F475158

General Info

Members Datasets Scaffolds Average Seq Length
685 363 1370 250

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0241352|Ga0501083_0241352_128_1015
Length 295
Sequence MAAGSGARPDPALNSAHGWLPARPRRQGVRQRLAANPEELFMSDYDRNVAAFPGATRTVAVDAGLRAHMIRVYNYMASAVALTGVLAYVTFQAAGGDAIRVAGNTITGLTPFGQTVMGGFAPIVLMLVTLGLVFFISFRINRLQYTTALGLFMLYAGLLGVALSTIFVAYTGASITRVFFISAASFGALSIYGYTTQRDLSPFGSFLIMGLFGIIIASLVNIFLASSALTFAISVIGVLVFAGLTAWDTQKIKEMYSPMDDGTVAGRKAVMGALSLYLDFINLFLMLLRLFGDRR

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
102 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
175 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
210 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
211 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
212 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
213 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
214 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
341 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
346 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
350 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
353 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
354 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
363 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 4.53
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.76
Nodule 0
Rhizoplane 3.5
Rhizosphere 84.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0241352 3300049744 Bacteria 1176
2 JGI24751J29686_10004988 3300002459 Bacteria 2705
3 JGI25406J46586_10008857 3300003203 Bacteria 4531
4 JGI25153J46596_10001402 3300003215 Bacteria 14442
5 JGI25153J46596_10004909 3300003215 Bacteria 7109
6 Ga0055527_1000348 3300003760 Bacteria 22982
7 Ga0055535_1000137 3300003761 Bacteria 76845
8 Ga0055542_1008635 3300003762 Bacteria 1979
9 Ga0055529_1005228 3300003763 Bacteria 1897
10 Ga0055529_1012897 3300003763 Bacteria 1066
11 Ga0058859_11740191 3300004798 Bacteria 822
12 Ga0058860_12182228 3300004801 Bacteria 1040
13 Ga0058862_12589958 3300004803 Bacteria 922
14 Ga0058862_12880575 3300004803 Bacteria 978
15 Ga0065707_10217266 3300005295 Bacteria 1235
16 Ga0070670_100073795 3300005331 Bacteria 2931
17 Ga0068869_100257574 3300005334 Bacteria 1396
18 Ga0068868_100176757 3300005338 Bacteria 1769
19 Ga0070689_100243052 3300005340 Bacteria 1483
20 Ga0070668_100136068 3300005347 Bacteria 1976
21 Ga0070669_100100970 3300005353 Bacteria 2176
22 Ga0070669_100145045 3300005353 Bacteria 1833
23 Ga0070675_100026991 3300005354 Bacteria 4611
24 Ga0070675_100133330 3300005354 Bacteria 2118
25 Ga0070675_100370162 3300005354 Bacteria 1274
26 Ga0070671_100005912 3300005355 Bacteria 9750
27 Ga0070674_100021767 3300005356 Bacteria 4124
28 Ga0070674_100835671 3300005356 Bacteria 798
29 Ga0070673_100083880 3300005364 Bacteria 2590
30 Ga0070688_100099172 3300005365 Bacteria 1917
31 Ga0070667_100113718 3300005367 Bacteria 2349
32 Ga0070667_100330999 3300005367 Bacteria 1376
33 Ga0070709_10039119 3300005434 Bacteria 2909
34 Ga0070709_10177453 3300005434 Bacteria 1493
35 Ga0070714_100071523 3300005435 Bacteria 2999
36 Ga0070714_100226570 3300005435 Bacteria 1720
37 Ga0070713_100504625 3300005436 Bacteria 1142
38 Ga0070710_10071096 3300005437 Bacteria 2006
39 Ga0070701_10171535 3300005438 Bacteria 1264
40 Ga0070701_10495026 3300005438 Bacteria 792
41 Ga0070711_100141313 3300005439 Bacteria 1806
42 Ga0070700_100254832 3300005441 Bacteria 1261
43 Ga0070708_100084345 3300005445 Bacteria 2882
44 Ga0070681_10059291 3300005458 Bacteria 3807
45 Ga0068867_100050608 3300005459 Bacteria 3062
46 Ga0070685_10018946 3300005466 Bacteria 3708
47 Ga0070685_10300453 3300005466 Bacteria 1082
48 Ga0070699_100309949 3300005518 Bacteria 1417
49 Ga0070679_100048126 3300005530 Bacteria 4249
50 Ga0070679_100218279 3300005530 Bacteria 1868
51 Ga0070672_100075006 3300005543 Bacteria 2699
52 Ga0070695_100249106 3300005545 Bacteria 1292
53 Ga0070665_100383592 3300005548 Bacteria 1413
54 Ga0070664_100075564 3300005564 Bacteria 2893
55 Ga0070702_100130906 3300005615 Bacteria 1584
56 Ga0068859_100027770 3300005617 Bacteria 5676
57 Ga0068864_100007555 3300005618 Bacteria 8957
58 Ga0068870_10397914 3300005840 Bacteria 896
59 Ga0068858_100373962 3300005842 Bacteria 1367
60 Ga0068860_100351676 3300005843 Bacteria 1450
61 Ga0068862_100121391 3300005844 Bacteria 2304
62 Ga0068862_100393608 3300005844 Bacteria 1295
63 Ga0081538_10124878 3300005981 Bacteria 1226
64 Ga0081540_1001109 3300005983 Bacteria 23852
65 Ga0081539_10003227 3300005985 Bacteria 20568
66 Ga0070717_10079339 3300006028 Bacteria 2752
67 Ga0070717_10514261 3300006028 Bacteria 1083
68 Ga0075365_10053864 3300006038 Bacteria 2666
69 Ga0075365_10098968 3300006038 Bacteria 1995
70 Ga0075368_10085825 3300006042 Bacteria 1284
71 Ga0075363_100015573 3300006048 Bacteria 3739
72 Ga0075364_10016731 3300006051 Bacteria 4567
73 Ga0070715_10172002 3300006163 Bacteria 1080
74 Ga0075367_10093438 3300006178 Bacteria 1832
75 Ga0075367_10229203 3300006178 Bacteria 1163
76 Ga0075367_10232165 3300006178 Bacteria 1155
77 Ga0075369_10028288 3300006186 Bacteria 2349
78 Ga0075369_10069978 3300006186 Bacteria 1543
79 Ga0075369_10202646 3300006186 Bacteria 916
80 Ga0075427_10000389 3300006194 Bacteria 4930
81 Ga0075366_10010635 3300006195 Bacteria 5169
82 Ga0075366_10152062 3300006195 Bacteria 1402
83 Ga0075370_10012948 3300006353 Bacteria 4422
84 Ga0075370_10046449 3300006353 Bacteria 2457
85 Ga0075370_10294985 3300006353 Bacteria 964
86 Ga0075428_100007998 3300006844 Bacteria 11727
87 Ga0075428_100058970 3300006844 Bacteria 4203
88 Ga0075428_100111881 3300006844 Bacteria 2974
89 Ga0075430_100000032 3300006846 Bacteria 72679
90 Ga0075430_100094433 3300006846 Bacteria 2500
91 Ga0075431_100000903 3300006847 Bacteria 26158
92 Ga0075431_100052467 3300006847 Bacteria 4206
93 Ga0075431_100167999 3300006847 Bacteria 2255
94 Ga0075431_100483701 3300006847 Bacteria 1230
95 Ga0075433_10017192 3300006852 Bacteria 5984
96 Ga0075433_10019599 3300006852 Bacteria 5639
97 Ga0075434_100000271 3300006871 Bacteria 36857
98 Ga0075434_100009740 3300006871 Bacteria 8981
99 Ga0075434_100011424 3300006871 Bacteria 8377
100 Ga0075434_100705248 3300006871 Bacteria 1027
101 Ga0075429_100000561 3300006880 Bacteria 28469
102 Ga0075429_100007528 3300006880 Bacteria 9453
103 Ga0097620_100027770 3300006931 Bacteria 5676
104 Ga0075435_100033962 3300007076 Bacteria 4038
105 Ga0075435_100035256 3300007076 Bacteria 3970
106 Ga0075435_100049397 3300007076 Bacteria 3383
107 Ga0099794_10023255 3300007265 Bacteria 2832
108 Ga0099795_10016161 3300007788 Bacteria 2354
109 Ga0111539_10001270 3300009094 Bacteria 33682
110 Ga0111539_10106024 3300009094 Bacteria 3297
111 Ga0111539_10230550 3300009094 Bacteria 2156
112 Ga0105245_10787318 3300009098 Bacteria 988
113 Ga0105247_10345618 3300009101 Bacteria 1045
114 Ga0114129_10001444 3300009147 Bacteria 32043
115 Ga0114129_10395943 3300009147 Bacteria 1821
116 Ga0114129_10488916 3300009147 Bacteria 1609
117 Ga0105243_10622346 3300009148 Bacteria 1042
118 Ga0105243_10798172 3300009148 Bacteria 930
119 Ga0105248_10130763 3300009177 Bacteria 2832
120 Ga0105238_10122440 3300009551 Bacteria 2580
121 Ga0105238_10457467 3300009551 Bacteria 1274
122 Ga0105249_10282604 3300009553 Bacteria 1658
123 Ga0099796_10022382 3300010159 Bacteria 1960
124 Ga0099796_10116269 3300010159 Bacteria 1023
125 Ga0157370_10057496 3300013104 Bacteria 3698
126 Ga0157370_10191953 3300013104 Bacteria 1896
127 Ga0157370_10471142 3300013104 Bacteria 1154
128 Ga0157374_10199033 3300013296 Bacteria 1961
129 Ga0157374_10473994 3300013296 Bacteria 1254
130 Ga0157375_10071761 3300013308 Bacteria 3477
131 Ga0157375_10618559 3300013308 Bacteria 1241
132 Ga0157375_11151307 3300013308 Bacteria 909
133 Ga0157380_10316693 3300014326 Bacteria 1444
134 Ga0163161_10219279 3300017792 Bacteria 1472
135 Ga0184601_134529 3300019183 Bacteria 829
136 Ga0197907_10241108 3300020069 Bacteria 952
137 Ga0197907_11149821 3300020069 Bacteria 854
138 Ga0206356_10058304 3300020070 Bacteria 1870
139 Ga0206356_11190054 3300020070 Bacteria 804
140 Ga0206349_1686143 3300020075 Bacteria 855
141 Ga0206355_1367406 3300020076 Bacteria 1178
142 Ga0206351_10671826 3300020077 Bacteria 937
143 Ga0206351_10851183 3300020077 Bacteria 850
144 Ga0206352_10130377 3300020078 Bacteria 868
145 Ga0206352_10630827 3300020078 Bacteria 856
146 Ga0206350_10136915 3300020080 Bacteria 960
147 Ga0206350_11242039 3300020080 Bacteria 857
148 Ga0206354_10364600 3300020081 Bacteria 950
149 Ga0206353_10033645 3300020082 Bacteria 1858
150 Ga0206353_10830196 3300020082 Bacteria 950
151 Ga0213874_10073401 3300021377 Bacteria 1096
152 Ga0213876_10005720 3300021384 Bacteria 6814
153 Ga0213871_10042533 3300021441 Bacteria 1224
154 Ga0224712_10182174 3300022467 Bacteria 947
155 Ga0224572_1031817 3300024225 Bacteria 1006
156 Ga0228598_1013306 3300024227 Bacteria 1630
157 Ga0209672_100015 3300025228 Bacteria 529352
158 Ga0209147_100016 3300025229 Bacteria 527606
159 Ga0209258_100026 3300025242 Bacteria 527606
160 Ga0209148_1000952 3300025254 Bacteria 18941
161 Ga0209148_1006961 3300025254 Bacteria 2395
162 Ga0209455_1000321 3300025272 Bacteria 47677
163 Ga0209455_1000544 3300025272 Bacteria 26082
164 Ga0209758_1000469 3300025297 Bacteria 66568
165 Ga0209758_1088120 3300025297 Bacteria 917
166 Ga0207682_10000722 3300025893 Bacteria 15329
167 Ga0207692_10065966 3300025898 Bacteria 1891
168 Ga0207692_10073172 3300025898 Bacteria 1812
169 Ga0207688_10083701 3300025901 Bacteria 1825
170 Ga0207685_10153223 3300025905 Bacteria 1045
171 Ga0207699_10050154 3300025906 Bacteria 2459
172 Ga0207645_10020586 3300025907 Bacteria 4316
173 Ga0207645_10111527 3300025907 Bacteria 1771
174 Ga0207654_10369880 3300025911 Bacteria 991
175 Ga0207707_10116011 3300025912 Bacteria 2340
176 Ga0207693_10017643 3300025915 Bacteria 5691
177 Ga0207660_10084805 3300025917 Bacteria 2335
178 Ga0207662_10026247 3300025918 Bacteria 3359
179 Ga0207649_10328407 3300025920 Bacteria 1126
180 Ga0207652_10248325 3300025921 Bacteria 1605
181 Ga0207652_10631978 3300025921 Bacteria 958
182 Ga0207681_10091132 3300025923 Bacteria 2177
183 Ga0207681_10432867 3300025923 Bacteria 1067
184 Ga0207650_10003045 3300025925 Bacteria 11539
185 Ga0207659_10170772 3300025926 Bacteria 1715
186 Ga0207659_10288923 3300025926 Bacteria 1343
187 Ga0207659_10510969 3300025926 Bacteria 1018
188 Ga0207687_10084817 3300025927 Bacteria 2297
189 Ga0207687_10175773 3300025927 Bacteria 1655
190 Ga0207700_10043617 3300025928 Bacteria 3295
191 Ga0207700_10106049 3300025928 Bacteria 2252
192 Ga0207664_10597058 3300025929 Bacteria 991
193 Ga0207644_10003250 3300025931 Bacteria 10486
194 Ga0207690_10140463 3300025932 Bacteria 1779
195 Ga0207706_10575797 3300025933 Bacteria 968
196 Ga0207669_10071094 3300025937 Bacteria 2184
197 Ga0207669_10192897 3300025937 Bacteria 1471
198 Ga0207665_10234830 3300025939 Bacteria 1349
199 Ga0207691_10003529 3300025940 Bacteria 15210
200 Ga0207691_10131990 3300025940 Bacteria 2205
201 Ga0207691_10158744 3300025940 Bacteria 1985
202 Ga0207689_10196599 3300025942 Bacteria 1664
203 Ga0207689_10231147 3300025942 Bacteria 1528
204 Ga0207679_10063581 3300025945 Bacteria 2755
205 Ga0207651_10000859 3300025960 Bacteria 13273
206 Ga0207712_10164602 3300025961 Bacteria 1727
207 Ga0207668_10093724 3300025972 Bacteria 2213
208 Ga0207658_10062401 3300025986 Bacteria 2789
209 Ga0207658_10149656 3300025986 Bacteria 1900
210 Ga0207703_10274460 3300026035 Bacteria 1529
211 Ga0207678_10402337 3300026067 Bacteria 1186
212 Ga0207708_10451360 3300026075 Bacteria 1071
213 Ga0207708_10477546 3300026075 Bacteria 1042
214 Ga0207648_10177525 3300026089 Bacteria 1884
215 Ga0207676_10023059 3300026095 Bacteria 4585
216 Ga0207674_10186439 3300026116 Bacteria 2025
217 Ga0207675_100294924 3300026118 Bacteria 1578
218 Ga0207683_10013489 3300026121 Bacteria 6972
219 Ga0207683_10121660 3300026121 Bacteria 2344
220 Ga0209179_1004914 3300027512 Bacteria 2055
221 Ga0209588_1031078 3300027671 Bacteria 1707
222 Ga0209813_10066764 3300027866 Bacteria 1161
223 Ga0207428_10000082 3300027907 Bacteria 133684
224 Ga0207428_10154679 3300027907 Bacteria 1744
225 Ga0207428_10449065 3300027907 Bacteria 940
226 Ga0268265_10357194 3300028380 Bacteria 1336
227 Ga0268264_10411625 3300028381 Bacteria 1302
228 Ga0268264_11084638 3300028381 Bacteria 809
229 Ga0265334_10001877 3300028573 Bacteria 9974
230 Ga0265318_10008385 3300028577 Bacteria 4603
231 Ga0265338_10068313 3300028800 Bacteria 3062
232 Ga0265338_10081565 3300028800 Bacteria 2712
233 Ga0265330_10009843 3300031235 Bacteria 4524
234 Ga0265332_10007464 3300031238 Bacteria 4943
235 Ga0265325_10002531 3300031241 Bacteria 12306
236 Ga0265325_10004291 3300031241 Bacteria 9036
237 Ga0265325_10005464 3300031241 Bacteria 7838
238 Ga0265325_10016732 3300031241 Bacteria 4093
239 Ga0265325_10019267 3300031241 Bacteria 3776
240 Ga0265325_10033863 3300031241 Bacteria 2722
241 Ga0265340_10006803 3300031247 Bacteria 6257
242 Ga0265340_10010861 3300031247 Bacteria 4859
243 Ga0265340_10042659 3300031247 Bacteria 2226
244 Ga0265340_10073607 3300031247 Bacteria 1616
245 Ga0265339_10000126 3300031249 Bacteria 63942
246 Ga0265339_10019847 3300031249 Bacteria 3935
247 Ga0265331_10029658 3300031250 Bacteria 2728
248 Ga0265331_10044220 3300031250 Bacteria 2155
249 Ga0265316_10016618 3300031344 Bacteria 6379
250 Ga0265316_10246298 3300031344 Bacteria 1313
251 Ga0307513_10012476 3300031456 Bacteria 10485
252 Ga0307513_10170943 3300031456 Bacteria 2051
253 Ga0265313_10000054 3300031595 Bacteria 110199
254 Ga0265313_10000593 3300031595 Bacteria 37608
255 Ga0265313_10009618 3300031595 Bacteria 6253
256 Ga0265313_10016449 3300031595 Bacteria 4251
257 Ga0316575_10040077 3300031665 Bacteria 1850
258 Ga0265314_10144700 3300031711 Bacteria 1465
259 Ga0265342_10000034 3300031712 Bacteria 145074
260 Ga0265342_10012408 3300031712 Bacteria 5774
261 Ga0316576_10252323 3300031727 Bacteria 1324
262 Ga0307516_10205444 3300031730 Bacteria 1687
263 Ga0307405_10308451 3300031731 Bacteria 1204
264 Ga0307413_10413909 3300031824 Bacteria 1060
265 Ga0307416_100962018 3300032002 Bacteria 956
266 Ga0316583_10002336 3300032133 Bacteria 6547
267 Ga0316583_10034329 3300032133 Bacteria 1800
268 Ga0316593_10186110 3300032168 Bacteria 764
269 Ga0316592_1067264 3300033524 Bacteria 808
270 Ga0316587_1035520 3300033529 Bacteria 891
271 Ga0316596_1087836 3300033541 Bacteria 837
272 Ga0316596_1107409 3300033541 Bacteria 756
273 Ga0373923_0029554 3300035111 Bacteria 2199
274 Ga0373923_0038540 3300035111 Bacteria 1959
275 Ga0373923_0213495 3300035111 Bacteria 895
276 Ga0373945_0015071 3300035116 Bacteria 2598
277 Ga0373953_0003215 3300035117 Bacteria 5057
278 Ga0373953_0020098 3300035117 Bacteria 2493
279 Ga0373953_0052158 3300035117 Bacteria 1655
280 Ga0373953_0147965 3300035117 Bacteria 1006
281 Ga0373954_0000445 3300035118 Bacteria 15476
282 Ga0373954_0016395 3300035118 Bacteria 3316
283 Ga0373956_0015215 3300035119 Bacteria 3219
284 Ga0373956_0034655 3300035119 Bacteria 2223
285 Ga0373956_0039236 3300035119 Bacteria 2098
286 Ga0373956_0044526 3300035119 Bacteria 1978
287 Ga0373956_0123417 3300035119 Bacteria 1210
288 Ga0373957_0001446 3300035120 Bacteria 6435
289 Ga0373943_0001478 3300035170 Bacteria 10640
290 Ga0373943_0006511 3300035170 Bacteria 5247
291 Ga0373943_0035254 3300035170 Bacteria 2390
292 Ga0373946_0024272 3300035171 Bacteria 2374
293 Ga0373946_0101768 3300035171 Bacteria 1289
294 Ga0373946_0141751 3300035171 Bacteria 1115
295 Ga0373955_0000310 3300035172 Bacteria 20214
296 Ga0373955_0000456 3300035172 Bacteria 17318
297 Ga0373955_0004242 3300035172 Bacteria 6332
298 Ga0316574_0000145 3300035398 Bacteria 22563
299 Ga0373924_0099306 3300035410 Bacteria 1251
300 Ga0373935_0000011 3300035692 Bacteria 89873
301 Ga0373935_0117456 3300035692 Bacteria 1773
302 Ga0373935_0173475 3300035692 Bacteria 1476
303 Ga0373935_0210499 3300035692 Bacteria 1347
304 Ga0373927_0018445 3300035695 Bacteria 4587
305 Ga0373927_0022396 3300035695 Bacteria 4139
306 Ga0373927_0032762 3300035695 Bacteria 3384
307 Ga0373927_0053021 3300035695 Bacteria 2623
308 Ga0373927_0114613 3300035695 Bacteria 1757
309 Ga0373933_0000315 3300035724 Bacteria 31397
310 Ga0373933_0001894 3300035724 Bacteria 12065
311 Ga0373933_0004896 3300035724 Bacteria 7308
312 Ga0373933_0009553 3300035724 Bacteria 5295
313 Ga0373933_0068023 3300035724 Bacteria 2163
314 Ga0373933_0229686 3300035724 Bacteria 1192
315 Ga0373947_0002093 3300035725 Bacteria 12167
316 Ga0373947_0027350 3300035725 Bacteria 3338
317 Ga0373947_0040197 3300035725 Bacteria 2785
318 Ga0373947_0207074 3300035725 Bacteria 1285
319 Ga0373937_0000019 3300036401 Bacteria 138568
320 Ga0373937_0001931 3300036401 Bacteria 17346
321 Ga0373937_0005293 3300036401 Bacteria 11025
322 Ga0373937_0041506 3300036401 Bacteria 4196
323 Ga0373937_0043108 3300036401 Bacteria 4117
324 Ga0373937_0050476 3300036401 Bacteria 3810
325 Ga0373937_0057234 3300036401 Bacteria 3581
326 Ga0373937_0145718 3300036401 Bacteria 2217
327 Ga0373937_0339950 3300036401 Bacteria 1421
328 Ga0265778_019593 3300036457 Bacteria 828
329 Ga0316582_0062945 3300036647 Bacteria 2383
330 Ga0316584_0043408 3300036712 Bacteria 3352
331 Ga0373925_0000048 3300037068 Bacteria 129615
332 Ga0373925_0012867 3300037068 Bacteria 6061
333 Ga0373925_0396408 3300037068 Bacteria 1125
334 Ga0395899_0009821 3300037312 Bacteria 7342
335 Ga0395899_0013258 3300037312 Bacteria 6308
336 Ga0395900_0028146 3300037418 Bacteria 5755
337 Ga0395898_0104572 3300037466 Bacteria 2715
338 Ga0436364_0305691 3300037853 Bacteria 1025
339 Ga0436364_0548592 3300037853 Bacteria 946
340 Ga0436364_1214892 3300037853 Bacteria 996
341 Ga0395901_0051442 3300038443 Bacteria 4283
342 Ga0395901_0111981 3300038443 Bacteria 2866
343 Ga0395901_0320363 3300038443 Bacteria 1604
344 Ga0395901_0441559 3300038443 Bacteria 1332
345 Ga0436365_1410225 3300039437 Bacteria 2990
346 Ga0436365_1620475 3300039437 Bacteria 1282
347 Ga0436365_1855567 3300039437 Bacteria 16138
348 Ga0436365_1890998 3300039437 Bacteria 3695
349 Ga0436365_1910356 3300039437 Bacteria 2164
350 Ga0436360_0440024 3300039438 Bacteria 1547
351 Ga0436360_0832565 3300039438 Bacteria 8060
352 Ga0436361_0360492 3300039447 Bacteria 1514
353 Ga0436363_0008346 3300039450 Bacteria 1206
354 Ga0436363_0611312 3300039450 Bacteria 947
355 Ga0436363_1081647 3300039450 Bacteria 2557
356 Ga0436363_1307539 3300039450 Bacteria 1380
357 Ga0436362_0343721 3300039453 Bacteria 1597
358 Ga0439439_0051495 3300041406 Bacteria 1080
359 Ga0439453_0041658 3300041408 Bacteria 902
360 Ga0451798_0309505 3300041458 Bacteria 1032
361 Ga0439443_011511 3300042003 Bacteria 1297
362 Ga0450923_013571 3300042125 Bacteria 1499
363 Ga0439458_0053291 3300042157 Bacteria 1001
364 Ga0439464_0025326 3300042439 Bacteria 1643
365 Ga0450893_0013879 3300042532 Bacteria 1347
366 Ga0466971_0078114 3300044719 Bacteria 1508
367 Ga0466967_0081276 3300045976 Bacteria 2927
368 Ga0495592_0000017 3300046454 Bacteria 142442
369 Ga0495592_0001796 3300046454 Bacteria 15099
370 Ga0495592_0003385 3300046454 Bacteria 11438
371 Ga0495591_057922 3300046458 Bacteria 1037
372 Ga0495629_0040146 3300046459 Bacteria 3292
373 Ga0495638_0034696 3300046460 Bacteria 3221
374 Ga0495641_0025187 3300046461 Bacteria 2922
375 Ga0495641_0168293 3300046461 Bacteria 981
376 Ga0495651_0000923 3300046462 Bacteria 22782
377 Ga0495651_0006369 3300046462 Bacteria 9032
378 Ga0495651_0054550 3300046462 Bacteria 3073
379 Ga0495651_0107774 3300046462 Bacteria 2064
380 Ga0495653_0000033 3300046463 Bacteria 131680
381 Ga0495653_0000987 3300046463 Bacteria 21890
382 Ga0495653_0001211 3300046463 Bacteria 19984
383 Ga0495653_0385847 3300046463 Bacteria 894
384 Ga0495582_0069408 3300046473 Bacteria 1948
385 Ga0495639_0018119 3300046475 Bacteria 3062
386 Ga0495639_0050651 3300046475 Bacteria 1887
387 Ga0495662_0037857 3300046476 Bacteria 2330
388 Ga0495664_0000008 3300046477 Bacteria 307158
389 Ga0495664_0046218 3300046477 Bacteria 2583
390 Ga0495664_0072946 3300046477 Bacteria 2052
391 Ga0495664_0196334 3300046477 Bacteria 1223
392 Ga0495585_0000389 3300046492 Bacteria 42431
393 Ga0495608_0000014 3300046511 Bacteria 221042
394 Ga0495608_0033393 3300046511 Bacteria 3478
395 Ga0495618_0000013 3300046514 Bacteria 168671
396 Ga0495618_0040055 3300046514 Bacteria 2947
397 Ga0495628_0000008 3300046516 Bacteria 284313
398 Ga0495628_0003849 3300046516 Bacteria 13361
399 Ga0495628_0054508 3300046516 Bacteria 3152
400 Ga0495628_0152051 3300046516 Bacteria 1762
401 Ga0495628_0243599 3300046516 Bacteria 1344
402 Ga0495630_0000797 3300046517 Bacteria 22206
403 Ga0495630_0051135 3300046517 Bacteria 3092
404 Ga0495637_0154191 3300046520 Bacteria 865
405 Ga0495644_0000373 3300046523 Bacteria 20312
406 Ga0495663_0046982 3300046525 Bacteria 1328
407 Ga0495666_0033440 3300046526 Bacteria 2511
408 Ga0495652_0000005 3300046529 Bacteria 524368
409 Ga0495652_0006346 3300046529 Bacteria 11012
410 Ga0495652_0032454 3300046529 Bacteria 4566
411 Ga0495652_0439637 3300046529 Bacteria 915
412 Ga0495665_0151267 3300046531 Bacteria 1211
413 Ga0495640_0000017 3300046533 Bacteria 138688
414 Ga0495640_0002174 3300046533 Bacteria 15677
415 Ga0495640_0048679 3300046533 Bacteria 2927
416 Ga0495640_0156194 3300046533 Bacteria 1464
417 Ga0495640_0332859 3300046533 Bacteria 939
418 Ga0495586_0312196 3300046535 Bacteria 901
419 Ga0495587_0000005 3300046536 Bacteria 358412
420 Ga0495587_0001202 3300046536 Bacteria 17146
421 Ga0495587_0035484 3300046536 Bacteria 3003
422 Ga0495587_0121730 3300046536 Bacteria 1494
423 Ga0495587_0233941 3300046536 Bacteria 1035
424 Ga0495598_0087651 3300046537 Bacteria 1009
425 Ga0495645_0000007 3300046543 Bacteria 376299
426 Ga0495645_0001074 3300046543 Bacteria 18551
427 Ga0495645_0042155 3300046543 Bacteria 3328
428 Ga0495645_0268809 3300046543 Bacteria 1126
429 Ga0495633_0006655 3300046558 Bacteria 6809
430 Ga0495667_0000012 3300046559 Bacteria 220967
431 Ga0495667_0000905 3300046559 Bacteria 19136
432 Ga0495667_0004405 3300046559 Bacteria 9495
433 Ga0495667_0014158 3300046559 Bacteria 5384
434 Ga0495667_0242628 3300046559 Bacteria 1147
435 Ga0495656_0002104 3300046615 Bacteria 6575
436 Ga0495634_0000070 3300046642 Bacteria 79664
437 Ga0495634_0019551 3300046642 Bacteria 4811
438 Ga0495634_0037227 3300046642 Bacteria 3325
439 Ga0495634_0265951 3300046642 Bacteria 1045
440 Ga0495635_0000010 3300046663 Bacteria 246385
441 Ga0495635_0003590 3300046663 Bacteria 10738
442 Ga0495659_0003751 3300046664 Bacteria 4831
443 Ga0495588_0015269 3300046674 Bacteria 3692
444 Ga0495657_0000178 3300046675 Bacteria 57139
445 Ga0495657_0020484 3300046675 Bacteria 4753
446 Ga0495657_0140535 3300046675 Bacteria 1505
447 Ga0495599_0000015 3300046678 Bacteria 175055
448 Ga0495599_0012323 3300046678 Bacteria 5266
449 Ga0495599_0054864 3300046678 Bacteria 2496
450 Ga0495599_0203610 3300046678 Bacteria 1215
451 Ga0495623_0000054 3300046679 Bacteria 70217
452 Ga0495623_0024201 3300046679 Bacteria 3916
453 Ga0495646_0000012 3300046680 Bacteria 185805
454 Ga0495646_0083868 3300046680 Bacteria 1851
455 Ga0495647_0080003 3300046681 Bacteria 1324
456 Ga0495647_0101405 3300046681 Bacteria 1192
457 Ga0495658_0024037 3300046683 Bacteria 3240
458 Ga0495658_0121856 3300046683 Bacteria 1578
459 Ga0495658_0137699 3300046683 Bacteria 1491
460 Ga0495613_0010812 3300046689 Bacteria 6771
461 Ga0495613_0011807 3300046689 Bacteria 6488
462 Ga0495624_0018068 3300046690 Bacteria 4721
463 Ga0495670_0000106 3300046691 Bacteria 37100
464 Ga0495600_0000031 3300046809 Bacteria 85535
465 Ga0495600_0000293 3300046809 Bacteria 26819
466 Ga0495600_0008849 3300046809 Bacteria 6200
467 Ga0495581_0019786 3300047315 Bacteria 3909
468 Ga0495581_0030496 3300047315 Bacteria 3124
469 Ga0495581_0179917 3300047315 Bacteria 1236
470 Ga0495604_0000001 3300047317 Bacteria 708627
471 Ga0495604_0003139 3300047317 Bacteria 13208
472 Ga0495604_0021273 3300047317 Bacteria 5178
473 Ga0495604_0058002 3300047317 Bacteria 2974
474 Ga0495604_0092509 3300047317 Bacteria 2240
475 Ga0495604_0215288 3300047317 Bacteria 1325
476 Ga0495604_0239232 3300047317 Bacteria 1242
477 Ga0495674_0000012 3300047319 Bacteria 270651
478 Ga0495674_0036514 3300047319 Bacteria 4422
479 Ga0495674_0056041 3300047319 Bacteria 3454
480 Ga0495674_0136213 3300047319 Bacteria 2066
481 Ga0495674_0383770 3300047319 Bacteria 1136
482 Ga0495676_0077187 3300047321 Bacteria 2541
483 Ga0495676_0111879 3300047321 Bacteria 2002
484 Ga0495680_0000483 3300047322 Bacteria 44818
485 Ga0495680_0011330 3300047322 Bacteria 7903
486 Ga0495680_0040789 3300047322 Bacteria 3696
487 Ga0495680_0079071 3300047322 Bacteria 2487
488 Ga0495675_0000500 3300047444 Bacteria 25407
489 Ga0495675_0009488 3300047444 Bacteria 6058
490 Ga0495679_044624 3300047446 Bacteria 1357
491 Ga0495685_069074 3300047447 Bacteria 1185
492 Ga0495684_0000021 3300047471 Bacteria 144901
493 Ga0495684_0117918 3300047471 Bacteria 2000
494 Ga0495684_0268751 3300047471 Bacteria 1234
495 Ga0495593_0000387 3300047673 Bacteria 24410
496 Ga0495593_0040640 3300047673 Bacteria 2503
497 Ga0495602_0000031 3300048088 Bacteria 141518
498 Ga0495602_0014374 3300048088 Bacteria 8039
499 Ga0495602_0031070 3300048088 Bacteria 5055
500 Ga0495602_0108292 3300048088 Bacteria 2263
501 Ga0495602_0282037 3300048088 Bacteria 1223
502 Ga0495614_0005015 3300048089 Bacteria 5973
503 Ga0495614_0076720 3300048089 Bacteria 1445
504 Ga0495615_0049002 3300048090 Bacteria 1081
505 Ga0496100_0007708 3300048903 Bacteria 5959
506 Ga0496100_0100101 3300048903 Bacteria 1996
507 Ga0496100_0158715 3300048903 Bacteria 1620
508 Ga0496101_0368609 3300048904 Bacteria 1129
509 Ga0496101_0610585 3300048904 Bacteria 862
510 Ga0496104_0006199 3300048907 Bacteria 10503
511 Ga0496104_0124558 3300048907 Bacteria 2474
512 Ga0496105_0246905 3300048908 Bacteria 1447
513 Ga0496106_0385086 3300048909 Bacteria 1127
514 Ga0496106_0444866 3300048909 Bacteria 1041
515 Ga0496107_0283282 3300048910 Bacteria 1233
516 Ga0496107_0394978 3300048910 Bacteria 1029
517 Ga0496109_0070082 3300048912 Bacteria 3217
518 Ga0496110_0050779 3300048913 Bacteria 3643
519 Ga0496112_0051251 3300048915 Bacteria 4048
520 Ga0496112_0250944 3300048915 Bacteria 1720
521 Ga0496112_0397824 3300048915 Bacteria 1317
522 Ga0496113_0043582 3300048916 Bacteria 3321
523 Ga0496114_0068181 3300048917 Bacteria 2986
524 Ga0496114_0083899 3300048917 Bacteria 2697
525 Ga0496114_0109828 3300048917 Bacteria 2362
526 Ga0496115_0121428 3300048918 Bacteria 2150
527 Ga0496115_0190556 3300048918 Bacteria 1694
528 Ga0496126_0015811 3300048929 Bacteria 7580
529 Ga0496126_0042509 3300048929 Bacteria 4197
530 Ga0501031_0002913 3300049568 Bacteria 10943
531 Ga0501032_0001960 3300049569 Bacteria 16196
532 Ga0501032_0129048 3300049569 Bacteria 1669
533 Ga0501033_0014226 3300049570 Bacteria 6048
534 Ga0501033_0021483 3300049570 Bacteria 4869
535 Ga0501034_0003727 3300049571 Bacteria 17214
536 Ga0501034_0487980 3300049571 Bacteria 1147
537 Ga0501036_0015848 3300049572 Bacteria 6294
538 Ga0501036_0279009 3300049572 Bacteria 1399
539 Ga0501037_0010686 3300049573 Bacteria 6745
540 Ga0501037_0287712 3300049573 Bacteria 1144
541 Ga0501038_0008913 3300049574 Bacteria 9204
542 Ga0501038_0205971 3300049574 Bacteria 1576
543 Ga0501039_0001032 3300049575 Bacteria 20355
544 Ga0501042_0102050 3300049578 Bacteria 2063
545 Ga0501043_0022908 3300049579 Bacteria 4897
546 Ga0501043_0047745 3300049579 Bacteria 3366
547 Ga0501043_0328019 3300049579 Bacteria 1166
548 Ga0501046_0000897 3300049580 Bacteria 29016
549 Ga0501046_0314087 3300049580 Bacteria 1143
550 Ga0501047_0023976 3300049581 Bacteria 5859
551 Ga0501047_0036900 3300049581 Bacteria 4724
552 Ga0501047_0091531 3300049581 Bacteria 2920
553 Ga0501047_0352092 3300049581 Bacteria 1309
554 Ga0501047_0559659 3300049581 Bacteria 967
555 Ga0501048_0006504 3300049582 Bacteria 8882
556 Ga0501067_0032125 3300049583 Bacteria 2913
557 Ga0501068_0001271 3300049584 Bacteria 13384
558 Ga0501068_0109336 3300049584 Bacteria 1718
559 Ga0501069_0000490 3300049585 Bacteria 18056
560 Ga0501070_0012403 3300049586 Bacteria 7188
561 Ga0501070_0023540 3300049586 Bacteria 5159
562 Ga0501070_0067905 3300049586 Bacteria 2952
563 Ga0501071_0012141 3300049587 Bacteria 5829
564 Ga0501071_0169366 3300049587 Bacteria 1635
565 Ga0501072_0003460 3300049588 Bacteria 11898
566 Ga0501072_0004379 3300049588 Bacteria 10721
567 Ga0501072_0210737 3300049588 Bacteria 1548
568 Ga0501072_0589670 3300049588 Bacteria 877
569 Ga0501073_0001330 3300049589 Bacteria 18204
570 Ga0501073_0059989 3300049589 Bacteria 2655
571 Ga0501074_0001714 3300049590 Bacteria 14964
572 Ga0501074_0115632 3300049590 Bacteria 1919
573 Ga0501075_0027955 3300049591 Bacteria 4159
574 Ga0501075_0110810 3300049591 Bacteria 2087
575 Ga0501076_0397553 3300049592 Bacteria 1133
576 Ga0501076_0474424 3300049592 Bacteria 1031
577 Ga0501076_0659582 3300049592 Bacteria 863
578 Ga0501077_0013421 3300049593 Bacteria 5138
579 Ga0501077_0037268 3300049593 Bacteria 3098
580 Ga0501079_0017343 3300049741 Bacteria 5499
581 Ga0501079_0114417 3300049741 Bacteria 2097
582 Ga0501080_0005290 3300049742 Bacteria 11492
583 Ga0501080_0049606 3300049742 Bacteria 3907
584 Ga0501080_0129312 3300049742 Bacteria 2338
585 Ga0501080_0259571 3300049742 Bacteria 1583
586 Ga0501081_0120944 3300049743 Bacteria 1865
587 Ga0501081_0344456 3300049743 Bacteria 1098
588 Ga0501083_0006952 3300049744 Bacteria 8028
589 Ga0501083_0033311 3300049744 Bacteria 3529
590 Ga0501083_0058798 3300049744 Bacteria 2572
591 Ga0501083_0071562 3300049744 Bacteria 2305
592 Ga0501035_0016898 3300049822 Bacteria 6727
593 Ga0501035_0040812 3300049822 Bacteria 4192
594 Ga0501035_0094431 3300049822 Bacteria 2630
595 Ga0501044_0004609 3300049823 Bacteria 15418
596 Ga0501044_0030415 3300049823 Bacteria 5691
597 Ga0501044_0086053 3300049823 Bacteria 3176
598 Ga0501044_0594138 3300049823 Bacteria 1000
599 Ga0501045_0014635 3300049824 Bacteria 5562
600 Ga0501045_0374458 3300049824 Bacteria 1060
601 nmdc:mga03683_96864_c1 3300050489 Bacteria 1293
602 nmdc:mga03n38_55175_c1 3300050490 Bacteria 1789
603 nmdc:mga00v17_70140_c1 3300050491 Bacteria 2170
604 nmdc:mga0yw44_49170_c1 3300050492 Bacteria 2544
605 nmdc:mga0k408_145779_c1 3300050493 Bacteria 1409
606 nmdc:mga0k408_95583_c1 3300050493 Bacteria 1748
607 nmdc:mga06z11_9341_c1 3300050494 Bacteria 4129
608 nmdc:mga07m45_423703_c1 3300050496 Bacteria 772
609 nmdc:mga07m45_53357_c1 3300050496 Bacteria 2284
610 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
611 nmdc:mga05p37_397809_c1 3300050507 Bacteria 1609
612 nmdc:mga05p37_4690_c1 3300050507 Bacteria 15966
613 nmdc:mga05p37_714414_c1 3300050507 Bacteria 1111
614 nmdc:mga05p37_8335_c1 3300050507 Bacteria 12261
615 nmdc:mga09592_123530_c1 3300050508 Bacteria 2224
616 nmdc:mga09592_1297_c1 3300050508 Bacteria 20091
617 nmdc:mga0qj67_187623_c1 3300050509 Bacteria 1680
618 nmdc:mga0qj67_20786_c1 3300050509 Bacteria 5026
619 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
620 nmdc:mga06r32_1133_c1 3300050510 Bacteria 23910
621 nmdc:mga06r32_20691_c1 3300050510 Bacteria 6061
622 nmdc:mga06r32_304636_c1 3300050510 Bacteria 1579
623 nmdc:mga08y16_221041_c1 3300050511 Bacteria 1961
624 nmdc:mga08y16_354_c1 3300050511 Bacteria 41427
625 nmdc:mga08y16_87928_c1 3300050511 Bacteria 3238
626 nmdc:mga08y16_917950_c1 3300050511 Bacteria 861
627 nmdc:mga0n895_114398_c1 3300050512 Bacteria 2716
628 nmdc:mga0n895_31979_c1 3300050512 Bacteria 5045
629 nmdc:mga0n895_58419_c1 3300050512 Bacteria 3803
630 nmdc:mga0n895_701_c1 3300050512 Bacteria 23539
631 nmdc:mga0rr50_10515_c1 3300050513 Bacteria 5875
632 nmdc:mga0rr50_35347_c1 3300050513 Bacteria 3588
633 nmdc:mga0a205_21253_c1 3300050515 Bacteria 6138
634 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
635 nmdc:mga0sz30_1915_c1 3300050516 Bacteria 7430
636 nmdc:mga0sz30_45391_c1 3300050516 Bacteria 1853
637 Ga0495601_0000011 3300053077 Bacteria 264937
638 Ga0495601_0015267 3300053077 Bacteria 4641
639 Ga0495601_0042986 3300053077 Bacteria 2837
640 Ga0495601_0065052 3300053077 Bacteria 2320
641 Ga0495601_0066178 3300053077 Bacteria 2300
642 Ga0495601_0085934 3300053077 Bacteria 2021
643 Ga0495612_0000006 3300053078 Bacteria 269278
644 Ga0495612_0000089 3300053078 Bacteria 40250
645 Ga0495612_0005230 3300053078 Bacteria 5360
646 Ga0495612_0043377 3300053078 Bacteria 1837
647 Ga0495612_0050167 3300053078 Bacteria 1713
648 Ga0495655_0002001 3300053083 Bacteria 3188
649 Ga0495595_0000021 3300053084 Bacteria 115921
650 Ga0495595_0018109 3300053084 Bacteria 3039
651 Ga0495595_0068379 3300053084 Bacteria 1675
652 Ga0495595_0223661 3300053084 Bacteria 939
653 Ga0495619_0000013 3300053085 Bacteria 264865
654 Ga0495619_0001549 3300053085 Bacteria 15135
655 Ga0495619_0020373 3300053085 Bacteria 4222
656 Ga0500646_0142164 3300053090 Bacteria 788
657 Ga0500583_0208224 3300053092 Bacteria 971
658 Ga0500651_0087411 3300053093 Bacteria 1924
659 Ga0500651_0117410 3300053093 Bacteria 1618
660 Ga0500641_0159619 3300053096 Bacteria 972
661 Ga0500555_020690 3300053103 Bacteria 1895
662 Ga0500562_027598 3300053108 Bacteria 1490
663 Ga0500593_002685 3300053117 Bacteria 6578
664 Ga0500594_0086433 3300053118 Bacteria 946
665 Ga0500642_0026283 3300053130 Bacteria 2375
666 Ga0500577_0236081 3300053142 Bacteria 793
667 Ga0500604_0113132 3300053151 Bacteria 902
668 Ga0500616_0002635 3300053153 Bacteria 14631
669 Ga0500620_129648 3300053155 Bacteria 883
670 Ga0500627_0060635 3300053158 Bacteria 1664
671 Ga0500611_043870 3300053727 Bacteria 995
672 Ga0501084_0030212 3300054114 Bacteria 4531
673 Ga0501084_0422951 3300054114 Bacteria 1126
674 Ga0501084_0488303 3300054114 Bacteria 1041
675 Ga0590071_058722 3300059421 Bacteria 938
676 Ga0587092_033054 3300059512 Bacteria 866
677 Ga0587106_020398 3300059605 Bacteria 978
678 Ga0587108_005203 3300059653 Bacteria 974
679 Ga0587111_0007632 3300060346 Bacteria 1764
680 Ga0501082_0043600 3300060353 Bacteria 3868
681 Ga0501082_0065082 3300060353 Bacteria 3139
682 Ga0501082_0249051 3300060353 Bacteria 1546
683 Ga0501082_0501108 3300060353 Bacteria 1061
684 Ga0530510_0031863 3300061734 Bacteria 3791
685 2643758246 2643221547 Bacteria 4740017
686 Ga0501083_0241352
687 JGI24751J29686_10004988
688 JGI25406J46586_10008857
689 JGI25153J46596_10001402
690 JGI25153J46596_10004909
691 Ga0055527_1000348
692 Ga0055535_1000137
693 Ga0055542_1008635
694 Ga0055529_1005228
695 Ga0055529_1012897
696 Ga0058859_11740191
697 Ga0058860_12182228
698 Ga0058862_12589958
699 Ga0058862_12880575
700 Ga0065707_10217266
701 Ga0070670_100073795
702 Ga0068869_100257574
703 Ga0068868_100176757
704 Ga0070689_100243052
705 Ga0070668_100136068
706 Ga0070669_100100970
707 Ga0070669_100145045
708 Ga0070675_100026991
709 Ga0070675_100133330
710 Ga0070675_100370162
711 Ga0070671_100005912
712 Ga0070674_100021767
713 Ga0070674_100835671
714 Ga0070673_100083880
715 Ga0070688_100099172
716 Ga0070667_100113718
717 Ga0070667_100330999
718 Ga0070709_10039119
719 Ga0070709_10177453
720 Ga0070714_100071523
721 Ga0070714_100226570
722 Ga0070713_100504625
723 Ga0070710_10071096
724 Ga0070701_10171535
725 Ga0070701_10495026
726 Ga0070711_100141313
727 Ga0070700_100254832
728 Ga0070708_100084345
729 Ga0070681_10059291
730 Ga0068867_100050608
731 Ga0070685_10018946
732 Ga0070685_10300453
733 Ga0070699_100309949
734 Ga0070679_100048126
735 Ga0070679_100218279
736 Ga0070672_100075006
737 Ga0070695_100249106
738 Ga0070665_100383592
739 Ga0070664_100075564
740 Ga0070702_100130906
741 Ga0068859_100027770
742 Ga0068864_100007555
743 Ga0068870_10397914
744 Ga0068858_100373962
745 Ga0068860_100351676
746 Ga0068862_100121391
747 Ga0068862_100393608
748 Ga0081538_10124878
749 Ga0081540_1001109
750 Ga0081539_10003227
751 Ga0070717_10079339
752 Ga0070717_10514261
753 Ga0075365_10053864
754 Ga0075365_10098968
755 Ga0075368_10085825
756 Ga0075363_100015573
757 Ga0075364_10016731
758 Ga0070715_10172002
759 Ga0075367_10093438
760 Ga0075367_10229203
761 Ga0075367_10232165
762 Ga0075369_10028288
763 Ga0075369_10069978
764 Ga0075369_10202646
765 Ga0075427_10000389
766 Ga0075366_10010635
767 Ga0075366_10152062
768 Ga0075370_10012948
769 Ga0075370_10046449
770 Ga0075370_10294985
771 Ga0075428_100007998
772 Ga0075428_100058970
773 Ga0075428_100111881
774 Ga0075430_100000032
775 Ga0075430_100094433
776 Ga0075431_100000903
777 Ga0075431_100052467
778 Ga0075431_100167999
779 Ga0075431_100483701
780 Ga0075433_10017192
781 Ga0075433_10019599
782 Ga0075434_100000271
783 Ga0075434_100009740
784 Ga0075434_100011424
785 Ga0075434_100705248
786 Ga0075429_100000561
787 Ga0075429_100007528
788 Ga0097620_100027770
789 Ga0075435_100033962
790 Ga0075435_100035256
791 Ga0075435_100049397
792 Ga0099794_10023255
793 Ga0099795_10016161
794 Ga0111539_10001270
795 Ga0111539_10106024
796 Ga0111539_10230550
797 Ga0105245_10787318
798 Ga0105247_10345618
799 Ga0114129_10001444
800 Ga0114129_10395943
801 Ga0114129_10488916
802 Ga0105243_10622346
803 Ga0105243_10798172
804 Ga0105248_10130763
805 Ga0105238_10122440
806 Ga0105238_10457467
807 Ga0105249_10282604
808 Ga0099796_10022382
809 Ga0099796_10116269
810 Ga0157370_10057496
811 Ga0157370_10191953
812 Ga0157370_10471142
813 Ga0157374_10199033
814 Ga0157374_10473994
815 Ga0157375_10071761
816 Ga0157375_10618559
817 Ga0157375_11151307
818 Ga0157380_10316693
819 Ga0163161_10219279
820 Ga0184601_134529
821 Ga0197907_10241108
822 Ga0197907_11149821
823 Ga0206356_10058304
824 Ga0206356_11190054
825 Ga0206349_1686143
826 Ga0206355_1367406
827 Ga0206351_10671826
828 Ga0206351_10851183
829 Ga0206352_10130377
830 Ga0206352_10630827
831 Ga0206350_10136915
832 Ga0206350_11242039
833 Ga0206354_10364600
834 Ga0206353_10033645
835 Ga0206353_10830196
836 Ga0213874_10073401
837 Ga0213876_10005720
838 Ga0213871_10042533
839 Ga0224712_10182174
840 Ga0224572_1031817
841 Ga0228598_1013306
842 Ga0209672_100015
843 Ga0209147_100016
844 Ga0209258_100026
845 Ga0209148_1000952
846 Ga0209148_1006961
847 Ga0209455_1000321
848 Ga0209455_1000544
849 Ga0209758_1000469
850 Ga0209758_1088120
851 Ga0207682_10000722
852 Ga0207692_10065966
853 Ga0207692_10073172
854 Ga0207688_10083701
855 Ga0207685_10153223
856 Ga0207699_10050154
857 Ga0207645_10020586
858 Ga0207645_10111527
859 Ga0207654_10369880
860 Ga0207707_10116011
861 Ga0207693_10017643
862 Ga0207660_10084805
863 Ga0207662_10026247
864 Ga0207649_10328407
865 Ga0207652_10248325
866 Ga0207652_10631978
867 Ga0207681_10091132
868 Ga0207681_10432867
869 Ga0207650_10003045
870 Ga0207659_10170772
871 Ga0207659_10288923
872 Ga0207659_10510969
873 Ga0207687_10084817
874 Ga0207687_10175773
875 Ga0207700_10043617
876 Ga0207700_10106049
877 Ga0207664_10597058
878 Ga0207644_10003250
879 Ga0207690_10140463
880 Ga0207706_10575797
881 Ga0207669_10071094
882 Ga0207669_10192897
883 Ga0207665_10234830
884 Ga0207691_10003529
885 Ga0207691_10131990
886 Ga0207691_10158744
887 Ga0207689_10196599
888 Ga0207689_10231147
889 Ga0207679_10063581
890 Ga0207651_10000859
891 Ga0207712_10164602
892 Ga0207668_10093724
893 Ga0207658_10062401
894 Ga0207658_10149656
895 Ga0207703_10274460
896 Ga0207678_10402337
897 Ga0207708_10451360
898 Ga0207708_10477546
899 Ga0207648_10177525
900 Ga0207676_10023059
901 Ga0207674_10186439
902 Ga0207675_100294924
903 Ga0207683_10013489
904 Ga0207683_10121660
905 Ga0209179_1004914
906 Ga0209588_1031078
907 Ga0209813_10066764
908 Ga0207428_10000082
909 Ga0207428_10154679
910 Ga0207428_10449065
911 Ga0268265_10357194
912 Ga0268264_10411625
913 Ga0268264_11084638
914 Ga0265334_10001877
915 Ga0265318_10008385
916 Ga0265338_10068313
917 Ga0265338_10081565
918 Ga0265330_10009843
919 Ga0265332_10007464
920 Ga0265325_10002531
921 Ga0265325_10004291
922 Ga0265325_10005464
923 Ga0265325_10016732
924 Ga0265325_10019267
925 Ga0265325_10033863
926 Ga0265340_10006803
927 Ga0265340_10010861
928 Ga0265340_10042659
929 Ga0265340_10073607
930 Ga0265339_10000126
931 Ga0265339_10019847
932 Ga0265331_10029658
933 Ga0265331_10044220
934 Ga0265316_10016618
935 Ga0265316_10246298
936 Ga0307513_10012476
937 Ga0307513_10170943
938 Ga0265313_10000054
939 Ga0265313_10000593
940 Ga0265313_10009618
941 Ga0265313_10016449
942 Ga0316575_10040077
943 Ga0265314_10144700
944 Ga0265342_10000034
945 Ga0265342_10012408
946 Ga0316576_10252323
947 Ga0307516_10205444
948 Ga0307405_10308451
949 Ga0307413_10413909
950 Ga0307416_100962018
951 Ga0316583_10002336
952 Ga0316583_10034329
953 Ga0316593_10186110
954 Ga0316592_1067264
955 Ga0316587_1035520
956 Ga0316596_1087836
957 Ga0316596_1107409
958 Ga0373923_0029554
959 Ga0373923_0038540
960 Ga0373923_0213495
961 Ga0373945_0015071
962 Ga0373953_0003215
963 Ga0373953_0020098
964 Ga0373953_0052158
965 Ga0373953_0147965
966 Ga0373954_0000445
967 Ga0373954_0016395
968 Ga0373956_0015215
969 Ga0373956_0034655
970 Ga0373956_0039236
971 Ga0373956_0044526
972 Ga0373956_0123417
973 Ga0373957_0001446
974 Ga0373943_0001478
975 Ga0373943_0006511
976 Ga0373943_0035254
977 Ga0373946_0024272
978 Ga0373946_0101768
979 Ga0373946_0141751
980 Ga0373955_0000310
981 Ga0373955_0000456
982 Ga0373955_0004242
983 Ga0316574_0000145
984 Ga0373924_0099306
985 Ga0373935_0000011
986 Ga0373935_0117456
987 Ga0373935_0173475
988 Ga0373935_0210499
989 Ga0373927_0018445
990 Ga0373927_0022396
991 Ga0373927_0032762
992 Ga0373927_0053021
993 Ga0373927_0114613
994 Ga0373933_0000315
995 Ga0373933_0001894
996 Ga0373933_0004896
997 Ga0373933_0009553
998 Ga0373933_0068023
999 Ga0373933_0229686
1000 Ga0373947_0002093
1001 Ga0373947_0027350
1002 Ga0373947_0040197
1003 Ga0373947_0207074
1004 Ga0373937_0000019
1005 Ga0373937_0001931
1006 Ga0373937_0005293
1007 Ga0373937_0041506
1008 Ga0373937_0043108
1009 Ga0373937_0050476
1010 Ga0373937_0057234
1011 Ga0373937_0145718
1012 Ga0373937_0339950
1013 Ga0265778_019593
1014 Ga0316582_0062945
1015 Ga0316584_0043408
1016 Ga0373925_0000048
1017 Ga0373925_0012867
1018 Ga0373925_0396408
1019 Ga0395899_0009821
1020 Ga0395899_0013258
1021 Ga0395900_0028146
1022 Ga0395898_0104572
1023 Ga0436364_0305691
1024 Ga0436364_0548592
1025 Ga0436364_1214892
1026 Ga0395901_0051442
1027 Ga0395901_0111981
1028 Ga0395901_0320363
1029 Ga0395901_0441559
1030 Ga0436365_1410225
1031 Ga0436365_1620475
1032 Ga0436365_1855567
1033 Ga0436365_1890998
1034 Ga0436365_1910356
1035 Ga0436360_0440024
1036 Ga0436360_0832565
1037 Ga0436361_0360492
1038 Ga0436363_0008346
1039 Ga0436363_0611312
1040 Ga0436363_1081647
1041 Ga0436363_1307539
1042 Ga0436362_0343721
1043 Ga0439439_0051495
1044 Ga0439453_0041658
1045 Ga0451798_0309505
1046 Ga0439443_011511
1047 Ga0450923_013571
1048 Ga0439458_0053291
1049 Ga0439464_0025326
1050 Ga0450893_0013879
1051 Ga0466971_0078114
1052 Ga0466967_0081276
1053 Ga0495592_0000017
1054 Ga0495592_0001796
1055 Ga0495592_0003385
1056 Ga0495591_057922
1057 Ga0495629_0040146
1058 Ga0495638_0034696
1059 Ga0495641_0025187
1060 Ga0495641_0168293
1061 Ga0495651_0000923
1062 Ga0495651_0006369
1063 Ga0495651_0054550
1064 Ga0495651_0107774
1065 Ga0495653_0000033
1066 Ga0495653_0000987
1067 Ga0495653_0001211
1068 Ga0495653_0385847
1069 Ga0495582_0069408
1070 Ga0495639_0018119
1071 Ga0495639_0050651
1072 Ga0495662_0037857
1073 Ga0495664_0000008
1074 Ga0495664_0046218
1075 Ga0495664_0072946
1076 Ga0495664_0196334
1077 Ga0495585_0000389
1078 Ga0495608_0000014
1079 Ga0495608_0033393
1080 Ga0495618_0000013
1081 Ga0495618_0040055
1082 Ga0495628_0000008
1083 Ga0495628_0003849
1084 Ga0495628_0054508
1085 Ga0495628_0152051
1086 Ga0495628_0243599
1087 Ga0495630_0000797
1088 Ga0495630_0051135
1089 Ga0495637_0154191
1090 Ga0495644_0000373
1091 Ga0495663_0046982
1092 Ga0495666_0033440
1093 Ga0495652_0000005
1094 Ga0495652_0006346
1095 Ga0495652_0032454
1096 Ga0495652_0439637
1097 Ga0495665_0151267
1098 Ga0495640_0000017
1099 Ga0495640_0002174
1100 Ga0495640_0048679
1101 Ga0495640_0156194
1102 Ga0495640_0332859
1103 Ga0495586_0312196
1104 Ga0495587_0000005
1105 Ga0495587_0001202
1106 Ga0495587_0035484
1107 Ga0495587_0121730
1108 Ga0495587_0233941
1109 Ga0495598_0087651
1110 Ga0495645_0000007
1111 Ga0495645_0001074
1112 Ga0495645_0042155
1113 Ga0495645_0268809
1114 Ga0495633_0006655
1115 Ga0495667_0000012
1116 Ga0495667_0000905
1117 Ga0495667_0004405
1118 Ga0495667_0014158
1119 Ga0495667_0242628
1120 Ga0495656_0002104
1121 Ga0495634_0000070
1122 Ga0495634_0019551
1123 Ga0495634_0037227
1124 Ga0495634_0265951
1125 Ga0495635_0000010
1126 Ga0495635_0003590
1127 Ga0495659_0003751
1128 Ga0495588_0015269
1129 Ga0495657_0000178
1130 Ga0495657_0020484
1131 Ga0495657_0140535
1132 Ga0495599_0000015
1133 Ga0495599_0012323
1134 Ga0495599_0054864
1135 Ga0495599_0203610
1136 Ga0495623_0000054
1137 Ga0495623_0024201
1138 Ga0495646_0000012
1139 Ga0495646_0083868
1140 Ga0495647_0080003
1141 Ga0495647_0101405
1142 Ga0495658_0024037
1143 Ga0495658_0121856
1144 Ga0495658_0137699
1145 Ga0495613_0010812
1146 Ga0495613_0011807
1147 Ga0495624_0018068
1148 Ga0495670_0000106
1149 Ga0495600_0000031
1150 Ga0495600_0000293
1151 Ga0495600_0008849
1152 Ga0495581_0019786
1153 Ga0495581_0030496
1154 Ga0495581_0179917
1155 Ga0495604_0000001
1156 Ga0495604_0003139
1157 Ga0495604_0021273
1158 Ga0495604_0058002
1159 Ga0495604_0092509
1160 Ga0495604_0215288
1161 Ga0495604_0239232
1162 Ga0495674_0000012
1163 Ga0495674_0036514
1164 Ga0495674_0056041
1165 Ga0495674_0136213
1166 Ga0495674_0383770
1167 Ga0495676_0077187
1168 Ga0495676_0111879
1169 Ga0495680_0000483
1170 Ga0495680_0011330
1171 Ga0495680_0040789
1172 Ga0495680_0079071
1173 Ga0495675_0000500
1174 Ga0495675_0009488
1175 Ga0495679_044624
1176 Ga0495685_069074
1177 Ga0495684_0000021
1178 Ga0495684_0117918
1179 Ga0495684_0268751
1180 Ga0495593_0000387
1181 Ga0495593_0040640
1182 Ga0495602_0000031
1183 Ga0495602_0014374
1184 Ga0495602_0031070
1185 Ga0495602_0108292
1186 Ga0495602_0282037
1187 Ga0495614_0005015
1188 Ga0495614_0076720
1189 Ga0495615_0049002
1190 Ga0496100_0007708
1191 Ga0496100_0100101
1192 Ga0496100_0158715
1193 Ga0496101_0368609
1194 Ga0496101_0610585
1195 Ga0496104_0006199
1196 Ga0496104_0124558
1197 Ga0496105_0246905
1198 Ga0496106_0385086
1199 Ga0496106_0444866
1200 Ga0496107_0283282
1201 Ga0496107_0394978
1202 Ga0496109_0070082
1203 Ga0496110_0050779
1204 Ga0496112_0051251
1205 Ga0496112_0250944
1206 Ga0496112_0397824
1207 Ga0496113_0043582
1208 Ga0496114_0068181
1209 Ga0496114_0083899
1210 Ga0496114_0109828
1211 Ga0496115_0121428
1212 Ga0496115_0190556
1213 Ga0496126_0015811
1214 Ga0496126_0042509
1215 Ga0501031_0002913
1216 Ga0501032_0001960
1217 Ga0501032_0129048
1218 Ga0501033_0014226
1219 Ga0501033_0021483
1220 Ga0501034_0003727
1221 Ga0501034_0487980
1222 Ga0501036_0015848
1223 Ga0501036_0279009
1224 Ga0501037_0010686
1225 Ga0501037_0287712
1226 Ga0501038_0008913
1227 Ga0501038_0205971
1228 Ga0501039_0001032
1229 Ga0501042_0102050
1230 Ga0501043_0022908
1231 Ga0501043_0047745
1232 Ga0501043_0328019
1233 Ga0501046_0000897
1234 Ga0501046_0314087
1235 Ga0501047_0023976
1236 Ga0501047_0036900
1237 Ga0501047_0091531
1238 Ga0501047_0352092
1239 Ga0501047_0559659
1240 Ga0501048_0006504
1241 Ga0501067_0032125
1242 Ga0501068_0001271
1243 Ga0501068_0109336
1244 Ga0501069_0000490
1245 Ga0501070_0012403
1246 Ga0501070_0023540
1247 Ga0501070_0067905
1248 Ga0501071_0012141
1249 Ga0501071_0169366
1250 Ga0501072_0003460
1251 Ga0501072_0004379
1252 Ga0501072_0210737
1253 Ga0501072_0589670
1254 Ga0501073_0001330
1255 Ga0501073_0059989
1256 Ga0501074_0001714
1257 Ga0501074_0115632
1258 Ga0501075_0027955
1259 Ga0501075_0110810
1260 Ga0501076_0397553
1261 Ga0501076_0474424
1262 Ga0501076_0659582
1263 Ga0501077_0013421
1264 Ga0501077_0037268
1265 Ga0501079_0017343
1266 Ga0501079_0114417
1267 Ga0501080_0005290
1268 Ga0501080_0049606
1269 Ga0501080_0129312
1270 Ga0501080_0259571
1271 Ga0501081_0120944
1272 Ga0501081_0344456
1273 Ga0501083_0006952
1274 Ga0501083_0033311
1275 Ga0501083_0058798
1276 Ga0501083_0071562
1277 Ga0501035_0016898
1278 Ga0501035_0040812
1279 Ga0501035_0094431
1280 Ga0501044_0004609
1281 Ga0501044_0030415
1282 Ga0501044_0086053
1283 Ga0501044_0594138
1284 Ga0501045_0014635
1285 Ga0501045_0374458
1286 nmdc:mga03683_96864_c1
1287 nmdc:mga03n38_55175_c1
1288 nmdc:mga00v17_70140_c1
1289 nmdc:mga0yw44_49170_c1
1290 nmdc:mga0k408_145779_c1
1291 nmdc:mga0k408_95583_c1
1292 nmdc:mga06z11_9341_c1
1293 nmdc:mga07m45_423703_c1
1294 nmdc:mga07m45_53357_c1
1295 nmdc:mga05p37_19_c2
1296 nmdc:mga05p37_397809_c1
1297 nmdc:mga05p37_4690_c1
1298 nmdc:mga05p37_714414_c1
1299 nmdc:mga05p37_8335_c1
1300 nmdc:mga09592_123530_c1
1301 nmdc:mga09592_1297_c1
1302 nmdc:mga0qj67_187623_c1
1303 nmdc:mga0qj67_20786_c1
1304 nmdc:mga0qj67_259_c1
1305 nmdc:mga06r32_1133_c1
1306 nmdc:mga06r32_20691_c1
1307 nmdc:mga06r32_304636_c1
1308 nmdc:mga08y16_221041_c1
1309 nmdc:mga08y16_354_c1
1310 nmdc:mga08y16_87928_c1
1311 nmdc:mga08y16_917950_c1
1312 nmdc:mga0n895_114398_c1
1313 nmdc:mga0n895_31979_c1
1314 nmdc:mga0n895_58419_c1
1315 nmdc:mga0n895_701_c1
1316 nmdc:mga0rr50_10515_c1
1317 nmdc:mga0rr50_35347_c1
1318 nmdc:mga0a205_21253_c1
1319 nmdc:mga0a205_249_c1
1320 nmdc:mga0sz30_1915_c1
1321 nmdc:mga0sz30_45391_c1
1322 Ga0495601_0000011
1323 Ga0495601_0015267
1324 Ga0495601_0042986
1325 Ga0495601_0065052
1326 Ga0495601_0066178
1327 Ga0495601_0085934
1328 Ga0495612_0000006
1329 Ga0495612_0000089
1330 Ga0495612_0005230
1331 Ga0495612_0043377
1332 Ga0495612_0050167
1333 Ga0495655_0002001
1334 Ga0495595_0000021
1335 Ga0495595_0018109
1336 Ga0495595_0068379
1337 Ga0495595_0223661
1338 Ga0495619_0000013
1339 Ga0495619_0001549
1340 Ga0495619_0020373
1341 Ga0500646_0142164
1342 Ga0500583_0208224
1343 Ga0500651_0087411
1344 Ga0500651_0117410
1345 Ga0500641_0159619
1346 Ga0500555_020690
1347 Ga0500562_027598
1348 Ga0500593_002685
1349 Ga0500594_0086433
1350 Ga0500642_0026283
1351 Ga0500577_0236081
1352 Ga0500604_0113132
1353 Ga0500616_0002635
1354 Ga0500620_129648
1355 Ga0500627_0060635
1356 Ga0500611_043870
1357 Ga0501084_0030212
1358 Ga0501084_0422951
1359 Ga0501084_0488303
1360 Ga0590071_058722
1361 Ga0587092_033054
1362 Ga0587106_020398
1363 Ga0587108_005203
1364 Ga0587111_0007632
1365 Ga0501082_0043600
1366 Ga0501082_0065082
1367 Ga0501082_0249051
1368 Ga0501082_0501108
1369 Ga0530510_0031863
1370 2643758246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

66

291

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.8584 29 252
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8541 29 252
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.8393 29 254
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8337 29 252
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.8315 29 254
ID Description Score Start End Superfamily
af_P0AAC4_18_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9246 29 252 1.20.1250.20
af_P0AAC4_18_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9121 29 252 1.20.1250.20
af_Q4DZH5_101_300_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8818 29 248 1.20.1250.20
af_O74888_1_266_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8811 26 253 1.20.1250.20
af_P0AAC6_18_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8773 29 250 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A435NBU8-F1-model_v4 deleted 0.9913 116 256
AF-A0A2D5WXY5-F1-model_v4 BAX inhibitor (BI)-1/YccA family protein 0.9797 115 256 GO:0005886
AF-A0A435NBU8-F1-model_v4 deleted 0.9775 116 256
AF-A0A1F3AYZ5-F1-model_v4 SecY protein 0.9745 90 256 GO:0005886
AF-A0A3A0EYU3-F1-model_v4 BAX inhibitor (BI)-1/YccA family protein 0.9718 14 256 GO:0005886

Map