115039 | Ga0081455_101150393 | 88 |
| 74 | 3300013105 | Ga0157369_12374675 | Ga0157369_123746752 | 88 |
| 75 | 3300025912 | Ga0207707_11166412 | Ga0207707_111664122 | 88 |
| 76 | 3300025921 | Ga0207652_10439677 | Ga0207652_104396772 | 88 |
| 77 | 3300025936 | Ga0207670_11601493 | Ga0207670_116014931 | 88 |
| 78 | 3300025949 | Ga0207667_11605900 | Ga0207667_116059002 | 88 |
| 79 | 3300031901 | Ga0307406_10662292 | Ga0307406_106622921 | 88 |
| 80 | 3300032002 | Ga0307416_101619248 | Ga0307416_1016192481 | 88 |
| 81 | 3300035692 | Ga0373935_0359194 | Ga0373935_0359194_273_569 | 88 |
| 82 | 3300035725 | Ga0373947_1125483 | Ga0373947_1125483_15_311 | 88 |
| 83 | 3300035725 | Ga0373947_1267644 | Ga0373947_1267644_67_363 | 88 |
| 84 | 3300045836 | Ga0466958_0591265 | Ga0466958_0591265_122_418 | 88 |
| 85 | 3300048908 | Ga0496105_0005879 | Ga0496105_0005879_250_546 | 88 |
| 86 | 3300048911 | Ga0496108_0170760 | Ga0496108_0170760_1260_1556 | 88 |
| 87 | 3300048912 | Ga0496109_0075548 | Ga0496109_0075548_2548_2844 | 88 |
| 88 | 3300048913 | Ga0496110_1290329 | Ga0496110_1290329_245_541 | 88 |
| 89 | 3300049569 | Ga0501032_0022579 | Ga0501032_0022579_2310_2606 | 88 |
| 90 | 3300049571 | Ga0501034_0000032 | Ga0501034_0000032_49235_49531 | 88 |
| 91 | 3300049571 | Ga0501034_0167100 | Ga0501034_0167100_793_1089 | 88 |
| 92 | 3300049572 | Ga0501036_0004475 | Ga0501036_0004475_843_1139 | 88 |
| 93 | 3300049572 | Ga0501036_0833797 | Ga0501036_0833797_43_339 | 88 |
| 94 | 3300049573 | Ga0501037_0025692 | Ga0501037_0025692_3354_3650 | 88 |
| 95 | 3300049574 | Ga0501038_0202241 | Ga0501038_0202241_426_722 | 88 |
| 96 | 3300049575 | Ga0501039_0030967 | Ga0501039_0030967_345_641 | 88 |
| 97 | 3300049579 | Ga0501043_0022339 | Ga0501043_0022339_3922_4218 | 88 |
| 98 | 3300049580 | Ga0501046_0281789 | Ga0501046_0281789_336_632 | 88 |
| 99 | 3300049581 | Ga0501047_0000100 | Ga0501047_0000100_39744_40040 | 88 |
| 100 | 3300049582 | Ga0501048_0000083 | Ga0501048_0000083_38717_39013 | 88 |
| 101 | 3300049584 | Ga0501068_0368335 | Ga0501068_0368335_185_481 | 88 |
| 102 | 3300049586 | Ga0501070_0009312 | Ga0501070_0009312_2369_2665 | 88 |
| 103 | 3300049586 | Ga0501070_0439238 | Ga0501070_0439238_507_803 | 88 |
| 104 | 3300049589 | Ga0501073_0085335 | Ga0501073_0085335_264_560 | 88 |
| 105 | 3300049590 | Ga0501074_0064991 | Ga0501074_0064991_1006_1302 | 88 |
| 106 | 3300049742 | Ga0501080_0000030 | Ga0501080_0000030_48598_48894 | 88 |
| 107 | 3300049744 | Ga0501083_0022286 | Ga0501083_0022286_118_414 | 88 |
| 108 | 3300049744 | Ga0501083_0272399 | Ga0501083_0272399_703_999 | 88 |
| 109 | 3300049823 | Ga0501044_0000587 | Ga0501044_0000587_29757_30053 | 88 |
| 110 | 3300049823 | Ga0501044_1408195 | Ga0501044_1408195_188_484 | 88 |
| 111 | 3300060353 | Ga0501082_0105261 | Ga0501082_0105261_542_838 | 88 |
| 112 | 3300001990 | JGI24737J22298_10083048 | JGI24737J22298_100830482 | 89 |
| 113 | 3300001991 | JGI24743J22301_10025535 | JGI24743J22301_100255352 | 89 |
| 114 | 3300002070 | JGI24750J21931_1001341 | JGI24750J21931_10013413 | 89 |
| 115 | 3300002075 | JGI24738J21930_10062502 | JGI24738J21930_100625022 | 89 |
| 116 | 3300002076 | JGI24749J21850_1034635 | JGI24749J21850_10346351 | 89 |
| 117 | 3300002077 | JGI24744J21845_10025982 | JGI24744J21845_100259822 | 89 |
| 118 | 3300002239 | JGI24034J26672_10015667 | JGI24034J26672_100156672 | 89 |
| 119 | 3300002244 | JGI24742J22300_10001929 | JGI24742J22300_100019292 | 89 |
| 120 | 3300002459 | JGI24751J29686_10014846 | JGI24751J29686_100148462 | 89 |
| 121 | 3300003659 | JGI25404J52841_10064658 | JGI25404J52841_100646582 | 89 |
| 122 | 3300005328 | Ga0070676_11339488 | Ga0070676_113394881 | 89 |
| 123 | 3300005329 | Ga0070683_100115805 | Ga0070683_1001158053 | 89 |
| 124 | 3300005329 | Ga0070683_100205026 | Ga0070683_1002050263 | 89 |
| 125 | 3300005330 | Ga0070690_100050605 | Ga0070690_1000506052 | 89 |
| 126 | 3300005335 | Ga0070666_10129280 | Ga0070666_101292802 | 89 |
| 127 | 3300005336 | Ga0070680_100148475 | Ga0070680_1001484753 | 89 |
| 128 | 3300005336 | Ga0070680_102019077 | Ga0070680_1020190772 | 89 |
| 129 | 3300005338 | Ga0068868_100173786 | Ga0068868_1001737862 | 89 |
| 130 | 3300005339 | Ga0070660_101136214 | Ga0070660_1011362142 | 89 |
| 131 | 3300005341 | Ga0070691_10034543 | Ga0070691_100345432 | 89 |
| 132 | 3300005343 | Ga0070687_100064706 | Ga0070687_1000647062 | 89 |
| 133 | 3300005344 | Ga0070661_100222692 | Ga0070661_1002226922 | 89 |
| 134 | 3300005345 | Ga0070692_10038798 | Ga0070692_100387982 | 89 |
| 135 | 3300005347 | Ga0070668_100087445 | Ga0070668_1000874452 | 89 |
| 136 | 3300005353 | Ga0070669_100463089 | Ga0070669_1004630892 | 89 |
| 137 | 3300005354 | Ga0070675_100221317 | Ga0070675_1002213172 | 89 |
| 138 | 3300005355 | Ga0070671_100177396 | Ga0070671_1001773962 | 89 |
| 139 | 3300005356 | Ga0070674_100575308 | Ga0070674_1005753082 | 89 |
| 140 | 3300005364 | Ga0070673_100051409 | Ga0070673_1000514091 | 89 |
| 141 | 3300005364 | Ga0070673_101388442 | Ga0070673_1013884422 | 89 |
| 142 | 3300005365 | Ga0070688_100019755 | Ga0070688_1000197553 | 89 |
| 143 | 3300005366 | Ga0070659_100274381 | Ga0070659_1002743812 | 89 |
| 144 | 3300005367 | Ga0070667_100760484 | Ga0070667_1007604842 | 89 |
| 145 | 3300005406 | Ga0070703_10319443 | Ga0070703_103194431 | 89 |
| 146 | 3300005435 | Ga0070714_100351433 | Ga0070714_1003514332 | 89 |
| 147 | 3300005436 | Ga0070713_100434942 | Ga0070713_1004349422 | 89 |
| 148 | 3300005436 | Ga0070713_101218970 | Ga0070713_1012189702 | 89 |
| 149 | 3300005437 | Ga0070710_10269330 | Ga0070710_102693303 | 89 |
| 150 | 3300005439 | Ga0070711_100829849 | Ga0070711_1008298492 | 89 |
| 151 | 3300005440 | Ga0070705_100460808 | Ga0070705_1004608081 | 89 |
| 152 | 3300005441 | Ga0070700_100157106 | Ga0070700_1001571062 | 89 |
| 153 | 3300005444 | Ga0070694_100133382 | Ga0070694_1001333823 | 89 |
| 154 | 3300005444 | Ga0070694_101490107 | Ga0070694_1014901072 | 89 |
| 155 | 3300005445 | Ga0070708_101890748 | Ga0070708_1018907481 | 89 |
| 156 | 3300005455 | Ga0070663_100337562 | Ga0070663_1003375622 | 89 |
| 157 | 3300005456 | Ga0070678_100189872 | Ga0070678_1001898722 | 89 |
| 158 | 3300005457 | Ga0070662_100037565 | Ga0070662_1000375652 | 89 |
| 159 | 3300005459 | Ga0068867_100041718 | Ga0068867_1000417183 | 89 |
| 160 | 3300005530 | Ga0070679_100604774 | Ga0070679_1006047742 | 89 |
| 161 | 3300005530 | Ga0070679_100978525 | Ga0070679_1009785252 | 89 |
| 162 | 3300005535 | Ga0070684_100126352 | Ga0070684_1001263523 | 89 |
| 163 | 3300005535 | Ga0070684_100165924 | Ga0070684_1001659242 | 89 |
| 164 | 3300005539 | Ga0068853_100600650 | Ga0068853_1006006502 | 89 |
| 165 | 3300005543 | Ga0070672_100151698 | Ga0070672_1001516982 | 89 |
| 166 | 3300005544 | Ga0070686_100287153 | Ga0070686_1002871532 | 89 |
| 167 | 3300005544 | Ga0070686_100448579 | Ga0070686_1004485791 | 89 |
| 168 | 3300005546 | Ga0070696_100011790 | Ga0070696_1000117906 | 89 |
| 169 | 3300005546 | Ga0070696_101249308 | Ga0070696_1012493081 | 89 |
| 170 | 3300005547 | Ga0070693_100205167 | Ga0070693_1002051672 | 89 |
| 171 | 3300005547 | Ga0070693_101458945 | Ga0070693_1014589451 | 89 |
| 172 | 3300005548 | Ga0070665_100210003 | Ga0070665_1002100033 | 89 |
| 173 | 3300005549 | Ga0070704_100003037 | Ga0070704_1000030375 | 89 |
| 174 | 3300005563 | Ga0068855_100157074 | Ga0068855_1001570745 | 89 |
| 175 | 3300005563 | Ga0068855_100546820 | Ga0068855_1005468201 | 89 |
| 176 | 3300005564 | Ga0070664_100289865 | Ga0070664_1002898652 | 89 |
| 177 | 3300005578 | Ga0068854_100071551 | Ga0068854_1000715512 | 89 |
| 178 | 3300005614 | Ga0068856_100548702 | Ga0068856_1005487022 | 89 |
| 179 | 3300005616 | Ga0068852_100777694 | Ga0068852_1007776942 | 89 |
| 180 | 3300005617 | Ga0068859_100077463 | Ga0068859_1000774633 | 89 |
| 181 | 3300005618 | Ga0068864_100005603 | Ga0068864_1000056032 | 89 |
| 182 | 3300005718 | Ga0068866_10048175 | Ga0068866_100481752 | 89 |
| 183 | 3300005719 | Ga0068861_100329960 | Ga0068861_1003299601 | 89 |
| 184 | 3300005834 | Ga0068851_10049054 | Ga0068851_100490542 | 89 |
| 185 | 3300005840 | Ga0068870_10125530 | Ga0068870_101255302 | 89 |
| 186 | 3300005841 | Ga0068863_100090051 | Ga0068863_1000900513 | 89 |
| 187 | 3300005842 | Ga0068858_100124350 | Ga0068858_1001243503 | 89 |
| 188 | 3300005843 | Ga0068860_100056993 | Ga0068860_1000569933 | 89 |
| 189 | 3300005844 | Ga0068862_100123793 | Ga0068862_1001237931 | 89 |
| 190 | 3300005844 | Ga0068862_100599485 | Ga0068862_1005994852 | 89 |
| 191 | 3300005983 | Ga0081540_1000008 | Ga0081540_1000008144 | 89 |
| 192 | 3300006028 | Ga0070717_11550002 | Ga0070717_115500022 | 89 |
| 193 | 3300006028 | Ga0070717_12148950 | Ga0070717_121489501 | 89 |
| 194 | 3300006038 | Ga0075365_10444672 | Ga0075365_104446722 | 89 |
| 195 | 3300006163 | Ga0070715_10154817 | Ga0070715_101548171 | 89 |
| 196 | 3300006163 | Ga0070715_10483732 | Ga0070715_104837322 | 89 |
| 197 | 3300006173 | Ga0070716_100420967 | Ga0070716_1004209672 | 89 |
| 198 | 3300006175 | Ga0070712_100036653 | Ga0070712_1000366533 | 89 |
| 199 | 3300006175 | Ga0070712_100796922 | Ga0070712_1007969222 | 89 |
| 200 | 3300006237 | Ga0097621_100239229 | Ga0097621_1002392293 | 89 |
| 201 | 3300006358 | Ga0068871_100575992 | Ga0068871_1005759922 | 89 |
| 202 | 3300006852 | Ga0075433_10128386 | Ga0075433_101283863 | 89 |
| 203 | 3300006852 | Ga0075433_11172471 | Ga0075433_111724711 | 89 |
| 204 | 3300006871 | Ga0075434_100118738 | Ga0075434_1001187383 | 89 |
| 205 | 3300006871 | Ga0075434_100168202 | Ga0075434_1001682021 | 89 |
| 206 | 3300006871 | Ga0075434_100381912 | Ga0075434_1003819123 | 89 |
| 207 | 3300006881 | Ga0068865_100073958 | Ga0068865_1000739583 | 89 |
| 208 | 3300006931 | Ga0097620_100077464 | Ga0097620_1000774643 | 89 |
| 209 | 3300007076 | Ga0075435_100004091 | Ga0075435_10000409110 | 89 |
| 210 | 3300009093 | Ga0105240_11185402 | Ga0105240_111854021 | 89 |
| 211 | 3300009101 | Ga0105247_10184604 | Ga0105247_101846041 | 89 |
| 212 | 3300009174 | Ga0105241_10067576 | Ga0105241_100675764 | 89 |
| 213 | 3300009174 | Ga0105241_10112609 | Ga0105241_101126093 | 89 |
| 214 | 3300009174 | Ga0105241_11355790 | Ga0105241_113557902 | 89 |
| 215 | 3300009176 | Ga0105242_10424632 | Ga0105242_104246322 | 89 |
| 216 | 3300009177 | Ga0105248_10247838 | Ga0105248_102478382 | 89 |
| 217 | 3300009177 | Ga0105248_11265892 | Ga0105248_112658922 | 89 |
| 218 | 3300009545 | Ga0105237_11561853 | Ga0105237_115618532 | 89 |
| 219 | 3300009545 | Ga0105237_12266513 | Ga0105237_122665132 | 89 |
| 220 | 3300009551 | Ga0105238_10311325 | Ga0105238_103113252 | 89 |
| 221 | 3300009551 | Ga0105238_11170507 | Ga0105238_111705071 | 89 |
| 222 | 3300009553 | Ga0105249_10000905 | Ga0105249_100009057 | 89 |
| 223 | 3300009553 | Ga0105249_10507336 | Ga0105249_105073361 | 89 |
| 224 | 3300010375 | Ga0105239_10220786 | Ga0105239_102207861 | 89 |
| 225 | 3300011119 | Ga0105246_10187076 | Ga0105246_101870762 | 89 |
| 226 | 3300013296 | Ga0157374_11002813 | Ga0157374_110028132 | 89 |
| 227 | 3300013297 | Ga0157378_10053607 | Ga0157378_100536073 | 89 |
| 228 | 3300013306 | Ga0163162_10217253 | Ga0163162_102172532 | 89 |
| 229 | 3300013306 | Ga0163162_10605755 | Ga0163162_106057552 | 89 |
| 230 | 3300013308 | Ga0157375_11418558 | Ga0157375_114185581 | 89 |
| 231 | 3300014325 | Ga0163163_10056522 | Ga0163163_100565224 | 89 |
| 232 | 3300014326 | Ga0157380_10363205 | Ga0157380_103632051 | 89 |
| 233 | 3300014745 | Ga0157377_10018475 | Ga0157377_100184753 | 89 |
| 234 | 3300014968 | Ga0157379_10171571 | Ga0157379_101715713 | 89 |
| 235 | 3300014969 | Ga0157376_10277065 | Ga0157376_102770653 | 89 |
| 236 | 3300014969 | Ga0157376_11512421 | Ga0157376_115124211 | 89 |
| 237 | 3300017792 | Ga0163161_11205958 | Ga0163161_112059582 | 89 |
| 238 | 3300025321 | Ga0207656_10229552 | Ga0207656_102295522 | 89 |
| 239 | 3300025893 | Ga0207682_10114400 | Ga0207682_101144002 | 89 |
| 240 | 3300025898 | Ga0207692_10183794 | Ga0207692_101837942 | 89 |
| 241 | 3300025899 | Ga0207642_10239780 | Ga0207642_102397801 | 89 |
| 242 | 3300025900 | Ga0207710_10020902 | Ga0207710_100209022 | 89 |
| 243 | 3300025901 | Ga0207688_10002291 | Ga0207688_100022913 | 89 |
| 244 | 3300025903 | Ga0207680_10161096 | Ga0207680_101610962 | 89 |
| 245 | 3300025904 | Ga0207647_10023557 | Ga0207647_100235573 | 89 |
| 246 | 3300025905 | Ga0207685_10036859 | Ga0207685_100368592 | 89 |
| 247 | 3300025905 | Ga0207685_10495790 | Ga0207685_104957901 | 89 |
| 248 | 3300025907 | Ga0207645_10062167 | Ga0207645_100621674 | 89 |
| 249 | 3300025908 | Ga0207643_10024520 | Ga0207643_100245203 | 89 |
| 250 | 3300025911 | Ga0207654_10033105 | Ga0207654_100331054 | 89 |
| 251 | 3300025914 | Ga0207671_11472425 | Ga0207671_114724251 | 89 |
| 252 | 3300025915 | Ga0207693_10047415 | Ga0207693_100474154 | 89 |
| 253 | 3300025915 | Ga0207693_10128967 | Ga0207693_101289673 | 89 |
| 254 | 3300025915 | Ga0207693_10877279 | Ga0207693_108772791 | 89 |
| 255 | 3300025916 | Ga0207663_11596646 | Ga0207663_115966461 | 89 |
| 256 | 3300025917 | Ga0207660_10212170 | Ga0207660_102121702 | 89 |
| 257 | 3300025917 | Ga0207660_11308975 | Ga0207660_113089751 | 89 |
| 258 | 3300025918 | Ga0207662_10003397 | Ga0207662_100033973 | 89 |
| 259 | 3300025919 | Ga0207657_10048757 | Ga0207657_100487576 | 89 |
| 260 | 3300025920 | Ga0207649_10567042 | Ga0207649_105670421 | 89 |
| 261 | 3300025924 | Ga0207694_10485853 | Ga0207694_104858532 | 89 |
| 262 | 3300025924 | Ga0207694_11465133 | Ga0207694_114651332 | 89 |
| 263 | 3300025927 | Ga0207687_10873675 | Ga0207687_108736752 | 89 |
| 264 | 3300025928 | Ga0207700_10472414 | Ga0207700_104724142 | 89 |
| 265 | 3300025929 | Ga0207664_11124598 | Ga0207664_111245981 | 89 |
| 266 | 3300025932 | Ga0207690_10538355 | Ga0207690_105383552 | 89 |
| 267 | 3300025933 | Ga0207706_10074129 | Ga0207706_100741291 | 89 |
| 268 | 3300025934 | Ga0207686_10118332 | Ga0207686_101183323 | 89 |
| 269 | 3300025935 | Ga0207709_10359365 | Ga0207709_103593651 | 89 |
| 270 | 3300025935 | Ga0207709_11059281 | Ga0207709_110592812 | 89 |
| 271 | 3300025936 | Ga0207670_10104197 | Ga0207670_101041973 | 89 |
| 272 | 3300025937 | Ga0207669_10028791 | Ga0207669_100287912 | 89 |
| 273 | 3300025938 | Ga0207704_10047933 | Ga0207704_100479332 | 89 |
| 274 | 3300025939 | Ga0207665_10055173 | Ga0207665_100551732 | 89 |
| 275 | 3300025940 | Ga0207691_10015850 | Ga0207691_100158502 | 89 |
| 276 | 3300025941 | Ga0207711_10273311 | Ga0207711_102733112 | 89 |
| 277 | 3300025942 | Ga0207689_10113511 | Ga0207689_101135112 | 89 |
| 278 | 3300025944 | Ga0207661_10555000 | Ga0207661_105550002 | 89 |
| 279 | 3300025945 | Ga0207679_10265519 | Ga0207679_102655192 | 89 |
| 280 | 3300025949 | Ga0207667_10050154 | Ga0207667_100501546 | 89 |
| 281 | 3300025960 | Ga0207651_10024143 | Ga0207651_100241433 | 89 |
| 282 | 3300025960 | Ga0207651_11172561 | Ga0207651_111725612 | 89 |
| 283 | 3300025961 | Ga0207712_10004862 | Ga0207712_100048627 | 89 |
| 284 | 3300025961 | Ga0207712_10121746 | Ga0207712_101217462 | 89 |
| 285 | 3300025972 | Ga0207668_10115721 | Ga0207668_101157212 | 89 |
| 286 | 3300025972 | Ga0207668_10529973 | Ga0207668_105299732 | 89 |
| 287 | 3300025981 | Ga0207640_10722042 | Ga0207640_107220422 | 89 |
| 288 | 3300025986 | Ga0207658_10278849 | Ga0207658_102788492 | 89 |
| 289 | 3300026023 | Ga0207677_10055397 | Ga0207677_100553973 | 89 |
| 290 | 3300026023 | Ga0207677_11425546 | Ga0207677_114255462 | 89 |
| 291 | 3300026035 | Ga0207703_10012740 | Ga0207703_100127407 | 89 |
| 292 | 3300026041 | Ga0207639_10367285 | Ga0207639_103672852 | 89 |
| 293 | 3300026067 | Ga0207678_10038146 | Ga0207678_100381463 | 89 |
| 294 | 3300026075 | Ga0207708_10030243 | Ga0207708_100302434 | 89 |
| 295 | 3300026078 | Ga0207702_11557536 | Ga0207702_115575362 | 89 |
| 296 | 3300026088 | Ga0207641_10515635 | Ga0207641_105156352 | 89 |
| 297 | 3300026089 | Ga0207648_10012760 | Ga0207648_100127607 | 89 |
| 298 | 3300026095 | Ga0207676_10047716 | Ga0207676_100477163 | 89 |
| 299 | 3300026116 | Ga0207674_10250716 | Ga0207674_102507162 | 89 |
| 300 | 3300026118 | Ga0207675_100002876 | Ga0207675_1000028768 | 89 |
| 301 | 3300026121 | Ga0207683_10023595 | Ga0207683_100235956 | 89 |
| 302 | 3300028379 | Ga0268266_10045805 | Ga0268266_100458053 | 89 |
| 303 | 3300028380 | Ga0268265_10027056 | Ga0268265_100270563 | 89 |
| 304 | 3300028380 | Ga0268265_11191083 | Ga0268265_111910832 | 89 |
| 305 | 3300031238 | Ga0265332_10278017 | Ga0265332_102780171 | 89 |
| 306 | 3300031247 | Ga0265340_10296913 | Ga0265340_102969131 | 89 |
| 307 | 3300031249 | Ga0265339_10142168 | Ga0265339_101421682 | 89 |
| 308 | 3300031250 | Ga0265331_10071212 | Ga0265331_100712122 | 89 |
| 309 | 3300031344 | Ga0265316_10101358 | Ga0265316_101013582 | 89 |
| 310 | 3300031548 | Ga0307408_101153673 | Ga0307408_1011536732 | 89 |
| 311 | 3300031731 | Ga0307405_11497847 | Ga0307405_114978472 | 89 |
| 312 | 3300031852 | Ga0307410_10239231 | Ga0307410_102392313 | 89 |
| 313 | 3300031903 | Ga0307407_10230380 | Ga0307407_102303802 | 89 |
| 314 | 3300031995 | Ga0307409_101428041 | Ga0307409_1014280412 | 89 |
| 315 | 3300032005 | Ga0307411_10756025 | Ga0307411_107560252 | 89 |
| 316 | 3300035083 | Ga0373926_0067171 | Ga0373926_0067171_444_752 | 89 |
| 317 | 3300035091 | Ga0373951_0072830 | Ga0373951_0072830_350_649 | 89 |
| 318 | 3300035170 | Ga0373943_0308759 | Ga0373943_0308759_93_392 | 89 |
| 319 | 3300035171 | Ga0373946_0380143 | Ga0373946_0380143_195_503 | 89 |
| 320 | 3300035410 | Ga0373924_0413962 | Ga0373924_0413962_30_329 | 89 |
| 321 | 3300035692 | Ga0373935_0281159 | Ga0373935_0281159_525_833 | 89 |
| 322 | 3300035695 | Ga0373927_0072933 | Ga0373927_0072933_20_319 | 89 |
| 323 | 3300035695 | Ga0373927_0161516 | Ga0373927_0161516_91_390 | 89 |
| 324 | 3300035695 | Ga0373927_0208007 | Ga0373927_0208007_373_681 | 89 |
| 325 | 3300035725 | Ga0373947_0190914 | Ga0373947_0190914_423_722 | 89 |
| 326 | 3300035725 | Ga0373947_0639401 | Ga0373947_0639401_134_433 | 89 |
| 327 | 3300037068 | Ga0373925_0075656 | Ga0373925_0075656_498_797 | 89 |
| 328 | 3300037068 | Ga0373925_0165413 | Ga0373925_0165413_471_770 | 89 |
| 329 | 3300037068 | Ga0373925_0422570 | Ga0373925_0422570_216_524 | 89 |
| 330 | 3300037466 | Ga0395898_1979984 | Ga0395898_1979984_93_392 | 89 |
| 331 | 3300041452 | Ga0451793_0517916 | Ga0451793_0517916_55_354 | 89 |
| 332 | 3300046455 | Ga0495603_0036999 | Ga0495603_0036999_2601_2909 | 89 |
| 333 | 3300046458 | Ga0495591_073226 | Ga0495591_073226_39_338 | 89 |
| 334 | 3300046459 | Ga0495629_0967854 | Ga0495629_0967854_242_541 | 89 |
| 335 | 3300046472 | Ga0495580_0352741 | Ga0495580_0352741_119_427 | 89 |
| 336 | 3300046476 | Ga0495662_0343201 | Ga0495662_0343201_33_332 | 89 |
| 337 | 3300046477 | Ga0495664_0437337 | Ga0495664_0437337_34_333 | 89 |
| 338 | 3300046491 | Ga0495584_0133481 | Ga0495584_0133481_16_315 | 89 |
| 339 | 3300046500 | Ga0495596_0207950 | Ga0495596_0207950_333_632 | 89 |
| 340 | 3300046514 | Ga0495618_0005416 | Ga0495618_0005416_1998_2297 | 89 |
| 341 | 3300046531 | Ga0495665_0362674 | Ga0495665_0362674_130_429 | 89 |
| 342 | 3300046533 | Ga0495640_0058303 | Ga0495640_0058303_2059_2358 | 89 |
| 343 | 3300046615 | Ga0495656_0215066 | Ga0495656_0215066_48_347 | 89 |
| 344 | 3300046642 | Ga0495634_0007278 | Ga0495634_0007278_1291_1590 | 89 |
| 345 | 3300046642 | Ga0495634_0182003 | Ga0495634_0182003_582_881 | 89 |
| 346 | 3300046663 | Ga0495635_0162211 | Ga0495635_0162211_720_1019 | 89 |
| 347 | 3300046683 | Ga0495658_0971465 | Ga0495658_0971465_225_524 | 89 |
| 348 | 3300046684 | Ga0495669_0282768 | Ga0495669_0282768_58_357 | 89 |
| 349 | 3300046689 | Ga0495613_0688658 | Ga0495613_0688658_41_340 | 89 |
| 350 | 3300046689 | Ga0495613_1064924 | Ga0495613_1064924_132_431 | 89 |
| 351 | 3300046694 | Ga0495649_0059244 | Ga0495649_0059244_1417_1716 | 89 |
| 352 | 3300046794 | Ga0495589_0103827 | Ga0495589_0103827_40_339 | 89 |
| 353 | 3300047315 | Ga0495581_0055853 | Ga0495581_0055853_106_405 | 89 |
| 354 | 3300047315 | Ga0495581_0274980 | Ga0495581_0274980_254_562 | 89 |
| 355 | 3300047319 | Ga0495674_0094472 | Ga0495674_0094472_1318_1617 | 89 |
| 356 | 3300047320 | Ga0495672_0250442 | Ga0495672_0250442_64_363 | 89 |
| 357 | 3300047445 | Ga0495677_0139985 | Ga0495677_0139985_333_632 | 89 |
| 358 | 3300047470 | Ga0495681_0104800 | Ga0495681_0104800_349_648 | 89 |
| 359 | 3300047471 | Ga0495684_0489647 | Ga0495684_0489647_511_810 | 89 |
| 360 | 3300048091 | Ga0495626_0170403 | Ga0495626_0170403_260_559 | 89 |
| 361 | 3300048903 | Ga0496100_0004121 | Ga0496100_0004121_6564_6863 | 89 |
| 362 | 3300048904 | Ga0496101_0002301 | Ga0496101_0002301_10266_10565 | 89 |
| 363 | 3300048904 | Ga0496101_0174536 | Ga0496101_0174536_305_604 | 89 |
| 364 | 3300048904 | Ga0496101_0474792 | Ga0496101_0474792_523_822 | 89 |
| 365 | 3300048905 | Ga0496102_0001907 | Ga0496102_0001907_7475_7774 | 89 |
| 366 | 3300048905 | Ga0496102_0636578 | Ga0496102_0636578_229_528 | 89 |
| 367 | 3300048906 | Ga0496103_0005408 | Ga0496103_0005408_7321_7620 | 89 |
| 368 | 3300048906 | Ga0496103_0090853 | Ga0496103_0090853_1433_1732 | 89 |
| 369 | 3300048907 | Ga0496104_0003321 | Ga0496104_0003321_12992_13291 | 89 |
| 370 | 3300048907 | Ga0496104_0113207 | Ga0496104_0113207_1722_2021 | 89 |
| 371 | 3300048907 | Ga0496104_0605768 | Ga0496104_0605768_497_796 | 89 |
| 372 | 3300048908 | Ga0496105_0011008 | Ga0496105_0011008_6207_6506 | 89 |
| 373 | 3300048909 | Ga0496106_0001903 | Ga0496106_0001903_8540_8839 | 89 |
| 374 | 3300048909 | Ga0496106_0050355 | Ga0496106_0050355_1212_1511 | 89 |
| 375 | 3300048910 | Ga0496107_0000742 | Ga0496107_0000742_6455_6754 | 89 |
| 376 | 3300048910 | Ga0496107_0048198 | Ga0496107_0048198_1176_1475 | 89 |
| 377 | 3300048911 | Ga0496108_0005149 | Ga0496108_0005149_6922_7221 | 89 |
| 378 | 3300048911 | Ga0496108_0012312 | Ga0496108_0012312_766_1065 | 89 |
| 379 | 3300048912 | Ga0496109_0002185 | Ga0496109_0002185_5980_6279 | 89 |
| 380 | 3300048912 | Ga0496109_0045609 | Ga0496109_0045609_763_1062 | 89 |
| 381 | 3300048912 | Ga0496109_0087085 | Ga0496109_0087085_1153_1452 | 89 |
| 382 | 3300048913 | Ga0496110_0001267 | Ga0496110_0001267_6954_7253 | 89 |
| 383 | 3300048913 | Ga0496110_0001439 | Ga0496110_0001439_7018_7317 | 89 |
| 384 | 3300048913 | Ga0496110_0148733 | Ga0496110_0148733_1234_1533 | 89 |
| 385 | 3300048914 | Ga0496111_0005865 | Ga0496111_0005865_5495_5794 | 89 |
| 386 | 3300048914 | Ga0496111_0006191 | Ga0496111_0006191_6591_6890 | 89 |
| 387 | 3300048915 | Ga0496112_0002066 | Ga0496112_0002066_13105_13404 | 89 |
| 388 | 3300048915 | Ga0496112_0019496 | Ga0496112_0019496_4796_5095 | 89 |
| 389 | 3300048915 | Ga0496112_0126841 | Ga0496112_0126841_305_604 | 89 |
| 390 | 3300048916 | Ga0496113_0068732 | Ga0496113_0068732_1414_1713 | 89 |
| 391 | 3300048916 | Ga0496113_0085245 | Ga0496113_0085245_545_844 | 89 |
| 392 | 3300048917 | Ga0496114_0067365 | Ga0496114_0067365_672_971 | 89 |
| 393 | 3300048917 | Ga0496114_0269161 | Ga0496114_0269161_34_333 | 89 |
| 394 | 3300048917 | Ga0496114_0405911 | Ga0496114_0405911_749_1048 | 89 |
| 395 | 3300048918 | Ga0496115_0336407 | Ga0496115_0336407_250_549 | 89 |
| 396 | 3300048918 | Ga0496115_0400705 | Ga0496115_0400705_440_739 | 89 |
| 397 | 3300048918 | Ga0496115_0704442 | Ga0496115_0704442_163_462 | 89 |
| 398 | 3300049568 | Ga0501031_0050661 | Ga0501031_0050661_782_1081 | 89 |
| 399 | 3300049570 | Ga0501033_0125882 | Ga0501033_0125882_868_1167 | 89 |
| 400 | 3300049571 | Ga0501034_0053224 | Ga0501034_0053224_2770_3069 | 89 |
| 401 | 3300049572 | Ga0501036_0026331 | Ga0501036_0026331_1935_2234 | 89 |
| 402 | 3300049573 | Ga0501037_0086237 | Ga0501037_0086237_392_691 | 89 |
| 403 | 3300049574 | Ga0501038_0010512 | Ga0501038_0010512_3011_3310 | 89 |
| 404 | 3300049575 | Ga0501039_0708378 | Ga0501039_0708378_47_346 | 89 |
| 405 | 3300049579 | Ga0501043_0068702 | Ga0501043_0068702_2343_2642 | 89 |
| 406 | 3300049581 | Ga0501047_0040658 | Ga0501047_0040658_2142_2441 | 89 |
| 407 | 3300049585 | Ga0501069_0248815 | Ga0501069_0248815_93_392 | 89 |
| 408 | 3300049586 | Ga0501070_1039113 | Ga0501070_1039113_204_503 | 89 |
| 409 | 3300049589 | Ga0501073_0129310 | Ga0501073_0129310_987_1286 | 89 |
| 410 | 3300049592 | Ga0501076_0477887 | Ga0501076_0477887_565_864 | 89 |
| 411 | 3300049593 | Ga0501077_0232710 | Ga0501077_0232710_592_891 | 89 |
| 412 | 3300049742 | Ga0501080_0003899 | Ga0501080_0003899_7262_7561 | 89 |
| 413 | 3300049823 | Ga0501044_0017933 | Ga0501044_0017933_3697_3996 | 89 |
| 414 | 3300050512 | nmdc:mga0n895_169692_c1 | nmdc:mga0n895_169692_c1_1740_2042 | 89 |
| 415 | 3300050512 | nmdc:mga0n895_342855_c1 | nmdc:mga0n895_342855_c1_660_959 | 89 |
| 416 | 3300050513 | nmdc:mga0rr50_12010_c1 | nmdc:mga0rr50_12010_c1_4595_4897 | 89 |
| 417 | 3300050515 | nmdc:mga0a205_388535_c1 | nmdc:mga0a205_388535_c1_830_1132 | 89 |
| 418 | 3300053077 | Ga0495601_0000886 | Ga0495601_0000886_463_762 | 89 |
| 419 | 3300053078 | Ga0495612_0094419 | Ga0495612_0094419_567_866 | 89 |
| 420 | 3300053085 | Ga0495619_0209324 | Ga0495619_0209324_166_465 | 89 |
| 421 | 3300053085 | Ga0495619_0287657 | Ga0495619_0287657_138_437 | 89 |
| 422 | 3300060353 | Ga0501082_0099629 | Ga0501082_0099629_1089_1388 | 89 |
| 423 | 2209111006 | 2214881028 | 2213933136 | 90 |
| 424 | 3300003911 | JGI25405J52794_10004873 | JGI25405J52794_100048733 | 90 |
| 425 | 3300005328 | Ga0070676_10567433 | Ga0070676_105674331 | 90 |
| 426 | 3300005331 | Ga0070670_100596065 | Ga0070670_1005960652 | 90 |
| 427 | 3300005335 | Ga0070666_10023216 | Ga0070666_100232166 | 90 |
| 428 | 3300005339 | Ga0070660_100884455 | Ga0070660_1008844551 | 90 |
| 429 | 3300005340 | Ga0070689_100202762 | Ga0070689_1002027622 | 90 |
| 430 | 3300005343 | Ga0070687_100175550 | Ga0070687_1001755502 | 90 |
| 431 | 3300005347 | Ga0070668_100535529 | Ga0070668_1005355292 | 90 |
| 432 | 3300005355 | Ga0070671_100778361 | Ga0070671_1007783611 | 90 |
| 433 | 3300005356 | Ga0070674_100305946 | Ga0070674_1003059462 | 90 |
| 434 | 3300005364 | Ga0070673_100092739 | Ga0070673_1000927392 | 90 |
| 435 | 3300005434 | Ga0070709_10003717 | Ga0070709_100037175 | 90 |
| 436 | 3300005434 | Ga0070709_11426750 | Ga0070709_114267502 | 90 |
| 437 | 3300005435 | Ga0070714_100027177 | Ga0070714_1000271773 | 90 |
| 438 | 3300005436 | Ga0070713_100004110 | Ga0070713_10000411010 | 90 |
| 439 | 3300005437 | Ga0070710_10005634 | Ga0070710_100056341 | 90 |
| 440 | 3300005439 | Ga0070711_100911483 | Ga0070711_1009114832 | 90 |
| 441 | 3300005440 | Ga0070705_100762615 | Ga0070705_1007626152 | 90 |
| 442 | 3300005441 | Ga0070700_100964888 | Ga0070700_1009648881 | 90 |
| 443 | 3300005455 | Ga0070663_100889703 | Ga0070663_1008897032 | 90 |
| 444 | 3300005456 | Ga0070678_100323936 | Ga0070678_1003239362 | 90 |
| 445 | 3300005459 | Ga0068867_100301491 | Ga0068867_1003014912 | 90 |
| 446 | 3300005535 | Ga0070684_100263281 | Ga0070684_1002632812 | 90 |
| 447 | 3300005539 | Ga0068853_101156250 | Ga0068853_1011562502 | 90 |
| 448 | 3300005564 | Ga0070664_100018435 | Ga0070664_1000184355 | 90 |
| 449 | 3300005564 | Ga0070664_101270056 | Ga0070664_1012700561 | 90 |
| 450 | 3300005617 | Ga0068859_100498048 | Ga0068859_1004980483 | 90 |
| 451 | 3300005618 | Ga0068864_100194705 | Ga0068864_1001947052 | 90 |
| 452 | 3300005841 | Ga0068863_100199880 | Ga0068863_1001998802 | 90 |
| 453 | 3300005937 | Ga0081455_10002167 | Ga0081455_1000216723 | 90 |
| 454 | 3300006028 | Ga0070717_10002524 | Ga0070717_100025247 | 90 |
| 455 | 3300006163 | Ga0070715_10035898 | Ga0070715_100358982 | 90 |
| 456 | 3300006173 | Ga0070716_100243226 | Ga0070716_1002432262 | 90 |
| 457 | 3300006175 | Ga0070712_100112330 | Ga0070712_1001123303 | 90 |
| 458 | 3300006175 | Ga0070712_100270553 | Ga0070712_1002705532 | 90 |
| 459 | 3300006186 | Ga0075369_10533538 | Ga0075369_105335381 | 90 |
| 460 | 3300006237 | Ga0097621_101486726 | Ga0097621_1014867262 | 90 |
| 461 | 3300006358 | Ga0068871_100159680 | Ga0068871_1001596801 | 90 |
| 462 | 3300006871 | Ga0075434_100086382 | Ga0075434_1000863823 | 90 |
| 463 | 3300006914 | Ga0075436_101210603 | Ga0075436_1012106032 | 90 |
| 464 | 3300006931 | Ga0097620_100498060 | Ga0097620_1004980602 | 90 |
| 465 | 3300007076 | Ga0075435_101175962 | Ga0075435_1011759621 | 90 |
| 466 | 3300007265 | Ga0099794_10748027 | Ga0099794_107480272 | 90 |
| 467 | 3300009011 | Ga0105251_10034356 | Ga0105251_100343561 | 90 |
| 468 | 3300009092 | Ga0105250_10079947 | Ga0105250_100799472 | 90 |
| 469 | 3300009148 | Ga0105243_10932966 | Ga0105243_109329662 | 90 |
| 470 | 3300009174 | Ga0105241_10132301 | Ga0105241_101323012 | 90 |
| 471 | 3300009176 | Ga0105242_10124133 | Ga0105242_101241332 | 90 |
| 472 | 3300009177 | Ga0105248_12998841 | Ga0105248_129988411 | 90 |
| 473 | 3300009553 | Ga0105249_12019285 | Ga0105249_120192852 | 90 |
| 474 | 3300010375 | Ga0105239_13325708 | Ga0105239_133257082 | 90 |
| 475 | 3300011119 | Ga0105246_10412995 | Ga0105246_104129952 | 90 |
| 476 | 3300012476 | Ga0157344_1003810 | Ga0157344_10038101 | 90 |
| 477 | 3300013105 | Ga0157369_11147123 | Ga0157369_111471232 | 90 |
| 478 | 3300013296 | Ga0157374_10173224 | Ga0157374_101732243 | 90 |
| 479 | 3300013306 | Ga0163162_10433602 | Ga0163162_104336023 | 90 |
| 480 | 3300014325 | Ga0163163_11210663 | Ga0163163_112106632 | 90 |
| 481 | 3300014326 | Ga0157380_10644661 | Ga0157380_106446612 | 90 |
| 482 | 3300014497 | Ga0182008_10252942 | Ga0182008_102529422 | 90 |
| 483 | 3300014745 | Ga0157377_10088941 | Ga0157377_100889413 | 90 |
| 484 | 3300014968 | Ga0157379_10551277 | Ga0157379_105512772 | 90 |
| 485 | 3300014969 | Ga0157376_10898082 | Ga0157376_108980822 | 90 |
| 486 | 3300025735 | Ga0207713_1046555 | Ga0207713_10465552 | 90 |
| 487 | 3300025898 | Ga0207692_10027430 | Ga0207692_100274301 | 90 |
| 488 | 3300025900 | Ga0207710_10035279 | Ga0207710_100352793 | 90 |
| 489 | 3300025901 | Ga0207688_10170276 | Ga0207688_101702762 | 90 |
| 490 | 3300025905 | Ga0207685_10019025 | Ga0207685_100190252 | 90 |
| 491 | 3300025906 | Ga0207699_10001254 | Ga0207699_100012547 | 90 |
| 492 | 3300025906 | Ga0207699_10525795 | Ga0207699_105257952 | 90 |
| 493 | 3300025911 | Ga0207654_10299084 | Ga0207654_102990842 | 90 |
| 494 | 3300025915 | Ga0207693_10033262 | Ga0207693_100332625 | 90 |
| 495 | 3300025916 | Ga0207663_10496535 | Ga0207663_104965351 | 90 |
| 496 | 3300025916 | Ga0207663_11720471 | Ga0207663_117204712 | 90 |
| 497 | 3300025919 | Ga0207657_10413513 | Ga0207657_104135132 | 90 |
| 498 | 3300025925 | Ga0207650_10230663 | Ga0207650_102306632 | 90 |
| 499 | 3300025926 | Ga0207659_10254859 | Ga0207659_102548592 | 90 |
| 500 | 3300025928 | Ga0207700_10001346 | Ga0207700_1000134610 | 90 |
| 501 | 3300025929 | Ga0207664_10034782 | Ga0207664_100347823 | 90 |
| 502 | 3300025931 | Ga0207644_10555613 | Ga0207644_105556132 | 90 |
| 503 | 3300025933 | Ga0207706_10047303 | Ga0207706_100473032 | 90 |
| 504 | 3300025933 | Ga0207706_11601959 | Ga0207706_116019592 | 90 |
| 505 | 3300025934 | Ga0207686_10593998 | Ga0207686_105939982 | 90 |
| 506 | 3300025939 | Ga0207665_10004253 | Ga0207665_100042538 | 90 |
| 507 | 3300025941 | Ga0207711_10873998 | Ga0207711_108739982 | 90 |
| 508 | 3300025961 | Ga0207712_10283870 | Ga0207712_102838702 | 90 |
| 509 | 3300025972 | Ga0207668_10379657 | Ga0207668_103796572 | 90 |
| 510 | 3300026035 | Ga0207703_10894394 | Ga0207703_108943942 | 90 |
| 511 | 3300026041 | Ga0207639_10364778 | Ga0207639_103647782 | 90 |
| 512 | 3300026075 | Ga0207708_11071894 | Ga0207708_110718942 | 90 |
| 513 | 3300026078 | Ga0207702_10037988 | Ga0207702_100379883 | 90 |
| 514 | 3300026089 | Ga0207648_10243918 | Ga0207648_102439182 | 90 |
| 515 | 3300026118 | Ga0207675_100068525 | Ga0207675_1000685252 | 90 |
| 516 | 3300026121 | Ga0207683_10658365 | Ga0207683_106583652 | 90 |
| 517 | 3300028379 | Ga0268266_10369073 | Ga0268266_103690733 | 90 |
| 518 | 3300035083 | Ga0373926_0006770 | Ga0373926_0006770_3078_3377 | 90 |
| 519 | 3300035086 | Ga0373934_0109789 | Ga0373934_0109789_227_526 | 90 |
| 520 | 3300035088 | Ga0373940_0021083 | Ga0373940_0021083_1133_1432 | 90 |
| 521 | 3300035089 | Ga0373944_0001887 | Ga0373944_0001887_2964_3263 | 90 |
| 522 | 3300035089 | Ga0373944_0009056 | Ga0373944_0009056_1076_1375 | 90 |
| 523 | 3300035111 | Ga0373923_0004951 | Ga0373923_0004951_4152_4451 | 90 |
| 524 | 3300035111 | Ga0373923_0028384 | Ga0373923_0028384_155_454 | 90 |
| 525 | 3300035112 | Ga0373932_0427568 | Ga0373932_0427568_183_482 | 90 |
| 526 | 3300035113 | Ga0373936_0003385 | Ga0373936_0003385_1703_2002 | 90 |
| 527 | 3300035116 | Ga0373945_0001184 | Ga0373945_0001184_6496_6795 | 90 |
| 528 | 3300035116 | Ga0373945_0004059 | Ga0373945_0004059_2620_2919 | 90 |
| 529 | 3300035117 | Ga0373953_0092979 | Ga0373953_0092979_610_909 | 90 |
| 530 | 3300035118 | Ga0373954_0017433 | Ga0373954_0017433_1232_1531 | 90 |
| 531 | 3300035118 | Ga0373954_0176850 | Ga0373954_0176850_457_756 | 90 |
| 532 | 3300035120 | Ga0373957_0023742 | Ga0373957_0023742_485_784 | 90 |
| 533 | 3300035170 | Ga0373943_0007904 | Ga0373943_0007904_2134_2433 | 90 |
| 534 | 3300035170 | Ga0373943_0089848 | Ga0373943_0089848_608_907 | 90 |
| 535 | 3300035170 | Ga0373943_0677614 | Ga0373943_0677614_61_363 | 90 |
| 536 | 3300035171 | Ga0373946_0001521 | Ga0373946_0001521_4001_4300 | 90 |
| 537 | 3300035171 | Ga0373946_0008101 | Ga0373946_0008101_1564_1863 | 90 |
| 538 | 3300035172 | Ga0373955_0023108 | Ga0373955_0023108_1184_1483 | 90 |
| 539 | 3300035242 | Ga0373962_0140516 | Ga0373962_0140516_260_559 | 90 |
| 540 | 3300035410 | Ga0373924_0002712 | Ga0373924_0002712_447_746 | 90 |
| 541 | 3300035691 | Ga0373931_0004834 | Ga0373931_0004834_5649_5948 | 90 |
| 542 | 3300035692 | Ga0373935_0001406 | Ga0373935_0001406_8200_8499 | 90 |
| 543 | 3300035692 | Ga0373935_0035255 | Ga0373935_0035255_1417_1716 | 90 |
| 544 | 3300035695 | Ga0373927_0003933 | Ga0373927_0003933_3470_3769 | 90 |
| 545 | 3300035695 | Ga0373927_0038572 | Ga0373927_0038572_1242_1541 | 90 |
| 546 | 3300035724 | Ga0373933_0023914 | Ga0373933_0023914_1159_1458 | 90 |
| 547 | 3300035725 | Ga0373947_0003263 | Ga0373947_0003263_3394_3693 | 90 |
| 548 | 3300035725 | Ga0373947_0007599 | Ga0373947_0007599_2797_3096 | 90 |
| 549 | 3300035725 | Ga0373947_0904139 | Ga0373947_0904139_140_442 | 90 |
| 550 | 3300036401 | Ga0373937_0084788 | Ga0373937_0084788_1407_1706 | 90 |
| 551 | 3300037068 | Ga0373925_0017905 | Ga0373925_0017905_1009_1308 | 90 |
| 552 | 3300037068 | Ga0373925_0079818 | Ga0373925_0079818_1004_1303 | 90 |
| 553 | 3300044901 | Ga0466960_0428184 | Ga0466960_0428184_250_549 | 90 |
| 554 | 3300046452 | Ga0495617_037668 | Ga0495617_037668_1016_1315 | 90 |
| 555 | 3300046454 | Ga0495592_0052256 | Ga0495592_0052256_1833_2132 | 90 |
| 556 | 3300046455 | Ga0495603_0056534 | Ga0495603_0056534_1810_2109 | 90 |
| 557 | 3300046458 | Ga0495591_099477 | Ga0495591_099477_157_456 | 90 |
| 558 | 3300046459 | Ga0495629_0014941 | Ga0495629_0014941_2550_2849 | 90 |
| 559 | 3300046459 | Ga0495629_0026104 | Ga0495629_0026104_2797_3096 | 90 |
| 560 | 3300046461 | Ga0495641_0041321 | Ga0495641_0041321_1797_2096 | 90 |
| 561 | 3300046462 | Ga0495651_0016437 | Ga0495651_0016437_2075_2374 | 90 |
| 562 | 3300046463 | Ga0495653_0005878 | Ga0495653_0005878_7643_7942 | 90 |
| 563 | 3300046463 | Ga0495653_0129270 | Ga0495653_0129270_553_852 | 90 |
| 564 | 3300046472 | Ga0495580_0059600 | Ga0495580_0059600_437_736 | 90 |
| 565 | 3300046473 | Ga0495582_0099607 | Ga0495582_0099607_47_346 | 90 |
| 566 | 3300046473 | Ga0495582_0603397 | Ga0495582_0603397_320_625 | 90 |
| 567 | 3300046475 | Ga0495639_0005083 | Ga0495639_0005083_2128_2427 | 90 |
| 568 | 3300046475 | Ga0495639_0075971 | Ga0495639_0075971_297_596 | 90 |
| 569 | 3300046476 | Ga0495662_0018751 | Ga0495662_0018751_1608_1907 | 90 |
| 570 | 3300046476 | Ga0495662_0087217 | Ga0495662_0087217_417_716 | 90 |
| 571 | 3300046477 | Ga0495664_0001034 | Ga0495664_0001034_3305_3604 | 90 |
| 572 | 3300046477 | Ga0495664_0061834 | Ga0495664_0061834_1883_2182 | 90 |
| 573 | 3300046491 | Ga0495584_0010382 | Ga0495584_0010382_3643_3942 | 90 |
| 574 | 3300046492 | Ga0495585_0002702 | Ga0495585_0002702_7153_7452 | 90 |
| 575 | 3300046499 | Ga0495594_0084341 | Ga0495594_0084341_1065_1364 | 90 |
| 576 | 3300046501 | Ga0495607_0043119 | Ga0495607_0043119_1630_1929 | 90 |
| 577 | 3300046506 | Ga0495583_0331447 | Ga0495583_0331447_85_384 | 90 |
| 578 | 3300046511 | Ga0495608_0023329 | Ga0495608_0023329_2031_2330 | 90 |
| 579 | 3300046514 | Ga0495618_0009681 | Ga0495618_0009681_4487_4786 | 90 |
| 580 | 3300046514 | Ga0495618_0017145 | Ga0495618_0017145_2733_3032 | 90 |
| 581 | 3300046516 | Ga0495628_0023643 | Ga0495628_0023643_949_1248 | 90 |
| 582 | 3300046516 | Ga0495628_0160286 | Ga0495628_0160286_12_311 | 90 |
| 583 | 3300046517 | Ga0495630_0026988 | Ga0495630_0026988_2955_3254 | 90 |
| 584 | 3300046517 | Ga0495630_0116373 | Ga0495630_0116373_517_816 | 90 |
| 585 | 3300046523 | Ga0495644_0000510 | Ga0495644_0000510_5808_6107 | 90 |
| 586 | 3300046526 | Ga0495666_0004543 | Ga0495666_0004543_3642_3941 | 90 |
| 587 | 3300046529 | Ga0495652_0012180 | Ga0495652_0012180_4093_4392 | 90 |
| 588 | 3300046529 | Ga0495652_0018127 | Ga0495652_0018127_1238_1537 | 90 |
| 589 | 3300046531 | Ga0495665_0002324 | Ga0495665_0002324_7174_7473 | 90 |
| 590 | 3300046531 | Ga0495665_0168889 | Ga0495665_0168889_133_432 | 90 |
| 591 | 3300046533 | Ga0495640_0008356 | Ga0495640_0008356_6213_6512 | 90 |
| 592 | 3300046533 | Ga0495640_0021657 | Ga0495640_0021657_2878_3177 | 90 |
| 593 | 3300046535 | Ga0495586_0012180 | Ga0495586_0012180_3014_3313 | 90 |
| 594 | 3300046536 | Ga0495587_0009020 | Ga0495587_0009020_4094_4393 | 90 |
| 595 | 3300046537 | Ga0495598_0001168 | Ga0495598_0001168_1768_2067 | 90 |
| 596 | 3300046538 | Ga0495609_0040488 | Ga0495609_0040488_169_468 | 90 |
| 597 | 3300046543 | Ga0495645_0015262 | Ga0495645_0015262_1768_2067 | 90 |
| 598 | 3300046543 | Ga0495645_0258761 | Ga0495645_0258761_277_576 | 90 |
| 599 | 3300046557 | Ga0495622_0028237 | Ga0495622_0028237_2107_2406 | 90 |
| 600 | 3300046558 | Ga0495633_0005507 | Ga0495633_0005507_5793_6092 | 90 |
| 601 | 3300046559 | Ga0495667_0004324 | Ga0495667_0004324_6227_6526 | 90 |
| 602 | 3300046642 | Ga0495634_0018647 | Ga0495634_0018647_4473_4772 | 90 |
| 603 | 3300046642 | Ga0495634_0069154 | Ga0495634_0069154_1775_2074 | 90 |
| 604 | 3300046648 | Ga0495611_0004254 | Ga0495611_0004254_3238_3537 | 90 |
| 605 | 3300046660 | Ga0495625_0258092 | Ga0495625_0258092_139_441 | 90 |
| 606 | 3300046663 | Ga0495635_0007226 | Ga0495635_0007226_4663_4962 | 90 |
| 607 | 3300046663 | Ga0495635_0092738 | Ga0495635_0092738_146_445 | 90 |
| 608 | 3300046665 | Ga0495661_0085906 | Ga0495661_0085906_417_716 | 90 |
| 609 | 3300046674 | Ga0495588_0001938 | Ga0495588_0001938_7536_7835 | 90 |
| 610 | 3300046678 | Ga0495599_0025038 | Ga0495599_0025038_1331_1630 | 90 |
| 611 | 3300046678 | Ga0495599_0037081 | Ga0495599_0037081_1755_2054 | 90 |
| 612 | 3300046679 | Ga0495623_0516505 | Ga0495623_0516505_53_352 | 90 |
| 613 | 3300046680 | Ga0495646_0061436 | Ga0495646_0061436_1440_1739 | 90 |
| 614 | 3300046680 | Ga0495646_0075503 | Ga0495646_0075503_309_608 | 90 |
| 615 | 3300046681 | Ga0495647_0107629 | Ga0495647_0107629_48_347 | 90 |
| 616 | 3300046681 | Ga0495647_0251045 | Ga0495647_0251045_380_679 | 90 |
| 617 | 3300046681 | Ga0495647_0413171 | Ga0495647_0413171_158_463 | 90 |
| 618 | 3300046683 | Ga0495658_0035402 | Ga0495658_0035402_1416_1715 | 90 |
| 619 | 3300046683 | Ga0495658_0055302 | Ga0495658_0055302_621_920 | 90 |
| 620 | 3300046689 | Ga0495613_0043387 | Ga0495613_0043387_1183_1482 | 90 |
| 621 | 3300046689 | Ga0495613_0162977 | Ga0495613_0162977_697_996 | 90 |
| 622 | 3300046690 | Ga0495624_0027240 | Ga0495624_0027240_516_815 | 90 |
| 623 | 3300046690 | Ga0495624_0099022 | Ga0495624_0099022_1449_1748 | 90 |
| 624 | 3300046691 | Ga0495670_0003427 | Ga0495670_0003427_3820_4119 | 90 |
| 625 | 3300046794 | Ga0495589_0042744 | Ga0495589_0042744_1633_1932 | 90 |
| 626 | 3300046809 | Ga0495600_0000758 | Ga0495600_0000758_1850_2149 | 90 |
| 627 | 3300047315 | Ga0495581_0002122 | Ga0495581_0002122_7174_7473 | 90 |
| 628 | 3300047317 | Ga0495604_0006519 | Ga0495604_0006519_7726_8025 | 90 |
| 629 | 3300047318 | Ga0495636_0322726 | Ga0495636_0322726_409_708 | 90 |
| 630 | 3300047319 | Ga0495674_0003621 | Ga0495674_0003621_11306_11605 | 90 |
| 631 | 3300047319 | Ga0495674_0025009 | Ga0495674_0025009_3997_4296 | 90 |
| 632 | 3300047321 | Ga0495676_0074467 | Ga0495676_0074467_1320_1619 | 90 |
| 633 | 3300047321 | Ga0495676_0090087 | Ga0495676_0090087_1585_1884 | 90 |
| 634 | 3300047322 | Ga0495680_0006335 | Ga0495680_0006335_3221_3520 | 90 |
| 635 | 3300047322 | Ga0495680_0192123 | Ga0495680_0192123_281_580 | 90 |
| 636 | 3300047323 | Ga0495683_0207585 | Ga0495683_0207585_26_325 | 90 |
| 637 | 3300047444 | Ga0495675_0063137 | Ga0495675_0063137_1205_1504 | 90 |
| 638 | 3300047446 | Ga0495679_009932 | Ga0495679_009932_2263_2562 | 90 |
| 639 | 3300047471 | Ga0495684_0002702 | Ga0495684_0002702_10948_11247 | 90 |
| 640 | 3300047471 | Ga0495684_0107676 | Ga0495684_0107676_772_1071 | 90 |
| 641 | 3300047673 | Ga0495593_0029008 | Ga0495593_0029008_1736_2035 | 90 |
| 642 | 3300047673 | Ga0495593_0133338 | Ga0495593_0133338_522_821 | 90 |
| 643 | 3300048088 | Ga0495602_0122404 | Ga0495602_0122404_804_1103 | 90 |
| 644 | 3300048089 | Ga0495614_0063042 | Ga0495614_0063042_533_832 | 90 |
| 645 | 3300048903 | Ga0496100_0018910 | Ga0496100_0018910_2895_3194 | 90 |
| 646 | 3300048904 | Ga0496101_0022121 | Ga0496101_0022121_1094_1393 | 90 |
| 647 | 3300048905 | Ga0496102_0211431 | Ga0496102_0211431_1094_1393 | 90 |
| 648 | 3300048906 | Ga0496103_0031406 | Ga0496103_0031406_885_1184 | 90 |
| 649 | 3300048907 | Ga0496104_0259799 | Ga0496104_0259799_475_774 | 90 |
| 650 | 3300048908 | Ga0496105_0143115 | Ga0496105_0143115_575_874 | 90 |
| 651 | 3300048909 | Ga0496106_0168933 | Ga0496106_0168933_831_1130 | 90 |
| 652 | 3300048910 | Ga0496107_0067308 | Ga0496107_0067308_155_454 | 90 |
| 653 | 3300048911 | Ga0496108_0223913 | Ga0496108_0223913_1094_1393 | 90 |
| 654 | 3300048912 | Ga0496109_0013309 | Ga0496109_0013309_5736_6035 | 90 |
| 655 | 3300048914 | Ga0496111_0198510 | Ga0496111_0198510_99_398 | 90 |
| 656 | 3300048914 | Ga0496111_0213186 | Ga0496111_0213186_179_478 | 90 |
| 657 | 3300048915 | Ga0496112_0192675 | Ga0496112_0192675_607_906 | 90 |
| 658 | 3300048916 | Ga0496113_0167417 | Ga0496113_0167417_1094_1393 | 90 |
| 659 | 3300048917 | Ga0496114_0060481 | Ga0496114_0060481_2067_2366 | 90 |
| 660 | 3300048918 | Ga0496115_0183612 | Ga0496115_0183612_1241_1540 | 90 |
| 661 | 3300049568 | Ga0501031_0055109 | Ga0501031_0055109_2094_2396 | 90 |
| 662 | 3300049574 | Ga0501038_0342947 | Ga0501038_0342947_459_761 | 90 |
| 663 | 3300049576 | Ga0501040_0574537 | Ga0501040_0574537_51_353 | 90 |
| 664 | 3300049587 | Ga0501071_0084581 | Ga0501071_0084581_1451_1753 | 90 |
| 665 | 3300049590 | Ga0501074_0048380 | Ga0501074_0048380_131_433 | 90 |
| 666 | 3300049591 | Ga0501075_0027790 | Ga0501075_0027790_2350_2652 | 90 |
| 667 | 3300049592 | Ga0501076_0011514 | Ga0501076_0011514_5598_5900 | 90 |
| 668 | 3300049741 | Ga0501079_0086821 | Ga0501079_0086821_578_880 | 90 |
| 669 | 3300049742 | Ga0501080_0003855 | Ga0501080_0003855_10447_10749 | 90 |
| 670 | 3300049822 | Ga0501035_0211044 | Ga0501035_0211044_872_1174 | 90 |
| 671 | 3300050512 | nmdc:mga0n895_385564_c1 | nmdc:mga0n895_385564_c1_223_522 | 90 |
| 672 | 3300050512 | nmdc:mga0n895_94584_c1 | nmdc:mga0n895_94584_c1_1870_2169 | 90 |
| 673 | 3300050513 | nmdc:mga0rr50_139729_c1 | nmdc:mga0rr50_139729_c1_1610_1909 | 90 |
| 674 | 3300050514 | nmdc:mga08x19_188283_c1 | nmdc:mga08x19_188283_c1_624_923 | 90 |
| 675 | 3300053077 | Ga0495601_0000489 | Ga0495601_0000489_7648_7947 | 90 |
| 676 | 3300053077 | Ga0495601_0024445 | Ga0495601_0024445_2015_2314 | 90 |
| 677 | 3300053078 | Ga0495612_0003322 | Ga0495612_0003322_2973_3272 | 90 |
| 678 | 3300053078 | Ga0495612_0004147 | Ga0495612_0004147_3829_4128 | 90 |
| 679 | 3300053084 | Ga0495595_0005839 | Ga0495595_0005839_2797_3096 | 90 |
| 680 | 3300053084 | Ga0495595_0397820 | Ga0495595_0397820_134_433 | 90 |
| 681 | 3300053085 | Ga0495619_0000918 | Ga0495619_0000918_9414_9713 | 90 |
| 682 | 3300053094 | Ga0500566_0077295 | Ga0500566_0077295_1534_1833 | 90 |
| 683 | 3300054114 | Ga0501084_0177788 | Ga0501084_0177788_49_351 | 90 |
| 684 | 3300054114 | Ga0501084_1270286 | Ga0501084_1270286_58_360 | 90 |
| 685 | 3300060353 | Ga0501082_0391088 | Ga0501082_0391088_483_785 | 90 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2lo0-assembly1.cif.gz_B | solution structure of the get5 carboxyl domain from a. fumigatus | 0.7008 | 37 | 69 |
| 1r6o-assembly2.cif.gz_D | atp-dependent clp protease atp-binding subunit clpa/atp-dependent clp protease adaptor protein clps | 0.6596 | 35 | 64 |
| 1mbx-assembly1.cif.gz_C | crystal structure analysis of clpsn with transition metal ion bound | 0.5965 | 32 | 64 |
| 7xxs-assembly1.cif.gz_A | hapr mutant i141v | 0.5631 | 37 | 65 |
| 6vz0-assembly1.cif.gz_A | c-terminal domain of mouse surfactant protein b crystallized at high ph | 0.538 | 37 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VDR4_1380_1622_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7137 | 35 | 62 | 3.40.50.300 |
| 1tfeA02 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1; | 0.7054 | 36 | 69 | 1.10.286.20 |
| 1aipC02 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1; | 0.7042 | 37 | 69 | 1.10.286.20 |
| 2lo0B00 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;Get5 dimerization domain | 0.7008 | 37 | 69 | 1.10.286.70 |
| af_Q9C8W7_33_125_3.30.70.80 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Peptidase S8 propeptide/proteinase inhibitor I9 | 0.684 | 27 | 54 | 3.30.70.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1RWV0-F1-model_v4 | Uncharacterized protein | 0.9429 | 39 | 89 |
|
| AF-F7QRK1-F1-model_v4 | Uncharacterized protein | 0.8475 | 38 | 90 |
|
| AF-A0A2D6X9W4-F1-model_v4 | Uncharacterized protein | 0.8267 | 27 | 89 |
|
| AF-A0A5C7PP70-F1-model_v4 | Uncharacterized protein | 0.8206 | 27 | 89 |
|
| AF-F7QRK1-F1-model_v4 | Uncharacterized protein | 0.82 | 38 | 90 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar