F475161

General Info

Members Datasets Scaffolds Average Seq Length
685 388 1370 75

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_1811764|Ga0501082_1811764_16_282
Length 88
Sequence VAKPTRVTNRIGELRAAIGLTQADLGDRIGVTRQTVNAIEGGKYSPSLDVAFRIAGVLGTSLEVVFQYDEVGRRARRSSAPDGEPAGS

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
192 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
193 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
194 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
195 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
221 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
222 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
223 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
248 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
249 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
250 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
251 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
256 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
257 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
258 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
259 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
262 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
263 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
266 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
267 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
268 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
269 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
270 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
271 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
274 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
359 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
360 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
361 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
362 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
370 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
373 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
374 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
375 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
376 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
377 2558860280 Kutzneria sp. 744 Isolate Unclassified
378 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
379 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
380 2643221695 Lysobacter sp. Root494 Isolate Unclassified
381 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
382 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
383 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
384 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
385 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
386 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
387 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
388 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0.44
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.6
Nodule 0
Rhizoplane 5.55
Rhizosphere 72.41
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_1811764 3300060353 Unclassified 532
2 JGI25162J39368_1000487 3300002737 Bacteria 30308
3 JGI25162J39368_1001151 3300002737 Bacteria 15806
4 JGI25162J39368_1008339 3300002737 Bacteria 1497
5 JGI25164J39214_1000193 3300002772 Bacteria 52696
6 JGI25164J39214_1000242 3300002772 Bacteria 41726
7 JGI25164J39214_1001125 3300002772 Bacteria 7616
8 JGI25406J46586_10008343 3300003203 Bacteria 4698
9 JGI25165J46597_1000269 3300003214 Bacteria 67008
10 JGI25165J46597_1000335 3300003214 Bacteria 55465
11 JGI25165J46597_1002787 3300003214 Bacteria 5070
12 JGI25160J50197_1058139 3300003354 Bacteria 784
13 Ga0055529_1005418 3300003763 Bacteria 1849
14 Ga0055526_1000961 3300003771 Bacteria 21281
15 Ga0055526_1067220 3300003771 Bacteria 740
16 Ga0055536_1000881 3300003781 Bacteria 19520
17 Ga0055534_1012732 3300003784 Bacteria 1649
18 Ga0055530_10000083 3300003791 Bacteria 81772
19 Ga0055530_10033459 3300003791 Bacteria 1325
20 Ga0055530_10036936 3300003791 Bacteria 1226
21 Ga0055531_10000316 3300003794 Bacteria 47444
22 Ga0055531_10000471 3300003794 Bacteria 37281
23 Ga0065707_10970854 3300005295 Bacteria 547
24 Ga0070658_10325314 3300005327 Bacteria 1313
25 Ga0070658_10639602 3300005327 Bacteria 923
26 Ga0070676_10647695 3300005328 Bacteria 766
27 Ga0070683_100510778 3300005329 Bacteria 1148
28 Ga0068869_100346121 3300005334 Bacteria 1211
29 Ga0068869_101009531 3300005334 Bacteria 725
30 Ga0068869_101591834 3300005334 Bacteria 582
31 Ga0070680_100300281 3300005336 Bacteria 1362
32 Ga0070682_100014692 3300005337 Bacteria 4527
33 Ga0070682_100198731 3300005337 Bacteria 1413
34 Ga0070682_100401525 3300005337 Bacteria 1037
35 Ga0070682_100922759 3300005337 Bacteria 719
36 Ga0070682_101217754 3300005337 Bacteria 636
37 Ga0070660_100313967 3300005339 Bacteria 1286
38 Ga0070687_100462486 3300005343 Bacteria 846
39 Ga0070668_100001537 3300005347 Bacteria 16641
40 Ga0070668_100308425 3300005347 Bacteria 1329
41 Ga0070675_101128337 3300005354 Bacteria 721
42 Ga0070675_102085755 3300005354 Bacteria 523
43 Ga0070671_100294218 3300005355 Bacteria 1382
44 Ga0070674_100215252 3300005356 Bacteria 1492
45 Ga0070659_100272920 3300005366 Bacteria 1405
46 Ga0070667_100746727 3300005367 Bacteria 907
47 Ga0070709_10479550 3300005434 Bacteria 941
48 Ga0070714_100131487 3300005435 Bacteria 2237
49 Ga0070714_100251451 3300005435 Bacteria 1634
50 Ga0070714_100262180 3300005435 Bacteria 1601
51 Ga0070714_100315078 3300005435 Bacteria 1462
52 Ga0070714_100667222 3300005435 Bacteria 1002
53 Ga0070714_102058694 3300005435 Bacteria 556
54 Ga0070713_100052825 3300005436 Bacteria 3365
55 Ga0070713_100783548 3300005436 Bacteria 913
56 Ga0070713_100936841 3300005436 Bacteria 834
57 Ga0070713_102038550 3300005436 Bacteria 556
58 Ga0070710_10219626 3300005437 Bacteria 1209
59 Ga0070711_100241133 3300005439 Bacteria 1413
60 Ga0070711_100390132 3300005439 Bacteria 1128
61 Ga0070711_101433367 3300005439 Bacteria 601
62 Ga0070694_100358186 3300005444 Bacteria 1132
63 Ga0070663_100979742 3300005455 Bacteria 734
64 Ga0070663_101953464 3300005455 Bacteria 527
65 Ga0070678_100143013 3300005456 Bacteria 1917
66 Ga0070678_100613431 3300005456 Bacteria 972
67 Ga0070678_101354907 3300005456 Bacteria 663
68 Ga0070681_10659586 3300005458 Bacteria 961
69 Ga0070681_10678629 3300005458 Bacteria 946
70 Ga0068867_101404169 3300005459 Bacteria 647
71 Ga0070685_11208280 3300005466 Bacteria 575
72 Ga0070706_100048867 3300005467 Bacteria 3904
73 Ga0070707_100044377 3300005468 Bacteria 4256
74 Ga0070698_100010358 3300005471 Bacteria 9955
75 Ga0070679_100115113 3300005530 Bacteria 2674
76 Ga0070684_101773228 3300005535 Unclassified 582
77 Ga0070697_100615900 3300005536 Bacteria 955
78 Ga0068853_100049917 3300005539 Bacteria 3598
79 Ga0068853_100273709 3300005539 Bacteria 1555
80 Ga0068853_100332802 3300005539 Bacteria 1409
81 Ga0068853_100438875 3300005539 Bacteria 1226
82 Ga0068853_100893245 3300005539 Bacteria 853
83 Ga0070672_100457746 3300005543 Bacteria 1099
84 Ga0070672_100739513 3300005543 Bacteria 863
85 Ga0070696_100151789 3300005546 Bacteria 1701
86 Ga0070693_100044703 3300005547 Bacteria 2506
87 Ga0070665_100000078 3300005548 Bacteria 188101
88 Ga0070704_100821138 3300005549 Bacteria 832
89 Ga0068855_100032327 3300005563 Bacteria 6248
90 Ga0068855_100526038 3300005563 Bacteria 1282
91 Ga0068857_100222158 3300005577 Bacteria 1726
92 Ga0068854_100149362 3300005578 Bacteria 1800
93 Ga0068854_100543281 3300005578 Bacteria 984
94 Ga0068854_100942091 3300005578 Bacteria 761
95 Ga0068854_101294313 3300005578 Bacteria 656
96 Ga0068854_101309118 3300005578 Bacteria 652
97 Ga0068856_100329500 3300005614 Bacteria 1544
98 Ga0068852_100167782 3300005616 Bacteria 2055
99 Ga0068852_102798712 3300005616 Bacteria 506
100 Ga0068859_101407770 3300005617 Bacteria 769
101 Ga0068859_101535234 3300005617 Bacteria 735
102 Ga0068864_101523652 3300005618 Bacteria 672
103 Ga0068861_102700909 3300005719 Bacteria 501
104 Ga0068851_10156768 3300005834 Bacteria 1248
105 Ga0068851_10872225 3300005834 Bacteria 562
106 Ga0068860_100264234 3300005843 Bacteria 1678
107 Ga0068862_100079586 3300005844 Bacteria 2841
108 Ga0081455_10690286 3300005937 Bacteria 652
109 Ga0081538_10010782 3300005981 Bacteria 7468
110 Ga0081538_10014870 3300005981 Bacteria 6064
111 Ga0081540_1333233 3300005983 Bacteria 520
112 Ga0081539_10000031 3300005985 Bacteria 313232
113 Ga0081539_10005625 3300005985 Bacteria 12608
114 Ga0070717_10058801 3300006028 Bacteria 3179
115 Ga0070717_10373130 3300006028 Bacteria 1278
116 Ga0070717_10629681 3300006028 Bacteria 973
117 Ga0070717_10647106 3300006028 Bacteria 959
118 Ga0070717_11174617 3300006028 Bacteria 698
119 Ga0075365_10087464 3300006038 Bacteria 2119
120 Ga0075363_100212596 3300006048 Bacteria 1107
121 Ga0075364_10000319 3300006051 Bacteria 23673
122 Ga0070715_10342781 3300006163 Bacteria 813
123 Ga0070716_100005185 3300006173 Bacteria 6300
124 Ga0070712_100014705 3300006175 Bacteria 5025
125 Ga0070712_100213341 3300006175 Bacteria 1524
126 Ga0070712_101482202 3300006175 Bacteria 593
127 Ga0075367_10352424 3300006178 Bacteria 929
128 Ga0097621_100136148 3300006237 Bacteria 2095
129 Ga0097621_101819940 3300006237 Bacteria 581
130 Ga0075370_10512175 3300006353 Bacteria 725
131 Ga0075370_11025219 3300006353 Bacteria 506
132 Ga0068871_101376272 3300006358 Bacteria 665
133 Ga0068871_101418701 3300006358 Bacteria 655
134 Ga0075428_100060805 3300006844 Bacteria 4137
135 Ga0075428_100296028 3300006844 Bacteria 1740
136 Ga0075428_101146007 3300006844 Bacteria 820
137 Ga0075430_100281133 3300006846 Bacteria 1377
138 Ga0075430_100281285 3300006846 Bacteria 1376
139 Ga0075430_100586297 3300006846 Bacteria 920
140 Ga0075431_100104479 3300006847 Bacteria 2923
141 Ga0075429_101623208 3300006880 Bacteria 562
142 Ga0097620_101407217 3300006931 Bacteria 769
143 Ga0097620_101535158 3300006931 Bacteria 735
144 Ga0075435_100203864 3300007076 Bacteria 1676
145 Ga0105240_10009760 3300009093 Bacteria 13555
146 Ga0105240_12744205 3300009093 Bacteria 507
147 Ga0111539_12062175 3300009094 Bacteria 662
148 Ga0105245_10825292 3300009098 Bacteria 966
149 Ga0105245_11145009 3300009098 Bacteria 825
150 Ga0105245_12622452 3300009098 Bacteria 557
151 Ga0105247_10901630 3300009101 Bacteria 683
152 Ga0114129_11287969 3300009147 Bacteria 906
153 Ga0105243_10087416 3300009148 Bacteria 2558
154 Ga0105243_12374845 3300009148 Bacteria 568
155 Ga0105243_13051614 3300009148 Bacteria 507
156 Ga0105241_10306021 3300009174 Bacteria 1365
157 Ga0105241_10331389 3300009174 Bacteria 1316
158 Ga0105241_10609471 3300009174 Bacteria 987
159 Ga0105242_11368600 3300009176 Bacteria 734
160 Ga0105248_13109645 3300009177 Bacteria 528
161 Ga0105237_10000105 3300009545 Bacteria 118218
162 Ga0105237_11035751 3300009545 Bacteria 827
163 Ga0105237_12230094 3300009545 Bacteria 557
164 Ga0105238_10228496 3300009551 Bacteria 1838
165 Ga0105238_10406366 3300009551 Bacteria 1355
166 Ga0105238_11746619 3300009551 Bacteria 654
167 Ga0105249_11315807 3300009553 Bacteria 794
168 Ga0105239_11030265 3300010375 Bacteria 947
169 Ga0105246_10335082 3300011119 Bacteria 1234
170 Ga0157373_11268285 3300013100 Bacteria 557
171 Ga0157371_10228588 3300013102 Bacteria 1337
172 Ga0157369_10839774 3300013105 Bacteria 943
173 Ga0157369_11550829 3300013105 Bacteria 674
174 Ga0157369_12193137 3300013105 Bacteria 560
175 Ga0157374_11836986 3300013296 Bacteria 631
176 Ga0157374_12744168 3300013296 Bacteria 520
177 Ga0157374_12981672 3300013296 Bacteria 500
178 Ga0157378_10451454 3300013297 Bacteria 1276
179 Ga0163162_13391211 3300013306 Bacteria 509
180 Ga0157372_10136012 3300013307 Bacteria 2830
181 Ga0157372_10477147 3300013307 Bacteria 1454
182 Ga0157372_10587320 3300013307 Bacteria 1298
183 Ga0157372_11079996 3300013307 Bacteria 929
184 Ga0157375_10367893 3300013308 Bacteria 1604
185 Ga0157375_10646286 3300013308 Bacteria 1214
186 Ga0157375_11298440 3300013308 Bacteria 855
187 Ga0163163_10537637 3300014325 Bacteria 1231
188 Ga0163163_10787261 3300014325 Bacteria 1014
189 Ga0163163_10822956 3300014325 Bacteria 992
190 Ga0163163_12223590 3300014325 Bacteria 608
191 Ga0157377_10919125 3300014745 Bacteria 656
192 Ga0182007_10003704 3300015262 Bacteria 7145
193 Ga0163161_12118946 3300017792 Bacteria 500
194 Ga0206356_11054920 3300020070 Bacteria 3228
195 Ga0206354_11349434 3300020081 Bacteria 1348
196 Ga0206353_11672713 3300020082 Bacteria 1532
197 Ga0213876_10002639 3300021384 Bacteria 10477
198 Ga0213875_10156232 3300021388 Bacteria 1070
199 Ga0213871_10318033 3300021441 Bacteria 505
200 Ga0207427_100054 3300025231 Bacteria 216315
201 Ga0207427_100117 3300025231 Bacteria 102251
202 Ga0207427_100178 3300025231 Bacteria 67956
203 Ga0209437_100240 3300025233 Bacteria 89740
204 Ga0209437_100304 3300025233 Bacteria 67955
205 Ga0209437_100642 3300025233 Bacteria 20416
206 Ga0207425_1000041 3300025245 Bacteria 210441
207 Ga0207425_1057180 3300025245 Bacteria 696
208 Ga0209646_1002600 3300025246 Bacteria 3895
209 Ga0209026_1000111 3300025250 Bacteria 140599
210 Ga0209129_1000977 3300025258 Bacteria 17189
211 Ga0209233_1000001 3300025261 Bacteria 2992747
212 Ga0209233_1000083 3300025261 Bacteria 336016
213 Ga0209233_1000287 3300025261 Bacteria 67956
214 Ga0209565_1001163 3300025263 Bacteria 12632
215 Ga0209565_1052632 3300025263 Bacteria 726
216 Ga0209455_1000211 3300025272 Bacteria 82660
217 Ga0209673_1026813 3300025273 Bacteria 1885
218 Ga0209675_1000190 3300025291 Bacteria 67514
219 Ga0209676_1000133 3300025292 Bacteria 184430
220 Ga0209676_1006028 3300025292 Bacteria 6115
221 Ga0209676_1012522 3300025292 Bacteria 3325
222 Ga0209676_1019508 3300025292 Bacteria 2332
223 Ga0209025_1000068 3300025294 Bacteria 294129
224 Ga0209025_1010719 3300025294 Bacteria 6165
225 Ga0209025_1148152 3300025294 Bacteria 652
226 Ga0209564_1000622 3300025295 Bacteria 53970
227 Ga0209758_1000004 3300025297 Bacteria 1375322
228 Ga0209758_1049652 3300025297 Bacteria 1479
229 Ga0209050_1000001 3300025298 Bacteria 3563507
230 Ga0209050_1000067 3300025298 Bacteria 304206
231 Ga0209050_1001738 3300025298 Bacteria 21673
232 Ga0209050_1010590 3300025298 Bacteria 4516
233 Ga0209050_1012591 3300025298 Bacteria 3859
234 Ga0207426_1036225 3300025302 Bacteria 1570
235 Ga0209051_1000191 3300025303 Bacteria 108763
236 Ga0209257_1000132 3300025304 Bacteria 210870
237 Ga0209257_1001893 3300025304 Bacteria 22618
238 Ga0209257_1001973 3300025304 Bacteria 22086
239 Ga0209257_1002895 3300025304 Bacteria 15900
240 Ga0207697_10559018 3300025315 Bacteria 503
241 Ga0207692_10083028 3300025898 Bacteria 1718
242 Ga0207692_10193017 3300025898 Bacteria 1193
243 Ga0207692_10441061 3300025898 Bacteria 818
244 Ga0207647_10411857 3300025904 Bacteria 761
245 Ga0207685_10018699 3300025905 Bacteria 2268
246 Ga0207699_10024767 3300025906 Bacteria 3285
247 Ga0207699_10111832 3300025906 Bacteria 1752
248 Ga0207645_10116341 3300025907 Bacteria 1733
249 Ga0207705_10367377 3300025909 Bacteria 1110
250 Ga0207705_11066321 3300025909 Bacteria 623
251 Ga0207654_11230431 3300025911 Bacteria 546
252 Ga0207707_10459635 3300025912 Bacteria 1089
253 Ga0207707_10751055 3300025912 Bacteria 816
254 Ga0207707_11302133 3300025912 Bacteria 584
255 Ga0207695_10001623 3300025913 Bacteria 36467
256 Ga0207671_10004557 3300025914 Bacteria 13165
257 Ga0207693_10074932 3300025915 Bacteria 2650
258 Ga0207663_10002596 3300025916 Bacteria 8691
259 Ga0207663_10141095 3300025916 Bacteria 1679
260 Ga0207663_10178568 3300025916 Bacteria 1514
261 Ga0207660_10283964 3300025917 Bacteria 1314
262 Ga0207662_11254655 3300025918 Bacteria 527
263 Ga0207657_10035367 3300025919 Bacteria 4480
264 Ga0207657_10164681 3300025919 Bacteria 1799
265 Ga0207649_10881004 3300025920 Bacteria 701
266 Ga0207649_11401016 3300025920 Bacteria 553
267 Ga0207652_10030206 3300025921 Bacteria 4536
268 Ga0207646_10070154 3300025922 Bacteria 3130
269 Ga0207694_10692513 3300025924 Bacteria 859
270 Ga0207694_11238840 3300025924 Bacteria 631
271 Ga0207694_11578562 3300025924 Bacteria 553
272 Ga0207650_10781690 3300025925 Bacteria 809
273 Ga0207687_10775048 3300025927 Bacteria 817
274 Ga0207700_10118124 3300025928 Bacteria 2145
275 Ga0207700_10251023 3300025928 Bacteria 1511
276 Ga0207700_10425100 3300025928 Bacteria 1168
277 Ga0207664_10050661 3300025929 Bacteria 3275
278 Ga0207664_10057619 3300025929 Bacteria 3088
279 Ga0207664_10072930 3300025929 Bacteria 2769
280 Ga0207664_11269803 3300025929 Bacteria 655
281 Ga0207664_12020098 3300025929 Bacteria 500
282 Ga0207644_10265936 3300025931 Bacteria 1373
283 Ga0207644_10617090 3300025931 Bacteria 901
284 Ga0207690_10741930 3300025932 Bacteria 809
285 Ga0207709_10700985 3300025935 Bacteria 810
286 Ga0207669_10074994 3300025937 Bacteria 2142
287 Ga0207669_10264549 3300025937 Bacteria 1288
288 Ga0207669_10871387 3300025937 Bacteria 751
289 Ga0207704_10362856 3300025938 Bacteria 1131
290 Ga0207665_10005367 3300025939 Bacteria 8557
291 Ga0207665_11587826 3300025939 Bacteria 519
292 Ga0207691_10079523 3300025940 Bacteria 2951
293 Ga0207711_11572865 3300025941 Bacteria 601
294 Ga0207661_11125549 3300025944 Bacteria 723
295 Ga0207661_11728885 3300025944 Bacteria 571
296 Ga0207679_10465506 3300025945 Bacteria 1123
297 Ga0207667_10297189 3300025949 Bacteria 1650
298 Ga0207667_11731711 3300025949 Bacteria 591
299 Ga0207668_10002726 3300025972 Bacteria 10331
300 Ga0207668_10122041 3300025972 Bacteria 1975
301 Ga0207668_10553277 3300025972 Bacteria 997
302 Ga0207640_10199242 3300025981 Bacteria 1516
303 Ga0207640_10257802 3300025981 Bacteria 1357
304 Ga0207677_10526855 3300026023 Bacteria 1026
305 Ga0207639_10194018 3300026041 Bacteria 1737
306 Ga0207639_10239950 3300026041 Bacteria 1575
307 Ga0207639_10319783 3300026041 Bacteria 1377
308 Ga0207639_10374248 3300026041 Bacteria 1277
309 Ga0207678_10115363 3300026067 Bacteria 2291
310 Ga0207678_10351367 3300026067 Bacteria 1271
311 Ga0207678_11930447 3300026067 Bacteria 515
312 Ga0207708_10873619 3300026075 Unclassified 777
313 Ga0207702_10461881 3300026078 Bacteria 1233
314 Ga0207702_10992056 3300026078 Bacteria 833
315 Ga0207648_10152652 3300026089 Bacteria 2038
316 Ga0207676_11784730 3300026095 Bacteria 614
317 Ga0207676_12320614 3300026095 Bacteria 534
318 Ga0207674_10237339 3300026116 Bacteria 1770
319 Ga0207674_11290391 3300026116 Bacteria 700
320 Ga0207675_100859877 3300026118 Bacteria 922
321 Ga0207683_10078463 3300026121 Bacteria 2926
322 Ga0207683_10082829 3300026121 Bacteria 2851
323 Ga0207683_11210987 3300026121 Bacteria 700
324 Ga0207683_11591408 3300026121 Bacteria 603
325 Ga0207698_10093412 3300026142 Bacteria 2470
326 Ga0207698_10234988 3300026142 Bacteria 1666
327 Ga0207698_11226901 3300026142 Bacteria 764
328 Ga0207698_11503320 3300026142 Bacteria 689
329 Ga0209974_10458078 3300027876 Bacteria 507
330 Ga0268266_10000131 3300028379 Bacteria 146628
331 Ga0268266_10191605 3300028379 Bacteria 1867
332 Ga0268266_10582547 3300028379 Bacteria 1074
333 Ga0268265_10128320 3300028380 Bacteria 2103
334 Ga0268264_10011270 3300028381 Bacteria 7387
335 Ga0268264_10529249 3300028381 Bacteria 1153
336 Ga0268264_12544760 3300028381 Bacteria 517
337 Ga0265337_1010536 3300028556 Bacteria 3235
338 Ga0265337_1012858 3300028556 Bacteria 2829
339 Ga0265334_10066814 3300028573 Bacteria 1345
340 Ga0307517_10100813 3300028786 Bacteria 2278
341 Ga0307515_10131481 3300028794 Bacteria 2753
342 Ga0307515_10266044 3300028794 Bacteria 1443
343 Ga0307515_10267568 3300028794 Bacteria 1435
344 Ga0307515_10471046 3300028794 Bacteria 869
345 Ga0307515_10703115 3300028794 Unclassified 627
346 Ga0307515_10739082 3300028794 Bacteria 602
347 Ga0265338_10014544 3300028800 Bacteria 8744
348 Ga0265338_10428339 3300028800 Unclassified 939
349 Ga0307512_10065896 3300030522 Bacteria 2740
350 Ga0316177_1074352 3300030731 Bacteria 11019
351 Ga0314311_1196854 3300030733 Bacteria 1018
352 Ga0316179_1070522 3300030734 Bacteria 666
353 Ga0316180_1192092 3300030736 Bacteria 858
354 Ga0265332_10038706 3300031238 Bacteria 2066
355 Ga0265320_10066844 3300031240 Bacteria 1703
356 Ga0265340_10046521 3300031247 Bacteria 2116
357 Ga0265331_10085819 3300031250 Bacteria 1458
358 Ga0307513_10039349 3300031456 Bacteria 5242
359 Ga0307513_10052583 3300031456 Bacteria 4385
360 Ga0307513_10057618 3300031456 Bacteria 4137
361 Ga0307513_10137835 3300031456 Bacteria 2372
362 Ga0307513_10404867 3300031456 Bacteria 1098
363 Ga0307508_10000982 3300031616 Bacteria 33131
364 Ga0307508_10006260 3300031616 Bacteria 11216
365 Ga0307508_10156710 3300031616 Bacteria 1881
366 Ga0307514_10058419 3300031649 Bacteria 2950
367 Ga0307514_10455589 3300031649 Bacteria 627
368 Ga0265314_10633917 3300031711 Bacteria 547
369 Ga0265342_10396499 3300031712 Bacteria 713
370 Ga0316576_10568221 3300031727 Bacteria 830
371 Ga0307405_10004380 3300031731 Bacteria 6666
372 Ga0307405_10730310 3300031731 Bacteria 823
373 Ga0307405_11200961 3300031731 Bacteria 656
374 Ga0307405_11427876 3300031731 Bacteria 606
375 Ga0307405_11726390 3300031731 Bacteria 555
376 Ga0307413_10321075 3300031824 Bacteria 1183
377 Ga0307413_10632019 3300031824 Bacteria 880
378 Ga0307413_11598422 3300031824 Bacteria 579
379 Ga0307518_10000363 3300031838 Bacteria 34524
380 Ga0307410_10276253 3300031852 Bacteria 1316
381 Ga0307406_10064232 3300031901 Bacteria 2381
382 Ga0307406_10357785 3300031901 Bacteria 1143
383 Ga0307406_10504645 3300031901 Bacteria 981
384 Ga0307406_10753036 3300031901 Bacteria 818
385 Ga0307406_11105207 3300031901 Bacteria 685
386 Ga0307406_11519107 3300031901 Bacteria 590
387 Ga0307406_11609747 3300031901 Bacteria 574
388 Ga0307407_10030591 3300031903 Bacteria 2906
389 Ga0307412_10340526 3300031911 Bacteria 1200
390 Ga0307409_100001766 3300031995 Bacteria 10925
391 Ga0307409_100169353 3300031995 Bacteria 1921
392 Ga0307409_100405283 3300031995 Bacteria 1304
393 Ga0307409_100460800 3300031995 Bacteria 1229
394 Ga0307409_100760076 3300031995 Bacteria 974
395 Ga0307416_100001803 3300032002 Bacteria 11893
396 Ga0307416_100093115 3300032002 Bacteria 2595
397 Ga0307416_100326028 3300032002 Bacteria 1541
398 Ga0307416_101698001 3300032002 Bacteria 736
399 Ga0307416_103348917 3300032002 Bacteria 536
400 Ga0307416_103893144 3300032002 Bacteria 500
401 Ga0307414_10739222 3300032004 Bacteria 893
402 Ga0307411_10095633 3300032005 Bacteria 2086
403 Ga0307411_10399589 3300032005 Bacteria 1136
404 Ga0307415_100000474 3300032126 Bacteria 17337
405 Ga0307415_100021712 3300032126 Bacteria 3952
406 Ga0307415_100045389 3300032126 Bacteria 2946
407 Ga0307415_100051999 3300032126 Bacteria 2784
408 Ga0307415_100388983 3300032126 Bacteria 1187
409 Ga0307415_100921916 3300032126 Bacteria 807
410 Ga0307415_101559439 3300032126 Bacteria 633
411 Ga0307415_102122116 3300032126 Bacteria 549
412 Ga0307507_10167399 3300033179 Bacteria 1607
413 Ga0307507_10180177 3300033179 Bacteria 1512
414 Ga0307507_10543021 3300033179 Bacteria 615
415 Ga0307510_10049951 3300033180 Bacteria 4443
416 Ga0373930_0108231 3300034816 Bacteria 667
417 Ga0373948_0028553 3300034817 Bacteria 1111
418 Ga0373950_0114526 3300034818 Bacteria 592
419 Ga0373938_0018605 3300034957 Bacteria 1380
420 Ga0373934_0475000 3300035086 Bacteria 525
421 Ga0373940_0025238 3300035088 Bacteria 1547
422 Ga0373944_0000077 3300035089 Bacteria 16846
423 Ga0373949_0098244 3300035090 Bacteria 799
424 Ga0373951_0043290 3300035091 Bacteria 1091
425 Ga0373952_0031345 3300035092 Bacteria 1182
426 Ga0373923_0089766 3300035111 Bacteria 1343
427 Ga0373932_0021233 3300035112 Bacteria 1713
428 Ga0373936_0216263 3300035113 Bacteria 849
429 Ga0373939_0093425 3300035114 Bacteria 1020
430 Ga0373941_0031995 3300035115 Bacteria 1572
431 Ga0373945_0392158 3300035116 Bacteria 607
432 Ga0373953_0032702 3300035117 Bacteria 2031
433 Ga0373942_0056356 3300035207 Bacteria 1115
434 Ga0373942_0079692 3300035207 Bacteria 970
435 Ga0373962_0050915 3300035242 Bacteria 1194
436 Ga0373931_0174036 3300035691 Bacteria 1270
437 Ga0373935_0986847 3300035692 Bacteria 625
438 Ga0373927_0122036 3300035695 Bacteria 1701
439 Ga0373933_0181516 3300035724 Bacteria 1342
440 Ga0373947_0549319 3300035725 Bacteria 786
441 Ga0373937_0277933 3300036401 Bacteria 1581
442 Ga0316584_0174426 3300036712 Bacteria 1593
443 Ga0373925_0224946 3300037068 Bacteria 1499
444 Ga0373925_1245752 3300037068 Bacteria 611
445 Ga0316581_0244265 3300037588 Bacteria 552
446 Ga0436364_0426719 3300037853 Bacteria 1152
447 Ga0237819_02012 3300038705 Bacteria 4528
448 Ga0400483_283032 3300039062 Bacteria 1437
449 Ga0237816_00962 3300039145 Bacteria 2361
450 Ga0436365_0260153 3300039437 Bacteria 649
451 Ga0436365_0354361 3300039437 Bacteria 622
452 Ga0436360_0757575 3300039438 Bacteria 814
453 Ga0436363_0345479 3300039450 Bacteria 782
454 Ga0436363_0434749 3300039450 Bacteria 965
455 Ga0436363_1235171 3300039450 Bacteria 758
456 Ga0436363_1291634 3300039450 Bacteria 1022
457 Ga0451791_0637026 3300041451 Bacteria 1754
458 Ga0451791_0649049 3300041451 Bacteria 514
459 Ga0451797_0512445 3300041453 Bacteria 602
460 Ga0451797_1286614 3300041453 Bacteria 569
461 Ga0451800_1361167 3300041459 Bacteria 1070
462 Ga0451802_0698271 3300041460 Bacteria 522
463 Ga0451802_0829211 3300041460 Bacteria 546
464 Ga0451804_0106901 3300041463 Bacteria 501
465 Ga0451807_2049489 3300041486 Bacteria 508
466 Ga0451807_2061218 3300041486 Bacteria 647
467 Ga0451807_2603260 3300041486 Bacteria 655
468 Ga0451807_2628185 3300041486 Bacteria 588
469 Ga0451837_0362053 3300041494 Bacteria 572
470 Ga0451837_0588667 3300041494 Bacteria 859
471 Ga0451841_1105605 3300041498 Bacteria 623
472 Ga0451845_0281309 3300041501 Bacteria 551
473 Ga0451853_2934718 3300041512 Bacteria 555
474 Ga0451853_3952303 3300041512 Bacteria 853
475 Ga0439443_034108 3300042003 Bacteria 849
476 Ga0439443_112236 3300042003 Bacteria 530
477 Ga0439448_0088988 3300042005 Bacteria 1042
478 Ga0439455_0128108 3300042012 Bacteria 714
479 Ga0439463_003783 3300042016 Bacteria 3814
480 Ga0450905_014976 3300042142 Bacteria 1109
481 Ga0439444_0007107 3300042437 Bacteria 1711
482 Ga0439460_0106062 3300042461 Bacteria 907
483 Ga0451577_0360951 3300042876 Bacteria 1318
484 Ga0451577_0533489 3300042876 Bacteria 1066
485 Ga0439440_0003715 3300042993 Bacteria 2964
486 Ga0439440_0004083 3300042993 Bacteria 2854
487 Ga0466972_0006222 3300044658 Bacteria 5998
488 Ga0466972_0034255 3300044658 Bacteria 2489
489 Ga0453683_0000060 3300044673 Bacteria 185920
490 Ga0466965_0004824 3300044683 Bacteria 6018
491 Ga0466965_0024589 3300044683 Bacteria 2914
492 Ga0466965_0080173 3300044683 Bacteria 1649
493 Ga0466964_0267678 3300044706 Bacteria 849
494 Ga0453684_0010987 3300044712 Bacteria 15303
495 Ga0453684_1498242 3300044712 Bacteria 696
496 Ga0453684_1795378 3300044712 Bacteria 624
497 Ga0466968_0348785 3300044735 Bacteria 719
498 Ga0466960_0002929 3300044901 Bacteria 6497
499 Ga0451576_0000001 3300045051 Bacteria 1802108
500 Ga0451576_1051167 3300045051 Bacteria 853
501 Ga0466958_0461230 3300045836 Bacteria 823
502 Ga0466958_0665711 3300045836 Bacteria 678
503 Ga0466967_0626685 3300045976 Bacteria 1062
504 Ga0495590_0000142 3300046457 Bacteria 43345
505 Ga0495590_0354702 3300046457 Bacteria 558
506 Ga0495638_0161366 3300046460 Bacteria 1293
507 Ga0495594_0030734 3300046499 Bacteria 2909
508 Ga0495630_0480809 3300046517 Bacteria 952
509 Ga0495632_0073382 3300046519 Bacteria 1641
510 Ga0495663_0016453 3300046525 Bacteria 2090
511 Ga0495652_0056439 3300046529 Bacteria 3335
512 Ga0495654_0024158 3300046530 Bacteria 3142
513 Ga0495667_0515082 3300046559 Bacteria 749
514 Ga0495668_0000076 3300046616 Bacteria 161826
515 Ga0495668_0519439 3300046616 Bacteria 657
516 Ga0495625_0000520 3300046660 Bacteria 56778
517 Ga0495625_0260011 3300046660 Bacteria 1123
518 Ga0495613_0007953 3300046689 Bacteria 7890
519 Ga0495604_0432622 3300047317 Bacteria 862
520 Ga0495674_0307055 3300047319 Bacteria 1295
521 Ga0495674_1162484 3300047319 Bacteria 585
522 Ga0495681_0273816 3300047470 Bacteria 660
523 Ga0495593_0201859 3300047673 Bacteria 999
524 Ga0496100_0334565 3300048903 Bacteria 1140
525 Ga0496101_0181641 3300048904 Bacteria 1620
526 Ga0496102_0325295 3300048905 Bacteria 1448
527 Ga0496103_0433247 3300048906 Bacteria 844
528 Ga0496104_0824352 3300048907 Bacteria 833
529 Ga0496104_0864123 3300048907 Bacteria 810
530 Ga0496105_0373456 3300048908 Bacteria 1136
531 Ga0496106_0620301 3300048909 Bacteria 865
532 Ga0496108_0050519 3300048911 Bacteria 3481
533 Ga0496108_0053263 3300048911 Bacteria 3393
534 Ga0496108_0552054 3300048911 Bacteria 1005
535 Ga0496109_0293673 3300048912 Bacteria 1532
536 Ga0496110_0657889 3300048913 Bacteria 948
537 Ga0496110_1259401 3300048913 Bacteria 649
538 Ga0496111_0275268 3300048914 Bacteria 1249
539 Ga0496111_0430298 3300048914 Bacteria 975
540 Ga0496112_0201159 3300048915 Bacteria 1951
541 Ga0496112_0732404 3300048915 Bacteria 916
542 Ga0496113_0423361 3300048916 Bacteria 1069
543 Ga0496113_0543808 3300048916 Bacteria 932
544 Ga0496114_0444466 3300048917 Bacteria 1148
545 Ga0496114_0471249 3300048917 Bacteria 1111
546 Ga0496114_0955217 3300048917 Bacteria 739
547 Ga0496114_1798236 3300048917 Bacteria 501
548 Ga0496115_0001384 3300048918 Bacteria 17323
549 Ga0496115_0262684 3300048918 Bacteria 1419
550 Ga0496126_0452888 3300048929 Bacteria 1033
551 Ga0496126_0466677 3300048929 Bacteria 1014
552 Ga0496126_0506616 3300048929 Bacteria 964
553 Ga0501031_0006336 3300049568 Bacteria 7716
554 Ga0501031_0130426 3300049568 Bacteria 1642
555 Ga0501031_0131485 3300049568 Bacteria 1635
556 Ga0501032_0007789 3300049569 Bacteria 7811
557 Ga0501032_0009497 3300049569 Bacteria 7048
558 Ga0501032_0100594 3300049569 Bacteria 1915
559 Ga0501032_0249123 3300049569 Bacteria 1153
560 Ga0501033_0004440 3300049570 Bacteria 11220
561 Ga0501033_0017619 3300049570 Bacteria 5395
562 Ga0501033_0032102 3300049570 Bacteria 3942
563 Ga0501033_0444829 3300049570 Bacteria 901
564 Ga0501034_0020575 3300049571 Bacteria 6739
565 Ga0501034_0022705 3300049571 Bacteria 6391
566 Ga0501034_0281500 3300049571 Bacteria 1602
567 Ga0501034_0623385 3300049571 Bacteria 982
568 Ga0501034_0662481 3300049571 Bacteria 945
569 Ga0501036_0007278 3300049572 Bacteria 9013
570 Ga0501036_0016024 3300049572 Bacteria 6262
571 Ga0501036_0388556 3300049572 Bacteria 1164
572 Ga0501037_0007234 3300049573 Bacteria 8110
573 Ga0501037_0010584 3300049573 Bacteria 6775
574 Ga0501037_0238034 3300049573 Bacteria 1276
575 Ga0501037_0473920 3300049573 Bacteria 852
576 Ga0501038_0002697 3300049574 Bacteria 16549
577 Ga0501038_0009560 3300049574 Bacteria 8894
578 Ga0501038_0317914 3300049574 Bacteria 1219
579 Ga0501038_0798481 3300049574 Bacteria 701
580 Ga0501039_0027494 3300049575 Bacteria 4374
581 Ga0501039_0036194 3300049575 Bacteria 3808
582 Ga0501039_0191013 3300049575 Bacteria 1610
583 Ga0501040_0270794 3300049576 Bacteria 1213
584 Ga0501043_0080171 3300049579 Bacteria 2564
585 Ga0501043_0189196 3300049579 Bacteria 1601
586 Ga0501043_0408169 3300049579 Bacteria 1025
587 Ga0501046_0066477 3300049580 Bacteria 2810
588 Ga0501046_0092688 3300049580 Bacteria 2322
589 Ga0501047_0048517 3300049581 Bacteria 4100
590 Ga0501047_0088657 3300049581 Bacteria 2970
591 Ga0501047_0410547 3300049581 Bacteria 1186
592 Ga0501047_0808682 3300049581 Bacteria 752
593 Ga0501047_0925820 3300049581 Bacteria 685
594 Ga0501048_0075041 3300049582 Bacteria 2385
595 Ga0501048_0588794 3300049582 Bacteria 798
596 Ga0501067_0236819 3300049583 Bacteria 1016
597 Ga0501068_0551553 3300049584 Bacteria 749
598 Ga0501069_0041447 3300049585 Bacteria 2545
599 Ga0501070_0047409 3300049586 Bacteria 3571
600 Ga0501070_0102945 3300049586 Bacteria 2361
601 Ga0501070_0258622 3300049586 Bacteria 1423
602 Ga0501070_0571612 3300049586 Bacteria 903
603 Ga0501070_1086066 3300049586 Bacteria 618
604 Ga0501071_0060455 3300049587 Bacteria 2743
605 Ga0501072_0408326 3300049588 Bacteria 1077
606 Ga0501073_0011736 3300049589 Bacteria 6398
607 Ga0501073_0082415 3300049589 Bacteria 2238
608 Ga0501073_0093284 3300049589 Bacteria 2092
609 Ga0501074_1240593 3300049590 Bacteria 523
610 Ga0501075_0409525 3300049591 Bacteria 1034
611 Ga0501076_1038267 3300049592 Bacteria 675
612 Ga0501076_1807293 3300049592 Bacteria 501
613 Ga0501238_001219 3300049671 Bacteria 2947
614 Ga0501079_0226637 3300049741 Bacteria 1460
615 Ga0501080_0005871 3300049742 Bacteria 10996
616 Ga0501262_088080 3300049759 Bacteria 525
617 Ga0501035_0005602 3300049822 Bacteria 11860
618 Ga0501035_0014674 3300049822 Bacteria 7233
619 Ga0501035_0095557 3300049822 Bacteria 2612
620 Ga0501035_0286355 3300049822 Bacteria 1391
621 Ga0501035_0621204 3300049822 Bacteria 879
622 Ga0501035_0750659 3300049822 Bacteria 783
623 Ga0501044_0021291 3300049823 Bacteria 6919
624 Ga0501044_0024125 3300049823 Bacteria 6461
625 Ga0501044_0058722 3300049823 Bacteria 3944
626 Ga0501044_0084557 3300049823 Bacteria 3207
627 Ga0501044_0137599 3300049823 Bacteria 2433
628 Ga0501044_0196719 3300049823 Bacteria 1975
629 Ga0501045_0301488 3300049824 Bacteria 1193
630 Ga0501045_1114076 3300049824 Bacteria 577
631 nmdc:mga03n38_249499_c1 3300050490 Bacteria 937
632 nmdc:mga03n38_347719_c1 3300050490 Bacteria 806
633 nmdc:mga00v17_23_c1 3300050491 Bacteria 43132
634 nmdc:mga0yw44_280811_c1 3300050492 Bacteria 1113
635 nmdc:mga06z11_144428_c1 3300050494 Bacteria 1347
636 nmdc:mga06z11_233351_c1 3300050494 Bacteria 1078
637 nmdc:mga07m45_622177_c1 3300050496 Bacteria 623
638 nmdc:mga05p37_377472_c1 3300050507 Bacteria 1662
639 nmdc:mga09592_1282733_c1 3300050508 Bacteria 603
640 nmdc:mga09592_279328_c1 3300050508 Bacteria 1448
641 nmdc:mga0qj67_1136031_c1 3300050509 Bacteria 609
642 nmdc:mga0qj67_614143_c1 3300050509 Bacteria 869
643 nmdc:mga06r32_12860_c1 3300050510 Bacteria 7565
644 nmdc:mga0rr50_1063637_c1 3300050513 Bacteria 689
645 Ga0500643_050329 3300053087 Bacteria 1192
646 Ga0500644_0416076 3300053088 Bacteria 587
647 Ga0500646_0000088 3300053090 Bacteria 26075
648 Ga0500646_0077659 3300053090 Bacteria 1007
649 Ga0500583_0006793 3300053092 Bacteria 3969
650 Ga0500641_0007308 3300053096 Bacteria 3937
651 Ga0500641_0434905 3300053096 Bacteria 509
652 Ga0500650_0347906 3300053098 Bacteria 649
653 Ga0500556_0367398 3300053104 Bacteria 555
654 Ga0500562_138111 3300053108 Bacteria 664
655 Ga0500592_010718 3300053116 Bacteria 1462
656 Ga0500592_043466 3300053116 Bacteria 728
657 Ga0500594_0072713 3300053118 Bacteria 1014
658 Ga0500642_0000002 3300053130 Bacteria 795093
659 Ga0500642_0436365 3300053130 Bacteria 565
660 Ga0500652_092173 3300053131 Bacteria 1265
661 Ga0500658_0014554 3300053134 Bacteria 2914
662 Ga0500658_0237611 3300053134 Bacteria 837
663 Ga0500568_0000579 3300053139 Bacteria 26786
664 Ga0500568_0001306 3300053139 Bacteria 16359
665 Ga0500568_0007771 3300053139 Bacteria 5227
666 Ga0500588_0008410 3300053146 Bacteria 2409
667 Ga0500616_0000483 3300053153 Bacteria 51655
668 Ga0500627_0000033 3300053158 Bacteria 82993
669 Ga0500630_212903 3300053159 Bacteria 735
670 Ga0500645_002050 3300053730 Bacteria 9379
671 Ga0500645_023936 3300053730 Bacteria 1870
672 Ga0500599_057531 3300053736 Bacteria 627
673 Ga0500587_002647 3300053739 Bacteria 2539
674 2559424523 2558860280 Bacteria 11429938
675 2585315162 2582581314 Bacteria 11452267
676 2643819779 2643221560 Bacteria 4801179
677 2644529035 2643221695 Bacteria 3441323
678 2676494832 2675903060 Bacteria 10051191
679 2753069156 2751185734 Bacteria 8863695
680 2791914452 2791354901 Bacteria 8322202
681 2852654369 2852653556 Bacteria 4050083
682 2852684282 2852680915 Bacteria 4100189
683 2870728384 2870721527 Bacteria 9689237
684 2996222565 2996221748 Bacteria 6799777
685 8055071622 8055066027 Bacteria 9479577
686 Ga0501082_1811764
687 JGI25162J39368_1000487
688 JGI25162J39368_1001151
689 JGI25162J39368_1008339
690 JGI25164J39214_1000193
691 JGI25164J39214_1000242
692 JGI25164J39214_1001125
693 JGI25406J46586_10008343
694 JGI25165J46597_1000269
695 JGI25165J46597_1000335
696 JGI25165J46597_1002787
697 JGI25160J50197_1058139
698 Ga0055529_1005418
699 Ga0055526_1000961
700 Ga0055526_1067220
701 Ga0055536_1000881
702 Ga0055534_1012732
703 Ga0055530_10000083
704 Ga0055530_10033459
705 Ga0055530_10036936
706 Ga0055531_10000316
707 Ga0055531_10000471
708 Ga0065707_10970854
709 Ga0070658_10325314
710 Ga0070658_10639602
711 Ga0070676_10647695
712 Ga0070683_100510778
713 Ga0068869_100346121
714 Ga0068869_101009531
715 Ga0068869_101591834
716 Ga0070680_100300281
717 Ga0070682_100014692
718 Ga0070682_100198731
719 Ga0070682_100401525
720 Ga0070682_100922759
721 Ga0070682_101217754
722 Ga0070660_100313967
723 Ga0070687_100462486
724 Ga0070668_100001537
725 Ga0070668_100308425
726 Ga0070675_101128337
727 Ga0070675_102085755
728 Ga0070671_100294218
729 Ga0070674_100215252
730 Ga0070659_100272920
731 Ga0070667_100746727
732 Ga0070709_10479550
733 Ga0070714_100131487
734 Ga0070714_100251451
735 Ga0070714_100262180
736 Ga0070714_100315078
737 Ga0070714_100667222
738 Ga0070714_102058694
739 Ga0070713_100052825
740 Ga0070713_100783548
741 Ga0070713_100936841
742 Ga0070713_102038550
743 Ga0070710_10219626
744 Ga0070711_100241133
745 Ga0070711_100390132
746 Ga0070711_101433367
747 Ga0070694_100358186
748 Ga0070663_100979742
749 Ga0070663_101953464
750 Ga0070678_100143013
751 Ga0070678_100613431
752 Ga0070678_101354907
753 Ga0070681_10659586
754 Ga0070681_10678629
755 Ga0068867_101404169
756 Ga0070685_11208280
757 Ga0070706_100048867
758 Ga0070707_100044377
759 Ga0070698_100010358
760 Ga0070679_100115113
761 Ga0070684_101773228
762 Ga0070697_100615900
763 Ga0068853_100049917
764 Ga0068853_100273709
765 Ga0068853_100332802
766 Ga0068853_100438875
767 Ga0068853_100893245
768 Ga0070672_100457746
769 Ga0070672_100739513
770 Ga0070696_100151789
771 Ga0070693_100044703
772 Ga0070665_100000078
773 Ga0070704_100821138
774 Ga0068855_100032327
775 Ga0068855_100526038
776 Ga0068857_100222158
777 Ga0068854_100149362
778 Ga0068854_100543281
779 Ga0068854_100942091
780 Ga0068854_101294313
781 Ga0068854_101309118
782 Ga0068856_100329500
783 Ga0068852_100167782
784 Ga0068852_102798712
785 Ga0068859_101407770
786 Ga0068859_101535234
787 Ga0068864_101523652
788 Ga0068861_102700909
789 Ga0068851_10156768
790 Ga0068851_10872225
791 Ga0068860_100264234
792 Ga0068862_100079586
793 Ga0081455_10690286
794 Ga0081538_10010782
795 Ga0081538_10014870
796 Ga0081540_1333233
797 Ga0081539_10000031
798 Ga0081539_10005625
799 Ga0070717_10058801
800 Ga0070717_10373130
801 Ga0070717_10629681
802 Ga0070717_10647106
803 Ga0070717_11174617
804 Ga0075365_10087464
805 Ga0075363_100212596
806 Ga0075364_10000319
807 Ga0070715_10342781
808 Ga0070716_100005185
809 Ga0070712_100014705
810 Ga0070712_100213341
811 Ga0070712_101482202
812 Ga0075367_10352424
813 Ga0097621_100136148
814 Ga0097621_101819940
815 Ga0075370_10512175
816 Ga0075370_11025219
817 Ga0068871_101376272
818 Ga0068871_101418701
819 Ga0075428_100060805
820 Ga0075428_100296028
821 Ga0075428_101146007
822 Ga0075430_100281133
823 Ga0075430_100281285
824 Ga0075430_100586297
825 Ga0075431_100104479
826 Ga0075429_101623208
827 Ga0097620_101407217
828 Ga0097620_101535158
829 Ga0075435_100203864
830 Ga0105240_10009760
831 Ga0105240_12744205
832 Ga0111539_12062175
833 Ga0105245_10825292
834 Ga0105245_11145009
835 Ga0105245_12622452
836 Ga0105247_10901630
837 Ga0114129_11287969
838 Ga0105243_10087416
839 Ga0105243_12374845
840 Ga0105243_13051614
841 Ga0105241_10306021
842 Ga0105241_10331389
843 Ga0105241_10609471
844 Ga0105242_11368600
845 Ga0105248_13109645
846 Ga0105237_10000105
847 Ga0105237_11035751
848 Ga0105237_12230094
849 Ga0105238_10228496
850 Ga0105238_10406366
851 Ga0105238_11746619
852 Ga0105249_11315807
853 Ga0105239_11030265
854 Ga0105246_10335082
855 Ga0157373_11268285
856 Ga0157371_10228588
857 Ga0157369_10839774
858 Ga0157369_11550829
859 Ga0157369_12193137
860 Ga0157374_11836986
861 Ga0157374_12744168
862 Ga0157374_12981672
863 Ga0157378_10451454
864 Ga0163162_13391211
865 Ga0157372_10136012
866 Ga0157372_10477147
867 Ga0157372_10587320
868 Ga0157372_11079996
869 Ga0157375_10367893
870 Ga0157375_10646286
871 Ga0157375_11298440
872 Ga0163163_10537637
873 Ga0163163_10787261
874 Ga0163163_10822956
875 Ga0163163_12223590
876 Ga0157377_10919125
877 Ga0182007_10003704
878 Ga0163161_12118946
879 Ga0206356_11054920
880 Ga0206354_11349434
881 Ga0206353_11672713
882 Ga0213876_10002639
883 Ga0213875_10156232
884 Ga0213871_10318033
885 Ga0207427_100054
886 Ga0207427_100117
887 Ga0207427_100178
888 Ga0209437_100240
889 Ga0209437_100304
890 Ga0209437_100642
891 Ga0207425_1000041
892 Ga0207425_1057180
893 Ga0209646_1002600
894 Ga0209026_1000111
895 Ga0209129_1000977
896 Ga0209233_1000001
897 Ga0209233_1000083
898 Ga0209233_1000287
899 Ga0209565_1001163
900 Ga0209565_1052632
901 Ga0209455_1000211
902 Ga0209673_1026813
903 Ga0209675_1000190
904 Ga0209676_1000133
905 Ga0209676_1006028
906 Ga0209676_1012522
907 Ga0209676_1019508
908 Ga0209025_1000068
909 Ga0209025_1010719
910 Ga0209025_1148152
911 Ga0209564_1000622
912 Ga0209758_1000004
913 Ga0209758_1049652
914 Ga0209050_1000001
915 Ga0209050_1000067
916 Ga0209050_1001738
917 Ga0209050_1010590
918 Ga0209050_1012591
919 Ga0207426_1036225
920 Ga0209051_1000191
921 Ga0209257_1000132
922 Ga0209257_1001893
923 Ga0209257_1001973
924 Ga0209257_1002895
925 Ga0207697_10559018
926 Ga0207692_10083028
927 Ga0207692_10193017
928 Ga0207692_10441061
929 Ga0207647_10411857
930 Ga0207685_10018699
931 Ga0207699_10024767
932 Ga0207699_10111832
933 Ga0207645_10116341
934 Ga0207705_10367377
935 Ga0207705_11066321
936 Ga0207654_11230431
937 Ga0207707_10459635
938 Ga0207707_10751055
939 Ga0207707_11302133
940 Ga0207695_10001623
941 Ga0207671_10004557
942 Ga0207693_10074932
943 Ga0207663_10002596
944 Ga0207663_10141095
945 Ga0207663_10178568
946 Ga0207660_10283964
947 Ga0207662_11254655
948 Ga0207657_10035367
949 Ga0207657_10164681
950 Ga0207649_10881004
951 Ga0207649_11401016
952 Ga0207652_10030206
953 Ga0207646_10070154
954 Ga0207694_10692513
955 Ga0207694_11238840
956 Ga0207694_11578562
957 Ga0207650_10781690
958 Ga0207687_10775048
959 Ga0207700_10118124
960 Ga0207700_10251023
961 Ga0207700_10425100
962 Ga0207664_10050661
963 Ga0207664_10057619
964 Ga0207664_10072930
965 Ga0207664_11269803
966 Ga0207664_12020098
967 Ga0207644_10265936
968 Ga0207644_10617090
969 Ga0207690_10741930
970 Ga0207709_10700985
971 Ga0207669_10074994
972 Ga0207669_10264549
973 Ga0207669_10871387
974 Ga0207704_10362856
975 Ga0207665_10005367
976 Ga0207665_11587826
977 Ga0207691_10079523
978 Ga0207711_11572865
979 Ga0207661_11125549
980 Ga0207661_11728885
981 Ga0207679_10465506
982 Ga0207667_10297189
983 Ga0207667_11731711
984 Ga0207668_10002726
985 Ga0207668_10122041
986 Ga0207668_10553277
987 Ga0207640_10199242
988 Ga0207640_10257802
989 Ga0207677_10526855
990 Ga0207639_10194018
991 Ga0207639_10239950
992 Ga0207639_10319783
993 Ga0207639_10374248
994 Ga0207678_10115363
995 Ga0207678_10351367
996 Ga0207678_11930447
997 Ga0207708_10873619
998 Ga0207702_10461881
999 Ga0207702_10992056
1000 Ga0207648_10152652
1001 Ga0207676_11784730
1002 Ga0207676_12320614
1003 Ga0207674_10237339
1004 Ga0207674_11290391
1005 Ga0207675_100859877
1006 Ga0207683_10078463
1007 Ga0207683_10082829
1008 Ga0207683_11210987
1009 Ga0207683_11591408
1010 Ga0207698_10093412
1011 Ga0207698_10234988
1012 Ga0207698_11226901
1013 Ga0207698_11503320
1014 Ga0209974_10458078
1015 Ga0268266_10000131
1016 Ga0268266_10191605
1017 Ga0268266_10582547
1018 Ga0268265_10128320
1019 Ga0268264_10011270
1020 Ga0268264_10529249
1021 Ga0268264_12544760
1022 Ga0265337_1010536
1023 Ga0265337_1012858
1024 Ga0265334_10066814
1025 Ga0307517_10100813
1026 Ga0307515_10131481
1027 Ga0307515_10266044
1028 Ga0307515_10267568
1029 Ga0307515_10471046
1030 Ga0307515_10703115
1031 Ga0307515_10739082
1032 Ga0265338_10014544
1033 Ga0265338_10428339
1034 Ga0307512_10065896
1035 Ga0316177_1074352
1036 Ga0314311_1196854
1037 Ga0316179_1070522
1038 Ga0316180_1192092
1039 Ga0265332_10038706
1040 Ga0265320_10066844
1041 Ga0265340_10046521
1042 Ga0265331_10085819
1043 Ga0307513_10039349
1044 Ga0307513_10052583
1045 Ga0307513_10057618
1046 Ga0307513_10137835
1047 Ga0307513_10404867
1048 Ga0307508_10000982
1049 Ga0307508_10006260
1050 Ga0307508_10156710
1051 Ga0307514_10058419
1052 Ga0307514_10455589
1053 Ga0265314_10633917
1054 Ga0265342_10396499
1055 Ga0316576_10568221
1056 Ga0307405_10004380
1057 Ga0307405_10730310
1058 Ga0307405_11200961
1059 Ga0307405_11427876
1060 Ga0307405_11726390
1061 Ga0307413_10321075
1062 Ga0307413_10632019
1063 Ga0307413_11598422
1064 Ga0307518_10000363
1065 Ga0307410_10276253
1066 Ga0307406_10064232
1067 Ga0307406_10357785
1068 Ga0307406_10504645
1069 Ga0307406_10753036
1070 Ga0307406_11105207
1071 Ga0307406_11519107
1072 Ga0307406_11609747
1073 Ga0307407_10030591
1074 Ga0307412_10340526
1075 Ga0307409_100001766
1076 Ga0307409_100169353
1077 Ga0307409_100405283
1078 Ga0307409_100460800
1079 Ga0307409_100760076
1080 Ga0307416_100001803
1081 Ga0307416_100093115
1082 Ga0307416_100326028
1083 Ga0307416_101698001
1084 Ga0307416_103348917
1085 Ga0307416_103893144
1086 Ga0307414_10739222
1087 Ga0307411_10095633
1088 Ga0307411_10399589
1089 Ga0307415_100000474
1090 Ga0307415_100021712
1091 Ga0307415_100045389
1092 Ga0307415_100051999
1093 Ga0307415_100388983
1094 Ga0307415_100921916
1095 Ga0307415_101559439
1096 Ga0307415_102122116
1097 Ga0307507_10167399
1098 Ga0307507_10180177
1099 Ga0307507_10543021
1100 Ga0307510_10049951
1101 Ga0373930_0108231
1102 Ga0373948_0028553
1103 Ga0373950_0114526
1104 Ga0373938_0018605
1105 Ga0373934_0475000
1106 Ga0373940_0025238
1107 Ga0373944_0000077
1108 Ga0373949_0098244
1109 Ga0373951_0043290
1110 Ga0373952_0031345
1111 Ga0373923_0089766
1112 Ga0373932_0021233
1113 Ga0373936_0216263
1114 Ga0373939_0093425
1115 Ga0373941_0031995
1116 Ga0373945_0392158
1117 Ga0373953_0032702
1118 Ga0373942_0056356
1119 Ga0373942_0079692
1120 Ga0373962_0050915
1121 Ga0373931_0174036
1122 Ga0373935_0986847
1123 Ga0373927_0122036
1124 Ga0373933_0181516
1125 Ga0373947_0549319
1126 Ga0373937_0277933
1127 Ga0316584_0174426
1128 Ga0373925_0224946
1129 Ga0373925_1245752
1130 Ga0316581_0244265
1131 Ga0436364_0426719
1132 Ga0237819_02012
1133 Ga0400483_283032
1134 Ga0237816_00962
1135 Ga0436365_0260153
1136 Ga0436365_0354361
1137 Ga0436360_0757575
1138 Ga0436363_0345479
1139 Ga0436363_0434749
1140 Ga0436363_1235171
1141 Ga0436363_1291634
1142 Ga0451791_0637026
1143 Ga0451791_0649049
1144 Ga0451797_0512445
1145 Ga0451797_1286614
1146 Ga0451800_1361167
1147 Ga0451802_0698271
1148 Ga0451802_0829211
1149 Ga0451804_0106901
1150 Ga0451807_2049489
1151 Ga0451807_2061218
1152 Ga0451807_2603260
1153 Ga0451807_2628185
1154 Ga0451837_0362053
1155 Ga0451837_0588667
1156 Ga0451841_1105605
1157 Ga0451845_0281309
1158 Ga0451853_2934718
1159 Ga0451853_3952303
1160 Ga0439443_034108
1161 Ga0439443_112236
1162 Ga0439448_0088988
1163 Ga0439455_0128108
1164 Ga0439463_003783
1165 Ga0450905_014976
1166 Ga0439444_0007107
1167 Ga0439460_0106062
1168 Ga0451577_0360951
1169 Ga0451577_0533489
1170 Ga0439440_0003715
1171 Ga0439440_0004083
1172 Ga0466972_0006222
1173 Ga0466972_0034255
1174 Ga0453683_0000060
1175 Ga0466965_0004824
1176 Ga0466965_0024589
1177 Ga0466965_0080173
1178 Ga0466964_0267678
1179 Ga0453684_0010987
1180 Ga0453684_1498242
1181 Ga0453684_1795378
1182 Ga0466968_0348785
1183 Ga0466960_0002929
1184 Ga0451576_0000001
1185 Ga0451576_1051167
1186 Ga0466958_0461230
1187 Ga0466958_0665711
1188 Ga0466967_0626685
1189 Ga0495590_0000142
1190 Ga0495590_0354702
1191 Ga0495638_0161366
1192 Ga0495594_0030734
1193 Ga0495630_0480809
1194 Ga0495632_0073382
1195 Ga0495663_0016453
1196 Ga0495652_0056439
1197 Ga0495654_0024158
1198 Ga0495667_0515082
1199 Ga0495668_0000076
1200 Ga0495668_0519439
1201 Ga0495625_0000520
1202 Ga0495625_0260011
1203 Ga0495613_0007953
1204 Ga0495604_0432622
1205 Ga0495674_0307055
1206 Ga0495674_1162484
1207 Ga0495681_0273816
1208 Ga0495593_0201859
1209 Ga0496100_0334565
1210 Ga0496101_0181641
1211 Ga0496102_0325295
1212 Ga0496103_0433247
1213 Ga0496104_0824352
1214 Ga0496104_0864123
1215 Ga0496105_0373456
1216 Ga0496106_0620301
1217 Ga0496108_0050519
1218 Ga0496108_0053263
1219 Ga0496108_0552054
1220 Ga0496109_0293673
1221 Ga0496110_0657889
1222 Ga0496110_1259401
1223 Ga0496111_0275268
1224 Ga0496111_0430298
1225 Ga0496112_0201159
1226 Ga0496112_0732404
1227 Ga0496113_0423361
1228 Ga0496113_0543808
1229 Ga0496114_0444466
1230 Ga0496114_0471249
1231 Ga0496114_0955217
1232 Ga0496114_1798236
1233 Ga0496115_0001384
1234 Ga0496115_0262684
1235 Ga0496126_0452888
1236 Ga0496126_0466677
1237 Ga0496126_0506616
1238 Ga0501031_0006336
1239 Ga0501031_0130426
1240 Ga0501031_0131485
1241 Ga0501032_0007789
1242 Ga0501032_0009497
1243 Ga0501032_0100594
1244 Ga0501032_0249123
1245 Ga0501033_0004440
1246 Ga0501033_0017619
1247 Ga0501033_0032102
1248 Ga0501033_0444829
1249 Ga0501034_0020575
1250 Ga0501034_0022705
1251 Ga0501034_0281500
1252 Ga0501034_0623385
1253 Ga0501034_0662481
1254 Ga0501036_0007278
1255 Ga0501036_0016024
1256 Ga0501036_0388556
1257 Ga0501037_0007234
1258 Ga0501037_0010584
1259 Ga0501037_0238034
1260 Ga0501037_0473920
1261 Ga0501038_0002697
1262 Ga0501038_0009560
1263 Ga0501038_0317914
1264 Ga0501038_0798481
1265 Ga0501039_0027494
1266 Ga0501039_0036194
1267 Ga0501039_0191013
1268 Ga0501040_0270794
1269 Ga0501043_0080171
1270 Ga0501043_0189196
1271 Ga0501043_0408169
1272 Ga0501046_0066477
1273 Ga0501046_0092688
1274 Ga0501047_0048517
1275 Ga0501047_0088657
1276 Ga0501047_0410547
1277 Ga0501047_0808682
1278 Ga0501047_0925820
1279 Ga0501048_0075041
1280 Ga0501048_0588794
1281 Ga0501067_0236819
1282 Ga0501068_0551553
1283 Ga0501069_0041447
1284 Ga0501070_0047409
1285 Ga0501070_0102945
1286 Ga0501070_0258622
1287 Ga0501070_0571612
1288 Ga0501070_1086066
1289 Ga0501071_0060455
1290 Ga0501072_0408326
1291 Ga0501073_0011736
1292 Ga0501073_0082415
1293 Ga0501073_0093284
1294 Ga0501074_1240593
1295 Ga0501075_0409525
1296 Ga0501076_1038267
1297 Ga0501076_1807293
1298 Ga0501238_001219
1299 Ga0501079_0226637
1300 Ga0501080_0005871
1301 Ga0501262_088080
1302 Ga0501035_0005602
1303 Ga0501035_0014674
1304 Ga0501035_0095557
1305 Ga0501035_0286355
1306 Ga0501035_0621204
1307 Ga0501035_0750659
1308 Ga0501044_0021291
1309 Ga0501044_0024125
1310 Ga0501044_0058722
1311 Ga0501044_0084557
1312 Ga0501044_0137599
1313 Ga0501044_0196719
1314 Ga0501045_0301488
1315 Ga0501045_1114076
1316 nmdc:mga03n38_249499_c1
1317 nmdc:mga03n38_347719_c1
1318 nmdc:mga00v17_23_c1
1319 nmdc:mga0yw44_280811_c1
1320 nmdc:mga06z11_144428_c1
1321 nmdc:mga06z11_233351_c1
1322 nmdc:mga07m45_622177_c1
1323 nmdc:mga05p37_377472_c1
1324 nmdc:mga09592_1282733_c1
1325 nmdc:mga09592_279328_c1
1326 nmdc:mga0qj67_1136031_c1
1327 nmdc:mga0qj67_614143_c1
1328 nmdc:mga06r32_12860_c1
1329 nmdc:mga0rr50_1063637_c1
1330 Ga0500643_050329
1331 Ga0500644_0416076
1332 Ga0500646_0000088
1333 Ga0500646_0077659
1334 Ga0500583_0006793
1335 Ga0500641_0007308
1336 Ga0500641_0434905
1337 Ga0500650_0347906
1338 Ga0500556_0367398
1339 Ga0500562_138111
1340 Ga0500592_010718
1341 Ga0500592_043466
1342 Ga0500594_0072713
1343 Ga0500642_0000002
1344 Ga0500642_0436365
1345 Ga0500652_092173
1346 Ga0500658_0014554
1347 Ga0500658_0237611
1348 Ga0500568_0000579
1349 Ga0500568_0001306
1350 Ga0500568_0007771
1351 Ga0500588_0008410
1352 Ga0500616_0000483
1353 Ga0500627_0000033
1354 Ga0500630_212903
1355 Ga0500645_002050
1356 Ga0500645_023936
1357 Ga0500599_057531
1358 Ga0500587_002647
1359 2559424523
1360 2585315162
1361 2643819779
1362 2644529035
1363 2676494832
1364 2753069156
1365 2791914452
1366 2852654369
1367 2852684282
1368 2870728384
1369 2996222565
1370 8055071622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

11

65

0.96

PF13560

HTH_31

Helix-turn-helix domain

7

65

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.9643 10 63
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9509 6 70
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9502 6 70
2lyk-assembly1.cif.gz_B noe-based 3d structure of the cylr2 homodimer at 270k (-3 celsius degrees) 0.941 6 70
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9393 8 70
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9745 7 70 1.10.260.40
2lykB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.941 6 70 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9366 10 63 1.10.260.40
3u3wB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.932 9 62 1.10.260.40
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9314 7 70 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A525HFM6-F1-model_v4 Transcriptional regulator 1.004 5 70 GO:0003677
AF-A0A6S6FY68-F1-model_v4 XRE family transcriptional regulator 1.001 6 70 GO:0003677
AF-A0A7G5HXA0-F1-model_v4 deleted 1.001 5 69
AF-A0A1I0DGC6-F1-model_v4 Putative transcriptional regulator 1 5 69 GO:0003677
AF-A0A1I2L6P6-F1-model_v4 Putative transcriptional regulator 0.9992 6 68 GO:0003677

Map