F475192

General Info

Members Datasets Scaffolds Average Seq Length
686 309 1372 384

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0102057|Ga0373933_0102057_10_1353
Length 447
Sequence MAQWPAHVGAMPAQAVAHAGKSSGQPVAFEKIREAPLMRHSDKRILTTHAGSLPRPADLLDMAAAKMAGQPVDEAARQARLPGAVKEIVAKQIELGLDIIDDGEYSKPSFVTYVAERLGGYEVDKNSAPRVPWLGSREALAFPEFYNFSSSGARPDRMACTGPVTYKGHAQLQRDIANLKSAVNGAKVEMFMPAISPANIEDWMGNKYYDKPEDYLFAIADAMHEEYKAITDAGLILQIDDPRLVSYYLVNPKASIAECRKWAVLRVEALNHALRGISPDKVRHHTCYGINMGPRVHDMEVKHLIDIILRINAGAYSFEAANPRHEHEWKIWGNAKLPKDKVLIPGVISHSTVLVEHPELVAERIARYASLVGKERVIAGSDCGFATFAGSKEVHPSIVWAKMQALTEGARLASKELWKKGKTRSAAKAKAAVSGRPSGRRKVRAKK

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
101 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
157 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
309 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 0
Rhizoplane 3.21
Rhizosphere 89.94
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0102057 3300035724 Bacteria 1781
2 JGI25406J46586_10017347 3300003203 Bacteria 2979
3 JGI25404J52841_10001046 3300003659 Bacteria 4604
4 JGI25404J52841_10006782 3300003659 Bacteria 2403
5 Ga0070658_10006248 3300005327 Bacteria 9650
6 Ga0070658_10007518 3300005327 Bacteria 8793
7 Ga0070658_10069596 3300005327 Bacteria 2879
8 Ga0070658_10122480 3300005327 Bacteria 2162
9 Ga0070683_100017729 3300005329 Bacteria 6291
10 Ga0070683_100019449 3300005329 Bacteria 6032
11 Ga0070683_100047684 3300005329 Bacteria 3959
12 Ga0070683_100310342 3300005329 Bacteria 1501
13 Ga0070683_100394393 3300005329 Bacteria 1320
14 Ga0070683_100402675 3300005329 Bacteria 1305
15 Ga0070670_100039755 3300005331 Bacteria 4045
16 Ga0070680_100041524 3300005336 Bacteria 3729
17 Ga0070680_100065822 3300005336 Bacteria 2970
18 Ga0068868_100061898 3300005338 Bacteria 2965
19 Ga0068868_100367171 3300005338 Bacteria 1236
20 Ga0070660_100027513 3300005339 Bacteria 4244
21 Ga0070660_100088478 3300005339 Unclassified 2439
22 Ga0070660_100135232 3300005339 Bacteria 1975
23 Ga0070689_100018049 3300005340 Bacteria 5190
24 Ga0070689_100171982 3300005340 Bacteria 1756
25 Ga0070689_100212352 3300005340 Bacteria 1584
26 Ga0070669_100165658 3300005353 Bacteria 1720
27 Ga0070675_100036331 3300005354 Bacteria 4009
28 Ga0070671_100070464 3300005355 Bacteria 2917
29 Ga0070671_100100448 3300005355 Bacteria 2427
30 Ga0070674_100029426 3300005356 Bacteria 3618
31 Ga0070674_100035791 3300005356 Bacteria 3327
32 Ga0070688_100029252 3300005365 Bacteria 3298
33 Ga0070688_100035087 3300005365 Bacteria 3045
34 Ga0070688_100203137 3300005365 Bacteria 1388
35 Ga0070659_100039175 3300005366 Bacteria 3699
36 Ga0070667_100295873 3300005367 Bacteria 1457
37 Ga0070709_10106528 3300005434 Bacteria 1877
38 Ga0070709_10126941 3300005434 Bacteria 1736
39 Ga0070709_10157106 3300005434 Bacteria 1577
40 Ga0070714_100029379 3300005435 Bacteria 4570
41 Ga0070714_100083344 3300005435 Bacteria 2788
42 Ga0070714_100242965 3300005435 Bacteria 1662
43 Ga0070714_100266434 3300005435 Bacteria 1588
44 Ga0070713_100052900 3300005436 Bacteria 3363
45 Ga0070713_100252031 3300005436 Bacteria 1610
46 Ga0070713_100252032 3300005436 Bacteria 1610
47 Ga0070713_100292503 3300005436 Bacteria 1497
48 Ga0070713_100400674 3300005436 Bacteria 1281
49 Ga0070710_10039621 3300005437 Bacteria 2593
50 Ga0070710_10060968 3300005437 Bacteria 2147
51 Ga0070710_10110794 3300005437 Bacteria 1648
52 Ga0070701_10003188 3300005438 Bacteria 6450
53 Ga0070711_100010025 3300005439 Bacteria 5847
54 Ga0070711_100050311 3300005439 Bacteria 2857
55 Ga0070711_100125109 3300005439 Bacteria 1907
56 Ga0070705_100023042 3300005440 Bacteria 3337
57 Ga0070708_100015184 3300005445 Bacteria 6351
58 Ga0070708_100154618 3300005445 Bacteria 2135
59 Ga0070678_100147349 3300005456 Bacteria 1892
60 Ga0070681_10130612 3300005458 Bacteria 2444
61 Ga0070681_10218124 3300005458 Bacteria 1823
62 Ga0070685_10104074 3300005466 Bacteria 1738
63 Ga0070706_100013964 3300005467 Bacteria 7418
64 Ga0070706_100104353 3300005467 Unclassified 2636
65 Ga0070707_100013880 3300005468 Bacteria 7544
66 Ga0070707_100064779 3300005468 Unclassified 3510
67 Ga0070707_100171147 3300005468 Bacteria 2116
68 Ga0070707_100198765 3300005468 Bacteria 1954
69 Ga0070707_100282232 3300005468 Bacteria 1614
70 Ga0070698_100079059 3300005471 Unclassified 3286
71 Ga0070698_100350065 3300005471 Unclassified 1409
72 Ga0070699_100060197 3300005518 Bacteria 3290
73 Ga0070699_100065058 3300005518 Bacteria 3163
74 Ga0070679_100003933 3300005530 Bacteria 13668
75 Ga0070679_100113264 3300005530 Bacteria 2698
76 Ga0070679_100113632 3300005530 Bacteria 2693
77 Ga0070679_100353031 3300005530 Bacteria 1418
78 Ga0070684_100020815 3300005535 Bacteria 5444
79 Ga0070684_100039472 3300005535 Bacteria 4061
80 Ga0070684_100045670 3300005535 Bacteria 3793
81 Ga0070697_100096711 3300005536 Bacteria 2450
82 Ga0070697_100156715 3300005536 Unclassified 1922
83 Ga0070697_100264499 3300005536 Unclassified 1473
84 Ga0068853_100249944 3300005539 Bacteria 1627
85 Ga0070672_100023898 3300005543 Bacteria 4508
86 Ga0070672_100101525 3300005543 Bacteria 2333
87 Ga0070686_100144520 3300005544 Bacteria 1659
88 Ga0070665_100009081 3300005548 Bacteria 10070
89 Ga0070665_100061937 3300005548 Bacteria 3751
90 Ga0068855_100070163 3300005563 Bacteria 4077
91 Ga0068855_100381149 3300005563 Bacteria 1548
92 Ga0068857_100040906 3300005577 Bacteria 4109
93 Ga0068856_100174100 3300005614 Bacteria 2165
94 Ga0068856_100397303 3300005614 Bacteria 1398
95 Ga0068852_100176932 3300005616 Bacteria 2004
96 Ga0068859_100389348 3300005617 Bacteria 1490
97 Ga0068861_100031119 3300005719 Bacteria 3917
98 Ga0068870_10113542 3300005840 Bacteria 1550
99 Ga0068858_100309736 3300005842 Bacteria 1508
100 Ga0068858_100381950 3300005842 Bacteria 1352
101 Ga0068860_100400973 3300005843 Bacteria 1357
102 Ga0081455_10000263 3300005937 Bacteria 69205
103 Ga0081455_10006059 3300005937 Bacteria 13082
104 Ga0081455_10013289 3300005937 Bacteria 8153
105 Ga0081455_10144055 3300005937 Bacteria 1846
106 Ga0081538_10008218 3300005981 Bacteria 8900
107 Ga0081540_1000282 3300005983 Bacteria 52922
108 Ga0081540_1000413 3300005983 Bacteria 42230
109 Ga0081540_1000790 3300005983 Bacteria 29061
110 Ga0081540_1007624 3300005983 Bacteria 7683
111 Ga0081539_10000144 3300005985 Bacteria 165116
112 Ga0081539_10101928 3300005985 Bacteria 1461
113 Ga0070717_10000010 3300006028 Bacteria 283501
114 Ga0070717_10004327 3300006028 Bacteria 10245
115 Ga0070717_10007403 3300006028 Bacteria 8151
116 Ga0070717_10043472 3300006028 Bacteria 3667
117 Ga0070717_10117277 3300006028 Bacteria 2277
118 Ga0070717_10122471 3300006028 Bacteria 2229
119 Ga0070717_10149860 3300006028 Bacteria 2017
120 Ga0070717_10160814 3300006028 Bacteria 1948
121 Ga0070717_10195454 3300006028 Bacteria 1769
122 Ga0070717_10235222 3300006028 Unclassified 1614
123 Ga0075365_10003854 3300006038 Bacteria 7832
124 Ga0075365_10025499 3300006038 Bacteria 3743
125 Ga0075365_10132645 3300006038 Bacteria 1724
126 Ga0075368_10015939 3300006042 Bacteria 2793
127 Ga0075363_100002037 3300006048 Bacteria 8062
128 Ga0075364_10033945 3300006051 Bacteria 3288
129 Ga0075364_10073860 3300006051 Bacteria 2248
130 Ga0070715_10002964 3300006163 Bacteria 5312
131 Ga0070716_100016430 3300006173 Bacteria 3819
132 Ga0070716_100095242 3300006173 Bacteria 1812
133 Ga0070716_100178302 3300006173 Bacteria 1393
134 Ga0070712_100001837 3300006175 Bacteria 12931
135 Ga0070712_100037818 3300006175 Bacteria 3293
136 Ga0070712_100066549 3300006175 Bacteria 2561
137 Ga0070712_100100792 3300006175 Bacteria 2135
138 Ga0070712_100175979 3300006175 Bacteria 1664
139 Ga0075362_10026616 3300006177 Bacteria 2472
140 Ga0075367_10000246 3300006178 Bacteria 18379
141 Ga0075367_10051926 3300006178 Bacteria 2425
142 Ga0075369_10000860 3300006186 Bacteria 10060
143 Ga0075366_10001626 3300006195 Bacteria 11257
144 Ga0075366_10019502 3300006195 Bacteria 3925
145 Ga0075366_10065773 3300006195 Bacteria 2156
146 Ga0097621_100026773 3300006237 Bacteria 4528
147 Ga0068871_100154533 3300006358 Bacteria 1958
148 Ga0075428_100006619 3300006844 Bacteria 12892
149 Ga0075428_100039173 3300006844 Bacteria 5216
150 Ga0075428_100047179 3300006844 Unclassified 4732
151 Ga0075428_100071793 3300006844 Bacteria 3783
152 Ga0075428_100108133 3300006844 Bacteria 3031
153 Ga0075428_100111010 3300006844 Bacteria 2987
154 Ga0075428_100207478 3300006844 Bacteria 2118
155 Ga0075428_100236100 3300006844 Bacteria 1973
156 Ga0075428_100425173 3300006844 Bacteria 1423
157 Ga0075430_100000104 3300006846 Bacteria 50931
158 Ga0075430_100000499 3300006846 Bacteria 29432
159 Ga0075430_100001511 3300006846 Bacteria 18979
160 Ga0075430_100004153 3300006846 Bacteria 12220
161 Ga0075430_100007807 3300006846 Bacteria 9039
162 Ga0075430_100013972 3300006846 Bacteria 6843
163 Ga0075430_100161494 3300006846 Bacteria 1865
164 Ga0075431_100000226 3300006847 Bacteria 42242
165 Ga0075431_100012050 3300006847 Bacteria 8725
166 Ga0075431_100024564 3300006847 Bacteria 6177
167 Ga0075431_100054990 3300006847 Bacteria 4105
168 Ga0075431_100097746 3300006847 Bacteria 3032
169 Ga0075431_100233563 3300006847 Bacteria 1873
170 Ga0075431_100386144 3300006847 Unclassified 1403
171 Ga0075433_10023715 3300006852 Bacteria 5168
172 Ga0075433_10056942 3300006852 Bacteria 3416
173 Ga0075433_10192033 3300006852 Bacteria 1816
174 Ga0075434_100001107 3300006871 Bacteria 22100
175 Ga0075434_100003036 3300006871 Bacteria 14926
176 Ga0075434_100024781 3300006871 Bacteria 5865
177 Ga0075434_100041629 3300006871 Bacteria 4551
178 Ga0075434_100086076 3300006871 Bacteria 3142
179 Ga0075434_100124904 3300006871 Bacteria 2591
180 Ga0075434_100142273 3300006871 Bacteria 2419
181 Ga0075434_100271202 3300006871 Bacteria 1716
182 Ga0075429_100001416 3300006880 Bacteria 19655
183 Ga0075429_100006639 3300006880 Bacteria 10024
184 Ga0075429_100047794 3300006880 Bacteria 3722
185 Ga0075429_100049107 3300006880 Bacteria 3669
186 Ga0075429_100074932 3300006880 Bacteria 2948
187 Ga0075429_100177613 3300006880 Bacteria 1866
188 Ga0075436_100193887 3300006914 Bacteria 1438
189 Ga0075436_100220787 3300006914 Bacteria 1345
190 Ga0097620_100389351 3300006931 Bacteria 1490
191 Ga0075435_100023486 3300007076 Bacteria 4771
192 Ga0075435_100037321 3300007076 Bacteria 3868
193 Ga0075435_100087642 3300007076 Bacteria 2565
194 Ga0075435_100113351 3300007076 Bacteria 2256
195 Ga0099794_10002449 3300007265 Bacteria 6845
196 Ga0099795_10011243 3300007788 Bacteria 2669
197 Ga0111539_10209052 3300009094 Bacteria 2274
198 Ga0111539_10348717 3300009094 Bacteria 1723
199 Ga0111539_10364464 3300009094 Bacteria 1682
200 Ga0105245_10000801 3300009098 Bacteria 28541
201 Ga0105245_10162048 3300009098 Bacteria 2123
202 Ga0105247_10028140 3300009101 Unclassified 3400
203 Ga0105247_10104893 3300009101 Bacteria 1811
204 Ga0114129_10009508 3300009147 Bacteria 13865
205 Ga0114129_10013898 3300009147 Bacteria 11470
206 Ga0114129_10066395 3300009147 Bacteria 5033
207 Ga0114129_10142685 3300009147 Bacteria 3281
208 Ga0114129_10423455 3300009147 Bacteria 1751
209 Ga0114129_10823024 3300009147 Bacteria 1183
210 Ga0105242_10061545 3300009176 Bacteria 3087
211 Ga0105248_10101902 3300009177 Bacteria 3236
212 Ga0105237_10128827 3300009545 Bacteria 2525
213 Ga0105238_10016642 3300009551 Bacteria 7448
214 Ga0105238_10128700 3300009551 Bacteria 2510
215 Ga0105249_10087485 3300009553 Bacteria 2907
216 Ga0105246_10133394 3300011119 Bacteria 1858
217 Ga0157369_10173494 3300013105 Bacteria 2271
218 Ga0157378_10239701 3300013297 Bacteria 1732
219 Ga0163162_10217485 3300013306 Bacteria 2041
220 Ga0157375_10125101 3300013308 Bacteria 2685
221 Ga0163163_10048765 3300014325 Unclassified 4165
222 Ga0157380_10096990 3300014326 Bacteria 2446
223 Ga0157376_10371759 3300014969 Bacteria 1374
224 Ga0182007_10030703 3300015262 Bacteria 1834
225 Ga0213873_10016045 3300021358 Bacteria 1687
226 Ga0213876_10099093 3300021384 Bacteria 1545
227 Ga0213875_10000298 3300021388 Bacteria 47640
228 Ga0213871_10018958 3300021441 Bacteria 1689
229 Ga0224572_1006791 3300024225 Bacteria 2078
230 Ga0228598_1010761 3300024227 Bacteria 1822
231 Ga0209758_1000063 3300025297 Bacteria 315999
232 Ga0209758_1001024 3300025297 Bacteria 36793
233 Ga0209758_1001506 3300025297 Bacteria 27097
234 Ga0207682_10013175 3300025893 Bacteria 3224
235 Ga0207692_10115390 3300025898 Bacteria 1496
236 Ga0207710_10075703 3300025900 Bacteria 1552
237 Ga0207685_10005070 3300025905 Bacteria 3432
238 Ga0207699_10008058 3300025906 Bacteria 5178
239 Ga0207699_10074712 3300025906 Bacteria 2083
240 Ga0207699_10120132 3300025906 Bacteria 1698
241 Ga0207699_10187662 3300025906 Bacteria 1393
242 Ga0207643_10148215 3300025908 Bacteria 1405
243 Ga0207705_10060849 3300025909 Bacteria 2728
244 Ga0207705_10062547 3300025909 Bacteria 2689
245 Ga0207705_10132883 3300025909 Bacteria 1853
246 Ga0207684_10001766 3300025910 Archaea 22836
247 Ga0207684_10003015 3300025910 Bacteria 16688
248 Ga0207684_10050105 3300025910 Bacteria 3542
249 Ga0207684_10221549 3300025910 Bacteria 1633
250 Ga0207684_10290966 3300025910 Bacteria 1408
251 Ga0207693_10001267 3300025915 Bacteria 22522
252 Ga0207693_10003027 3300025915 Bacteria 14526
253 Ga0207693_10046928 3300025915 Bacteria 3394
254 Ga0207693_10047904 3300025915 Bacteria 3358
255 Ga0207693_10050052 3300025915 Bacteria 3281
256 Ga0207693_10127260 3300025915 Bacteria 2002
257 Ga0207693_10181076 3300025915 Bacteria 1658
258 Ga0207663_10040117 3300025916 Bacteria 2843
259 Ga0207660_10093535 3300025917 Bacteria 2234
260 Ga0207657_10006419 3300025919 Bacteria 12197
261 Ga0207657_10230298 3300025919 Bacteria 1482
262 Ga0207652_10173210 3300025921 Unclassified 1937
263 Ga0207646_10116089 3300025922 Bacteria 2404
264 Ga0207646_10168287 3300025922 Bacteria 1979
265 Ga0207646_10251634 3300025922 Bacteria 1596
266 Ga0207681_10027917 3300025923 Bacteria 3654
267 Ga0207681_10175941 3300025923 Bacteria 1626
268 Ga0207694_10008986 3300025924 Bacteria 7543
269 Ga0207694_10024988 3300025924 Bacteria 4539
270 Ga0207694_10050441 3300025924 Bacteria 3223
271 Ga0207687_10002780 3300025927 Bacteria 11873
272 Ga0207687_10163770 3300025927 Bacteria 1709
273 Ga0207700_10003051 3300025928 Bacteria 9659
274 Ga0207700_10003807 3300025928 Bacteria 8812
275 Ga0207700_10042877 3300025928 Bacteria 3320
276 Ga0207700_10170372 3300025928 Bacteria 1816
277 Ga0207700_10215866 3300025928 Bacteria 1624
278 Ga0207700_10275065 3300025928 Bacteria 1446
279 Ga0207700_10296360 3300025928 Bacteria 1395
280 Ga0207700_10301063 3300025928 Bacteria 1385
281 Ga0207700_10338799 3300025928 Bacteria 1307
282 Ga0207664_10048079 3300025929 Bacteria 3354
283 Ga0207664_10072633 3300025929 Bacteria 2774
284 Ga0207644_10321972 3300025931 Bacteria 1250
285 Ga0207706_10242593 3300025933 Bacteria 1575
286 Ga0207670_10005857 3300025936 Bacteria 6786
287 Ga0207670_10079819 3300025936 Bacteria 2285
288 Ga0207669_10119653 3300025937 Bacteria 1784
289 Ga0207665_10002841 3300025939 Bacteria 11622
290 Ga0207665_10158232 3300025939 Bacteria 1627
291 Ga0207691_10001015 3300025940 Bacteria 27838
292 Ga0207691_10011422 3300025940 Bacteria 8521
293 Ga0207711_10063711 3300025941 Bacteria 3183
294 Ga0207711_10064548 3300025941 Bacteria 3163
295 Ga0207689_10116290 3300025942 Bacteria 2198
296 Ga0207661_10097603 3300025944 Bacteria 2461
297 Ga0207661_10299218 3300025944 Bacteria 1442
298 Ga0207661_10379400 3300025944 Bacteria 1279
299 Ga0207667_10041252 3300025949 Bacteria 4909
300 Ga0207667_10136155 3300025949 Bacteria 2529
301 Ga0207651_10072673 3300025960 Bacteria 2443
302 Ga0207639_10204454 3300026041 Bacteria 1696
303 Ga0207702_10055751 3300026078 Bacteria 3353
304 Ga0207702_10126730 3300026078 Bacteria 2293
305 Ga0207702_10414361 3300026078 Bacteria 1302
306 Ga0207648_10024183 3300026089 Bacteria 5428
307 Ga0207676_10010116 3300026095 Bacteria 6712
308 Ga0207674_10058975 3300026116 Bacteria 3886
309 Ga0207674_10086481 3300026116 Bacteria 3130
310 Ga0207675_100111811 3300026118 Bacteria 2577
311 Ga0207675_100135970 3300026118 Bacteria 2332
312 Ga0207683_10051770 3300026121 Bacteria 3597
313 Ga0207683_10084539 3300026121 Bacteria 2821
314 Ga0207683_10097988 3300026121 Bacteria 2615
315 Ga0207698_10049634 3300026142 Bacteria 3196
316 Ga0207428_10112868 3300027907 Unclassified 2090
317 Ga0268265_10137746 3300028380 Bacteria 2039
318 Ga0268264_10397216 3300028381 Bacteria 1324
319 Ga0265338_10021494 3300028800 Bacteria 6727
320 Ga0265325_10000106 3300031241 Bacteria 59197
321 Ga0265325_10004986 3300031241 Bacteria 8272
322 Ga0265325_10018701 3300031241 Bacteria 3841
323 Ga0265325_10039878 3300031241 Bacteria 2469
324 Ga0265329_10009077 3300031242 Bacteria 3731
325 Ga0265340_10005680 3300031247 Bacteria 6899
326 Ga0265340_10019694 3300031247 Bacteria 3474
327 Ga0265339_10000024 3300031249 Bacteria 169774
328 Ga0265339_10000048 3300031249 Bacteria 109188
329 Ga0265316_10072545 3300031344 Bacteria 2652
330 Ga0265313_10000006 3300031595 Bacteria 183184
331 Ga0265313_10000221 3300031595 Bacteria 61433
332 Ga0265313_10013490 3300031595 Bacteria 4900
333 Ga0265313_10030579 3300031595 Bacteria 2770
334 Ga0316579_10000707 3300031691 Bacteria 11384
335 Ga0316579_10003525 3300031691 Bacteria 6123
336 Ga0265314_10131307 3300031711 Bacteria 1562
337 Ga0265342_10000640 3300031712 Bacteria 36671
338 Ga0265342_10043873 3300031712 Bacteria 2697
339 Ga0265342_10064781 3300031712 Bacteria 2143
340 Ga0316576_10124610 3300031727 Bacteria 1935
341 Ga0316577_10000747 3300031733 Bacteria 13944
342 Ga0316585_10031698 3300032137 Bacteria 1663
343 Ga0373950_0001856 3300034818 Bacteria 2829
344 Ga0373926_0010723 3300035083 Bacteria 3075
345 Ga0373929_0011225 3300035085 Bacteria 1686
346 Ga0373944_0005408 3300035089 Bacteria 3364
347 Ga0373923_0000173 3300035111 Bacteria 12840
348 Ga0373936_0004721 3300035113 Bacteria 5148
349 Ga0373939_0003478 3300035114 Bacteria 3697
350 Ga0373945_0000336 3300035116 Bacteria 13381
351 Ga0373953_0001311 3300035117 Bacteria 7125
352 Ga0373956_0010752 3300035119 Bacteria 3758
353 Ga0373960_0015850 3300035121 Bacteria 1930
354 Ga0373943_0000219 3300035170 Bacteria 23269
355 Ga0373943_0005393 3300035170 Bacteria 5753
356 Ga0373946_0016817 3300035171 Bacteria 2792
357 Ga0373946_0036496 3300035171 Bacteria 1993
358 Ga0373955_0000613 3300035172 Bacteria 15258
359 Ga0373955_0010295 3300035172 Bacteria 4411
360 Ga0316574_0012691 3300035398 Bacteria 4825
361 Ga0316574_0017417 3300035398 Bacteria 4205
362 Ga0373924_0000623 3300035410 Bacteria 10958
363 Ga0373924_0004646 3300035410 Bacteria 4813
364 Ga0373931_0020797 3300035691 Bacteria 3286
365 Ga0373931_0026280 3300035691 Bacteria 2962
366 Ga0373931_0045946 3300035691 Bacteria 2307
367 Ga0373935_0000013 3300035692 Bacteria 78986
368 Ga0373935_0017705 3300035692 Bacteria 4327
369 Ga0373935_0043452 3300035692 Bacteria 2828
370 Ga0373927_0001854 3300035695 Bacteria 15665
371 Ga0373927_0005536 3300035695 Bacteria 8693
372 Ga0373927_0015598 3300035695 Bacteria 5018
373 Ga0373927_0201155 3300035695 Bacteria 1308
374 Ga0373933_0002518 3300035724 Bacteria 10293
375 Ga0373933_0013182 3300035724 Bacteria 4579
376 Ga0373947_0000714 3300035725 Bacteria 19784
377 Ga0373947_0002000 3300035725 Bacteria 12444
378 Ga0373947_0045653 3300035725 Bacteria 2622
379 Ga0373947_0056362 3300035725 Bacteria 2375
380 Ga0373937_0000018 3300036401 Bacteria 144056
381 Ga0373937_0016702 3300036401 Bacteria 6522
382 Ga0373937_0033461 3300036401 Bacteria 4668
383 Ga0373937_0142463 3300036401 Bacteria 2243
384 Ga0316582_0000622 3300036647 Bacteria 13823
385 Ga0316584_0003519 3300036712 Bacteria 10206
386 Ga0316584_0025823 3300036712 Bacteria 4310
387 Ga0373925_0000055 3300037068 Bacteria 123638
388 Ga0373925_0000990 3300037068 Bacteria 25795
389 Ga0373925_0015001 3300037068 Bacteria 5601
390 Ga0373925_0027673 3300037068 Bacteria 4150
391 Ga0373925_0032881 3300037068 Bacteria 3820
392 Ga0373925_0043998 3300037068 Bacteria 3315
393 Ga0373925_0061899 3300037068 Bacteria 2813
394 Ga0395900_0025792 3300037418 Bacteria 6016
395 Ga0395898_0007242 3300037466 Bacteria 11774
396 Ga0395898_0120472 3300037466 Bacteria 2514
397 Ga0395898_0218895 3300037466 Bacteria 1816
398 Ga0436364_0266271 3300037853 Bacteria 210347
399 Ga0436364_1491805 3300037853 Bacteria 4833
400 Ga0395901_0022798 3300038443 Bacteria 6419
401 Ga0436365_0534746 3300039437 Bacteria 6587
402 Ga0436365_0836207 3300039437 Unclassified 3794
403 Ga0436365_1053265 3300039437 Bacteria 6168
404 Ga0436365_1649448 3300039437 Bacteria 14225
405 Ga0436360_0067583 3300039438 Bacteria 1702
406 Ga0436360_0983381 3300039438 Bacteria 5329
407 Ga0436360_1180143 3300039438 Unclassified 3734
408 Ga0436360_1337354 3300039438 Bacteria 1732
409 Ga0436361_0213200 3300039447 Bacteria 1190
410 Ga0436361_0929561 3300039447 Bacteria 2848
411 Ga0436361_1077947 3300039447 Bacteria 3194
412 Ga0436361_1172924 3300039447 Unclassified 1847
413 Ga0436363_0184415 3300039450 Bacteria 31021
414 Ga0436363_0261677 3300039450 Unclassified 1950
415 Ga0436363_0344458 3300039450 Unclassified 3225
416 Ga0436362_0114171 3300039453 Bacteria 2161
417 Ga0436362_0290511 3300039453 Bacteria 3129
418 Ga0451793_1667522 3300041452 Bacteria 1694
419 Ga0439435_0002799 3300042436 Bacteria 3526
420 Ga0439440_0021742 3300042993 Bacteria 1449
421 Ga0466963_0022994 3300044694 Bacteria 3954
422 Ga0466963_0043144 3300044694 Bacteria 2964
423 Ga0466963_0049028 3300044694 Bacteria 2792
424 Ga0466963_0104637 3300044694 Bacteria 1940
425 Ga0466959_0030522 3300045049 Bacteria 3991
426 Ga0466958_0047338 3300045836 Bacteria 2596
427 Ga0466958_0123363 3300045836 Bacteria 1623
428 Ga0466967_0078727 3300045976 Bacteria 2970
429 Ga0495592_0000430 3300046454 Bacteria 31720
430 Ga0495592_0057962 3300046454 Bacteria 2858
431 Ga0495603_0091542 3300046455 Bacteria 1778
432 Ga0495629_0024227 3300046459 Bacteria 4321
433 Ga0495629_0036532 3300046459 Bacteria 3467
434 Ga0495629_0148649 3300046459 Bacteria 1628
435 Ga0495651_0000298 3300046462 Bacteria 38601
436 Ga0495653_0000003 3300046463 Bacteria 377892
437 Ga0495582_0081301 3300046473 Bacteria 1799
438 Ga0495639_0075049 3300046475 Bacteria 1567
439 Ga0495662_0001776 3300046476 Bacteria 10789
440 Ga0495662_0006610 3300046476 Bacteria 5787
441 Ga0495662_0053648 3300046476 Bacteria 1947
442 Ga0495662_0088241 3300046476 Bacteria 1511
443 Ga0495664_0000001 3300046477 Bacteria 757730
444 Ga0495664_0001063 3300046477 Bacteria 14192
445 Ga0495584_0052242 3300046491 Bacteria 2057
446 Ga0495608_0000233 3300046511 Bacteria 40218
447 Ga0495618_0000012 3300046514 Bacteria 170881
448 Ga0495618_0023858 3300046514 Bacteria 3787
449 Ga0495618_0120948 3300046514 Bacteria 1677
450 Ga0495628_0000003 3300046516 Bacteria 470339
451 Ga0495628_0167747 3300046516 Bacteria 1666
452 Ga0495630_0012538 3300046517 Bacteria 6157
453 Ga0495630_0013889 3300046517 Bacteria 5857
454 Ga0495652_0000001 3300046529 Bacteria 1045081
455 Ga0495640_0000022 3300046533 Bacteria 101825
456 Ga0495640_0007753 3300046533 Bacteria 8448
457 Ga0495640_0028742 3300046533 Bacteria 4000
458 Ga0495640_0096451 3300046533 Bacteria 1945
459 Ga0495587_0000003 3300046536 Bacteria 424188
460 Ga0495645_0000004 3300046543 Bacteria 532661
461 Ga0495645_0006748 3300046543 Bacteria 7977
462 Ga0495667_0000001 3300046559 Bacteria 834831
463 Ga0495667_0042990 3300046559 Bacteria 2995
464 Ga0495634_0000012 3300046642 Bacteria 131341
465 Ga0495634_0015355 3300046642 Bacteria 5505
466 Ga0495634_0031293 3300046642 Bacteria 3665
467 Ga0495635_0000011 3300046663 Bacteria 240094
468 Ga0495635_0001639 3300046663 Bacteria 15096
469 Ga0495635_0025573 3300046663 Bacteria 4113
470 Ga0495635_0058809 3300046663 Bacteria 2644
471 Ga0495657_0000061 3300046675 Bacteria 96199
472 Ga0495599_0000004 3300046678 Bacteria 316231
473 Ga0495623_0000020 3300046679 Bacteria 100523
474 Ga0495646_0000006 3300046680 Bacteria 258496
475 Ga0495647_0042896 3300046681 Bacteria 1729
476 Ga0495658_0059689 3300046683 Bacteria 2185
477 Ga0495658_0138835 3300046683 Bacteria 1485
478 Ga0495669_0031815 3300046684 Bacteria 2317
479 Ga0495613_0013393 3300046689 Bacteria 6093
480 Ga0495613_0022900 3300046689 Bacteria 4655
481 Ga0495624_0000757 3300046690 Bacteria 25443
482 Ga0495624_0015372 3300046690 Bacteria 5168
483 Ga0495624_0072605 3300046690 Bacteria 2140
484 Ga0495600_0000029 3300046809 Bacteria 89914
485 Ga0495581_0001760 3300047315 Bacteria 12084
486 Ga0495581_0024996 3300047315 Bacteria 3461
487 Ga0495604_0000018 3300047317 Bacteria 181417
488 Ga0495674_0000001 3300047319 Bacteria 778665
489 Ga0495674_0006497 3300047319 Bacteria 11214
490 Ga0495674_0009246 3300047319 Bacteria 9366
491 Ga0495676_0022026 3300047321 Bacteria 5553
492 Ga0495675_0000034 3300047444 Bacteria 97963
493 Ga0495684_0000005 3300047471 Bacteria 291932
494 Ga0495684_0006008 3300047471 Bacteria 9436
495 Ga0495684_0040176 3300047471 Bacteria 3586
496 Ga0495684_0059677 3300047471 Bacteria 2905
497 Ga0495684_0068784 3300047471 Bacteria 2692
498 Ga0495593_0000173 3300047673 Bacteria 33534
499 Ga0495593_0018491 3300047673 Unclassified 3915
500 Ga0495602_0000002 3300048088 Bacteria 422216
501 Ga0495602_0251584 3300048088 Bacteria 1316
502 Ga0496101_0034065 3300048904 Bacteria 3596
503 Ga0496102_0163178 3300048905 Bacteria 2096
504 Ga0496104_0001479 3300048907 Bacteria 20271
505 Ga0496104_0097001 3300048907 Bacteria 2821
506 Ga0496104_0097839 3300048907 Bacteria 2808
507 Ga0496105_0024893 3300048908 Bacteria 4865
508 Ga0496105_0027623 3300048908 Bacteria 4638
509 Ga0496106_0064060 3300048909 Bacteria 2796
510 Ga0496108_0033163 3300048911 Bacteria 4290
511 Ga0496110_0038198 3300048913 Bacteria 4176
512 Ga0496110_0047528 3300048913 Bacteria 3759
513 Ga0496110_0167296 3300048913 Bacteria 1994
514 Ga0496110_0446489 3300048913 Bacteria 1179
515 Ga0496111_0049308 3300048914 Bacteria 3036
516 Ga0496112_0039632 3300048915 Bacteria 4605
517 Ga0496114_0056582 3300048917 Bacteria 3273
518 Ga0496114_0179754 3300048917 Bacteria 1847
519 Ga0496115_0032007 3300048918 Bacteria 4148
520 Ga0496115_0158649 3300048918 Bacteria 1869
521 Ga0496115_0162560 3300048918 Bacteria 1846
522 Ga0496115_0163293 3300048918 Bacteria 1841
523 Ga0496118_0038015 3300048921 Bacteria 3864
524 Ga0496119_0121251 3300048922 Bacteria 1437
525 Ga0496121_0011374 3300048924 Bacteria 9892
526 Ga0501032_0024181 3300049569 Bacteria 4195
527 Ga0501032_0074329 3300049569 Bacteria 2265
528 Ga0501032_0102405 3300049569 Bacteria 1897
529 Ga0501033_0017201 3300049570 Bacteria 5464
530 Ga0501033_0091542 3300049570 Bacteria 2224
531 Ga0501034_0025922 3300049571 Bacteria 5971
532 Ga0501034_0360236 3300049571 Bacteria 1382
533 Ga0501036_0016129 3300049572 Bacteria 6243
534 Ga0501036_0098606 3300049572 Bacteria 2470
535 Ga0501037_0023387 3300049573 Bacteria 4569
536 Ga0501038_0002874 3300049574 Bacteria 16055
537 Ga0501038_0125128 3300049574 Bacteria 2116
538 Ga0501039_0011358 3300049575 Bacteria 6782
539 Ga0501039_0141945 3300049575 Bacteria 1886
540 Ga0501040_0001002 3300049576 Bacteria 17888
541 Ga0501040_0024346 3300049576 Bacteria 4063
542 Ga0501040_0061441 3300049576 Bacteria 2584
543 Ga0501041_0127100 3300049577 Bacteria 1587
544 Ga0501041_0155389 3300049577 Bacteria 1429
545 Ga0501042_0036036 3300049578 Bacteria 3510
546 Ga0501042_0274611 3300049578 Bacteria 1217
547 Ga0501043_0001495 3300049579 Bacteria 20440
548 Ga0501043_0101053 3300049579 Bacteria 2267
549 Ga0501043_0106099 3300049579 Bacteria 2207
550 Ga0501043_0139785 3300049579 Bacteria 1897
551 Ga0501046_0002961 3300049580 Bacteria 15707
552 Ga0501046_0172149 3300049580 Bacteria 1624
553 Ga0501047_0009026 3300049581 Bacteria 9414
554 Ga0501047_0045821 3300049581 Bacteria 4227
555 Ga0501048_0001603 3300049582 Bacteria 17193
556 Ga0501048_0239678 3300049582 Bacteria 1287
557 Ga0501067_0002566 3300049583 Bacteria 10035
558 Ga0501069_0005776 3300049585 Bacteria 6447
559 Ga0501070_0021635 3300049586 Bacteria 5394
560 Ga0501070_0025246 3300049586 Bacteria 4983
561 Ga0501070_0032773 3300049586 Bacteria 4347
562 Ga0501070_0037582 3300049586 Bacteria 4041
563 Ga0501071_0002022 3300049587 Bacteria 12134
564 Ga0501072_0005549 3300049588 Bacteria 9595
565 Ga0501072_0006127 3300049588 Bacteria 9173
566 Ga0501072_0056066 3300049588 Bacteria 3106
567 Ga0501072_0143897 3300049588 Bacteria 1901
568 Ga0501073_0002637 3300049589 Bacteria 13439
569 Ga0501074_0014655 3300049590 Bacteria 5702
570 Ga0501074_0125738 3300049590 Bacteria 1834
571 Ga0501074_0189515 3300049590 Bacteria 1467
572 Ga0501075_0021492 3300049591 Bacteria 4706
573 Ga0501075_0111981 3300049591 Bacteria 2075
574 Ga0501076_0061508 3300049592 Bacteria 2988
575 Ga0501077_0059632 3300049593 Bacteria 2422
576 Ga0501077_0086047 3300049593 Bacteria 1993
577 Ga0501079_0011611 3300049741 Bacteria 6726
578 Ga0501079_0097453 3300049741 Bacteria 2280
579 Ga0501080_0003564 3300049742 Bacteria 13700
580 Ga0501080_0088380 3300049742 Bacteria 2879
581 Ga0501080_0239939 3300049742 Bacteria 1655
582 Ga0501080_0293343 3300049742 Bacteria 1476
583 Ga0501081_0042162 3300049743 Bacteria 3127
584 Ga0501081_0056593 3300049743 Bacteria 2710
585 Ga0501083_0029878 3300049744 Bacteria 3745
586 Ga0501083_0091747 3300049744 Bacteria 2005
587 Ga0501035_0018792 3300049822 Bacteria 6366
588 Ga0501035_0040751 3300049822 Bacteria 4195
589 Ga0501035_0107109 3300049822 Bacteria 2450
590 Ga0501035_0353344 3300049822 Bacteria 1229
591 Ga0501044_0100864 3300049823 Bacteria 2904
592 Ga0501044_0165786 3300049823 Bacteria 2184
593 Ga0501044_0175707 3300049823 Bacteria 2111
594 Ga0501045_0283862 3300049824 Bacteria 1232
595 nmdc:mga03683_15208_c1 3300050489 Bacteria 2867
596 nmdc:mga03683_76049_c1 3300050489 Bacteria 1443
597 nmdc:mga00v17_125313_c1 3300050491 Bacteria 1639
598 nmdc:mga00v17_96533_c1 3300050491 Bacteria 1862
599 nmdc:mga0yw44_58885_c1 3300050492 Bacteria 2348
600 nmdc:mga0k408_63397_c1 3300050493 Bacteria 2150
601 nmdc:mga05p37_112041_c1 3300050507 Bacteria 3355
602 nmdc:mga05p37_273452_c1 3300050507 Bacteria 2018
603 nmdc:mga05p37_355004_c1 3300050507 Bacteria 1725
604 nmdc:mga05p37_367918_c1 3300050507 Bacteria 1688
605 nmdc:mga05p37_37245_c1 3300050507 Bacteria 5964
606 nmdc:mga05p37_61127_c1 3300050507 Bacteria 4638
607 nmdc:mga09592_110005_c1 3300050508 Bacteria 2364
608 nmdc:mga09592_11649_c2 3300050508 Bacteria 4009
609 nmdc:mga09592_11976_c1 3300050508 Bacteria 7055
610 nmdc:mga09592_13679_c1 3300050508 Bacteria 6632
611 nmdc:mga09592_374533_c1 3300050508 Bacteria 1231
612 nmdc:mga09592_4528_c2 3300050508 Bacteria 9811
613 nmdc:mga0qj67_10775_c1 3300050509 Bacteria 6837
614 nmdc:mga0qj67_134321_c1 3300050509 Bacteria 2004
615 nmdc:mga0qj67_17744_c1 3300050509 Bacteria 5414
616 nmdc:mga0qj67_20967_c1 3300050509 Bacteria 5009
617 nmdc:mga0qj67_2921_c1 3300050509 Bacteria 12270
618 nmdc:mga0qj67_3168_c1 3300050509 Bacteria 11850
619 nmdc:mga0qj67_32029_c1 3300050509 Bacteria 4098
620 nmdc:mga0qj67_42638_c1 3300050509 Bacteria 3572
621 nmdc:mga06r32_112335_c1 3300050510 Bacteria 2681
622 nmdc:mga06r32_1480_c1 3300050510 Bacteria 21119
623 nmdc:mga06r32_164357_c1 3300050510 Bacteria 2202
624 nmdc:mga06r32_226676_c1 3300050510 Bacteria 1857
625 nmdc:mga06r32_240844_c1 3300050510 Bacteria 1797
626 nmdc:mga06r32_28710_c1 3300050510 Bacteria 5209
627 nmdc:mga06r32_56844_c1 3300050510 Bacteria 3757
628 nmdc:mga08y16_178131_c1 3300050511 Bacteria 2208
629 nmdc:mga08y16_266972_c1 3300050511 Bacteria 1767
630 nmdc:mga08y16_349197_c1 3300050511 Bacteria 1520
631 nmdc:mga08y16_9304_c1 3300050511 Bacteria 10305
632 nmdc:mga0n895_130418_c1 3300050512 Bacteria 2539
633 nmdc:mga0n895_223159_c1 3300050512 Bacteria 1913
634 nmdc:mga0n895_24751_c1 3300050512 Bacteria 5661
635 nmdc:mga0n895_782_c1 3300050512 Bacteria 22642
636 nmdc:mga0n895_84016_c1 3300050512 Bacteria 3176
637 nmdc:mga0n895_92025_c1 3300050512 Bacteria 3036
638 nmdc:mga0rr50_298167_c1 3300050513 Bacteria 1348
639 nmdc:mga0rr50_30396_c1 3300050513 Bacteria 3824
640 nmdc:mga0rr50_33577_c1 3300050513 Bacteria 3666
641 nmdc:mga08x19_222899_c1 3300050514 Bacteria 1296
642 nmdc:mga08x19_5493_c1 3300050514 Bacteria 7497
643 nmdc:mga0a205_135218_c1 3300050515 Bacteria 2366
644 nmdc:mga0a205_184074_c1 3300050515 Bacteria 1982
645 nmdc:mga0a205_216659_c1 3300050515 Bacteria 1801
646 nmdc:mga0a205_41489_c1 3300050515 Bacteria 4431
647 nmdc:mga0sz30_13769_c2 3300050516 Bacteria 2827
648 nmdc:mga0sz30_84579_c1 3300050516 Bacteria 1376
649 Ga0495601_0000003 3300053077 Bacteria 493642
650 Ga0495601_0000334 3300053077 Bacteria 24822
651 Ga0495601_0008241 3300053077 Bacteria 6148
652 Ga0495601_0021514 3300053077 Bacteria 3951
653 Ga0495601_0032027 3300053077 Bacteria 3270
654 Ga0495601_0048524 3300053077 Bacteria 2674
655 Ga0495612_0000007 3300053078 Bacteria 253300
656 Ga0495612_0000550 3300053078 Bacteria 15056
657 Ga0495595_0000197 3300053084 Bacteria 24481
658 Ga0495595_0035084 3300053084 Bacteria 2271
659 Ga0495595_0105811 3300053084 Bacteria 1361
660 Ga0495619_0000009 3300053085 Bacteria 305595
661 Ga0495619_0000950 3300053085 Bacteria 18988
662 Ga0495619_0008078 3300053085 Bacteria 6659
663 Ga0495619_0027141 3300053085 Bacteria 3689
664 Ga0495619_0045638 3300053085 Bacteria 2879
665 Ga0500651_0007853 3300053093 Bacteria 6238
666 Ga0500641_0056811 3300053096 Bacteria 1623
667 Ga0500595_008053 3300053119 Bacteria 4325
668 Ga0500595_008074 3300053119 Bacteria 4319
669 Ga0500642_0006484 3300053130 Bacteria 3859
670 Ga0500652_000288 3300053131 Bacteria 18466
671 Ga0500622_0013015 3300053156 Bacteria 4496
672 Ga0500570_051020 3300053724 Bacteria 2082
673 Ga0501084_0016775 3300054114 Bacteria 6085
674 Ga0501084_0064643 3300054114 Bacteria 3061
675 Ga0501084_0066038 3300054114 Bacteria 3027
676 Ga0501082_0006130 3300060353 Bacteria 10437
677 Ga0501082_0083861 3300060353 Bacteria 2749
678 Ga0501082_0100611 3300060353 Bacteria 2500
679 Ga0501082_0216044 3300060353 Bacteria 1668
680 Ga0530510_0038856 3300061734 Bacteria 3437
681 Ga0530510_0069206 3300061734 Bacteria 2561
682 Ga0530510_0092472 3300061734 Bacteria 2208
683 Ga0530510_0195529 3300061734 Bacteria 1502
684 Ga0530510_0246022 3300061734 Bacteria 1332
685 Ga0530510_0251134 3300061734 Bacteria 1318
686 2946083795 2946080515 Bacteria 4310960
687 Ga0373933_0102057
688 JGI25406J46586_10017347
689 JGI25404J52841_10001046
690 JGI25404J52841_10006782
691 Ga0070658_10006248
692 Ga0070658_10007518
693 Ga0070658_10069596
694 Ga0070658_10122480
695 Ga0070683_100017729
696 Ga0070683_100019449
697 Ga0070683_100047684
698 Ga0070683_100310342
699 Ga0070683_100394393
700 Ga0070683_100402675
701 Ga0070670_100039755
702 Ga0070680_100041524
703 Ga0070680_100065822
704 Ga0068868_100061898
705 Ga0068868_100367171
706 Ga0070660_100027513
707 Ga0070660_100088478
708 Ga0070660_100135232
709 Ga0070689_100018049
710 Ga0070689_100171982
711 Ga0070689_100212352
712 Ga0070669_100165658
713 Ga0070675_100036331
714 Ga0070671_100070464
715 Ga0070671_100100448
716 Ga0070674_100029426
717 Ga0070674_100035791
718 Ga0070688_100029252
719 Ga0070688_100035087
720 Ga0070688_100203137
721 Ga0070659_100039175
722 Ga0070667_100295873
723 Ga0070709_10106528
724 Ga0070709_10126941
725 Ga0070709_10157106
726 Ga0070714_100029379
727 Ga0070714_100083344
728 Ga0070714_100242965
729 Ga0070714_100266434
730 Ga0070713_100052900
731 Ga0070713_100252031
732 Ga0070713_100252032
733 Ga0070713_100292503
734 Ga0070713_100400674
735 Ga0070710_10039621
736 Ga0070710_10060968
737 Ga0070710_10110794
738 Ga0070701_10003188
739 Ga0070711_100010025
740 Ga0070711_100050311
741 Ga0070711_100125109
742 Ga0070705_100023042
743 Ga0070708_100015184
744 Ga0070708_100154618
745 Ga0070678_100147349
746 Ga0070681_10130612
747 Ga0070681_10218124
748 Ga0070685_10104074
749 Ga0070706_100013964
750 Ga0070706_100104353
751 Ga0070707_100013880
752 Ga0070707_100064779
753 Ga0070707_100171147
754 Ga0070707_100198765
755 Ga0070707_100282232
756 Ga0070698_100079059
757 Ga0070698_100350065
758 Ga0070699_100060197
759 Ga0070699_100065058
760 Ga0070679_100003933
761 Ga0070679_100113264
762 Ga0070679_100113632
763 Ga0070679_100353031
764 Ga0070684_100020815
765 Ga0070684_100039472
766 Ga0070684_100045670
767 Ga0070697_100096711
768 Ga0070697_100156715
769 Ga0070697_100264499
770 Ga0068853_100249944
771 Ga0070672_100023898
772 Ga0070672_100101525
773 Ga0070686_100144520
774 Ga0070665_100009081
775 Ga0070665_100061937
776 Ga0068855_100070163
777 Ga0068855_100381149
778 Ga0068857_100040906
779 Ga0068856_100174100
780 Ga0068856_100397303
781 Ga0068852_100176932
782 Ga0068859_100389348
783 Ga0068861_100031119
784 Ga0068870_10113542
785 Ga0068858_100309736
786 Ga0068858_100381950
787 Ga0068860_100400973
788 Ga0081455_10000263
789 Ga0081455_10006059
790 Ga0081455_10013289
791 Ga0081455_10144055
792 Ga0081538_10008218
793 Ga0081540_1000282
794 Ga0081540_1000413
795 Ga0081540_1000790
796 Ga0081540_1007624
797 Ga0081539_10000144
798 Ga0081539_10101928
799 Ga0070717_10000010
800 Ga0070717_10004327
801 Ga0070717_10007403
802 Ga0070717_10043472
803 Ga0070717_10117277
804 Ga0070717_10122471
805 Ga0070717_10149860
806 Ga0070717_10160814
807 Ga0070717_10195454
808 Ga0070717_10235222
809 Ga0075365_10003854
810 Ga0075365_10025499
811 Ga0075365_10132645
812 Ga0075368_10015939
813 Ga0075363_100002037
814 Ga0075364_10033945
815 Ga0075364_10073860
816 Ga0070715_10002964
817 Ga0070716_100016430
818 Ga0070716_100095242
819 Ga0070716_100178302
820 Ga0070712_100001837
821 Ga0070712_100037818
822 Ga0070712_100066549
823 Ga0070712_100100792
824 Ga0070712_100175979
825 Ga0075362_10026616
826 Ga0075367_10000246
827 Ga0075367_10051926
828 Ga0075369_10000860
829 Ga0075366_10001626
830 Ga0075366_10019502
831 Ga0075366_10065773
832 Ga0097621_100026773
833 Ga0068871_100154533
834 Ga0075428_100006619
835 Ga0075428_100039173
836 Ga0075428_100047179
837 Ga0075428_100071793
838 Ga0075428_100108133
839 Ga0075428_100111010
840 Ga0075428_100207478
841 Ga0075428_100236100
842 Ga0075428_100425173
843 Ga0075430_100000104
844 Ga0075430_100000499
845 Ga0075430_100001511
846 Ga0075430_100004153
847 Ga0075430_100007807
848 Ga0075430_100013972
849 Ga0075430_100161494
850 Ga0075431_100000226
851 Ga0075431_100012050
852 Ga0075431_100024564
853 Ga0075431_100054990
854 Ga0075431_100097746
855 Ga0075431_100233563
856 Ga0075431_100386144
857 Ga0075433_10023715
858 Ga0075433_10056942
859 Ga0075433_10192033
860 Ga0075434_100001107
861 Ga0075434_100003036
862 Ga0075434_100024781
863 Ga0075434_100041629
864 Ga0075434_100086076
865 Ga0075434_100124904
866 Ga0075434_100142273
867 Ga0075434_100271202
868 Ga0075429_100001416
869 Ga0075429_100006639
870 Ga0075429_100047794
871 Ga0075429_100049107
872 Ga0075429_100074932
873 Ga0075429_100177613
874 Ga0075436_100193887
875 Ga0075436_100220787
876 Ga0097620_100389351
877 Ga0075435_100023486
878 Ga0075435_100037321
879 Ga0075435_100087642
880 Ga0075435_100113351
881 Ga0099794_10002449
882 Ga0099795_10011243
883 Ga0111539_10209052
884 Ga0111539_10348717
885 Ga0111539_10364464
886 Ga0105245_10000801
887 Ga0105245_10162048
888 Ga0105247_10028140
889 Ga0105247_10104893
890 Ga0114129_10009508
891 Ga0114129_10013898
892 Ga0114129_10066395
893 Ga0114129_10142685
894 Ga0114129_10423455
895 Ga0114129_10823024
896 Ga0105242_10061545
897 Ga0105248_10101902
898 Ga0105237_10128827
899 Ga0105238_10016642
900 Ga0105238_10128700
901 Ga0105249_10087485
902 Ga0105246_10133394
903 Ga0157369_10173494
904 Ga0157378_10239701
905 Ga0163162_10217485
906 Ga0157375_10125101
907 Ga0163163_10048765
908 Ga0157380_10096990
909 Ga0157376_10371759
910 Ga0182007_10030703
911 Ga0213873_10016045
912 Ga0213876_10099093
913 Ga0213875_10000298
914 Ga0213871_10018958
915 Ga0224572_1006791
916 Ga0228598_1010761
917 Ga0209758_1000063
918 Ga0209758_1001024
919 Ga0209758_1001506
920 Ga0207682_10013175
921 Ga0207692_10115390
922 Ga0207710_10075703
923 Ga0207685_10005070
924 Ga0207699_10008058
925 Ga0207699_10074712
926 Ga0207699_10120132
927 Ga0207699_10187662
928 Ga0207643_10148215
929 Ga0207705_10060849
930 Ga0207705_10062547
931 Ga0207705_10132883
932 Ga0207684_10001766
933 Ga0207684_10003015
934 Ga0207684_10050105
935 Ga0207684_10221549
936 Ga0207684_10290966
937 Ga0207693_10001267
938 Ga0207693_10003027
939 Ga0207693_10046928
940 Ga0207693_10047904
941 Ga0207693_10050052
942 Ga0207693_10127260
943 Ga0207693_10181076
944 Ga0207663_10040117
945 Ga0207660_10093535
946 Ga0207657_10006419
947 Ga0207657_10230298
948 Ga0207652_10173210
949 Ga0207646_10116089
950 Ga0207646_10168287
951 Ga0207646_10251634
952 Ga0207681_10027917
953 Ga0207681_10175941
954 Ga0207694_10008986
955 Ga0207694_10024988
956 Ga0207694_10050441
957 Ga0207687_10002780
958 Ga0207687_10163770
959 Ga0207700_10003051
960 Ga0207700_10003807
961 Ga0207700_10042877
962 Ga0207700_10170372
963 Ga0207700_10215866
964 Ga0207700_10275065
965 Ga0207700_10296360
966 Ga0207700_10301063
967 Ga0207700_10338799
968 Ga0207664_10048079
969 Ga0207664_10072633
970 Ga0207644_10321972
971 Ga0207706_10242593
972 Ga0207670_10005857
973 Ga0207670_10079819
974 Ga0207669_10119653
975 Ga0207665_10002841
976 Ga0207665_10158232
977 Ga0207691_10001015
978 Ga0207691_10011422
979 Ga0207711_10063711
980 Ga0207711_10064548
981 Ga0207689_10116290
982 Ga0207661_10097603
983 Ga0207661_10299218
984 Ga0207661_10379400
985 Ga0207667_10041252
986 Ga0207667_10136155
987 Ga0207651_10072673
988 Ga0207639_10204454
989 Ga0207702_10055751
990 Ga0207702_10126730
991 Ga0207702_10414361
992 Ga0207648_10024183
993 Ga0207676_10010116
994 Ga0207674_10058975
995 Ga0207674_10086481
996 Ga0207675_100111811
997 Ga0207675_100135970
998 Ga0207683_10051770
999 Ga0207683_10084539
1000 Ga0207683_10097988
1001 Ga0207698_10049634
1002 Ga0207428_10112868
1003 Ga0268265_10137746
1004 Ga0268264_10397216
1005 Ga0265338_10021494
1006 Ga0265325_10000106
1007 Ga0265325_10004986
1008 Ga0265325_10018701
1009 Ga0265325_10039878
1010 Ga0265329_10009077
1011 Ga0265340_10005680
1012 Ga0265340_10019694
1013 Ga0265339_10000024
1014 Ga0265339_10000048
1015 Ga0265316_10072545
1016 Ga0265313_10000006
1017 Ga0265313_10000221
1018 Ga0265313_10013490
1019 Ga0265313_10030579
1020 Ga0316579_10000707
1021 Ga0316579_10003525
1022 Ga0265314_10131307
1023 Ga0265342_10000640
1024 Ga0265342_10043873
1025 Ga0265342_10064781
1026 Ga0316576_10124610
1027 Ga0316577_10000747
1028 Ga0316585_10031698
1029 Ga0373950_0001856
1030 Ga0373926_0010723
1031 Ga0373929_0011225
1032 Ga0373944_0005408
1033 Ga0373923_0000173
1034 Ga0373936_0004721
1035 Ga0373939_0003478
1036 Ga0373945_0000336
1037 Ga0373953_0001311
1038 Ga0373956_0010752
1039 Ga0373960_0015850
1040 Ga0373943_0000219
1041 Ga0373943_0005393
1042 Ga0373946_0016817
1043 Ga0373946_0036496
1044 Ga0373955_0000613
1045 Ga0373955_0010295
1046 Ga0316574_0012691
1047 Ga0316574_0017417
1048 Ga0373924_0000623
1049 Ga0373924_0004646
1050 Ga0373931_0020797
1051 Ga0373931_0026280
1052 Ga0373931_0045946
1053 Ga0373935_0000013
1054 Ga0373935_0017705
1055 Ga0373935_0043452
1056 Ga0373927_0001854
1057 Ga0373927_0005536
1058 Ga0373927_0015598
1059 Ga0373927_0201155
1060 Ga0373933_0002518
1061 Ga0373933_0013182
1062 Ga0373947_0000714
1063 Ga0373947_0002000
1064 Ga0373947_0045653
1065 Ga0373947_0056362
1066 Ga0373937_0000018
1067 Ga0373937_0016702
1068 Ga0373937_0033461
1069 Ga0373937_0142463
1070 Ga0316582_0000622
1071 Ga0316584_0003519
1072 Ga0316584_0025823
1073 Ga0373925_0000055
1074 Ga0373925_0000990
1075 Ga0373925_0015001
1076 Ga0373925_0027673
1077 Ga0373925_0032881
1078 Ga0373925_0043998
1079 Ga0373925_0061899
1080 Ga0395900_0025792
1081 Ga0395898_0007242
1082 Ga0395898_0120472
1083 Ga0395898_0218895
1084 Ga0436364_0266271
1085 Ga0436364_1491805
1086 Ga0395901_0022798
1087 Ga0436365_0534746
1088 Ga0436365_0836207
1089 Ga0436365_1053265
1090 Ga0436365_1649448
1091 Ga0436360_0067583
1092 Ga0436360_0983381
1093 Ga0436360_1180143
1094 Ga0436360_1337354
1095 Ga0436361_0213200
1096 Ga0436361_0929561
1097 Ga0436361_1077947
1098 Ga0436361_1172924
1099 Ga0436363_0184415
1100 Ga0436363_0261677
1101 Ga0436363_0344458
1102 Ga0436362_0114171
1103 Ga0436362_0290511
1104 Ga0451793_1667522
1105 Ga0439435_0002799
1106 Ga0439440_0021742
1107 Ga0466963_0022994
1108 Ga0466963_0043144
1109 Ga0466963_0049028
1110 Ga0466963_0104637
1111 Ga0466959_0030522
1112 Ga0466958_0047338
1113 Ga0466958_0123363
1114 Ga0466967_0078727
1115 Ga0495592_0000430
1116 Ga0495592_0057962
1117 Ga0495603_0091542
1118 Ga0495629_0024227
1119 Ga0495629_0036532
1120 Ga0495629_0148649
1121 Ga0495651_0000298
1122 Ga0495653_0000003
1123 Ga0495582_0081301
1124 Ga0495639_0075049
1125 Ga0495662_0001776
1126 Ga0495662_0006610
1127 Ga0495662_0053648
1128 Ga0495662_0088241
1129 Ga0495664_0000001
1130 Ga0495664_0001063
1131 Ga0495584_0052242
1132 Ga0495608_0000233
1133 Ga0495618_0000012
1134 Ga0495618_0023858
1135 Ga0495618_0120948
1136 Ga0495628_0000003
1137 Ga0495628_0167747
1138 Ga0495630_0012538
1139 Ga0495630_0013889
1140 Ga0495652_0000001
1141 Ga0495640_0000022
1142 Ga0495640_0007753
1143 Ga0495640_0028742
1144 Ga0495640_0096451
1145 Ga0495587_0000003
1146 Ga0495645_0000004
1147 Ga0495645_0006748
1148 Ga0495667_0000001
1149 Ga0495667_0042990
1150 Ga0495634_0000012
1151 Ga0495634_0015355
1152 Ga0495634_0031293
1153 Ga0495635_0000011
1154 Ga0495635_0001639
1155 Ga0495635_0025573
1156 Ga0495635_0058809
1157 Ga0495657_0000061
1158 Ga0495599_0000004
1159 Ga0495623_0000020
1160 Ga0495646_0000006
1161 Ga0495647_0042896
1162 Ga0495658_0059689
1163 Ga0495658_0138835
1164 Ga0495669_0031815
1165 Ga0495613_0013393
1166 Ga0495613_0022900
1167 Ga0495624_0000757
1168 Ga0495624_0015372
1169 Ga0495624_0072605
1170 Ga0495600_0000029
1171 Ga0495581_0001760
1172 Ga0495581_0024996
1173 Ga0495604_0000018
1174 Ga0495674_0000001
1175 Ga0495674_0006497
1176 Ga0495674_0009246
1177 Ga0495676_0022026
1178 Ga0495675_0000034
1179 Ga0495684_0000005
1180 Ga0495684_0006008
1181 Ga0495684_0040176
1182 Ga0495684_0059677
1183 Ga0495684_0068784
1184 Ga0495593_0000173
1185 Ga0495593_0018491
1186 Ga0495602_0000002
1187 Ga0495602_0251584
1188 Ga0496101_0034065
1189 Ga0496102_0163178
1190 Ga0496104_0001479
1191 Ga0496104_0097001
1192 Ga0496104_0097839
1193 Ga0496105_0024893
1194 Ga0496105_0027623
1195 Ga0496106_0064060
1196 Ga0496108_0033163
1197 Ga0496110_0038198
1198 Ga0496110_0047528
1199 Ga0496110_0167296
1200 Ga0496110_0446489
1201 Ga0496111_0049308
1202 Ga0496112_0039632
1203 Ga0496114_0056582
1204 Ga0496114_0179754
1205 Ga0496115_0032007
1206 Ga0496115_0158649
1207 Ga0496115_0162560
1208 Ga0496115_0163293
1209 Ga0496118_0038015
1210 Ga0496119_0121251
1211 Ga0496121_0011374
1212 Ga0501032_0024181
1213 Ga0501032_0074329
1214 Ga0501032_0102405
1215 Ga0501033_0017201
1216 Ga0501033_0091542
1217 Ga0501034_0025922
1218 Ga0501034_0360236
1219 Ga0501036_0016129
1220 Ga0501036_0098606
1221 Ga0501037_0023387
1222 Ga0501038_0002874
1223 Ga0501038_0125128
1224 Ga0501039_0011358
1225 Ga0501039_0141945
1226 Ga0501040_0001002
1227 Ga0501040_0024346
1228 Ga0501040_0061441
1229 Ga0501041_0127100
1230 Ga0501041_0155389
1231 Ga0501042_0036036
1232 Ga0501042_0274611
1233 Ga0501043_0001495
1234 Ga0501043_0101053
1235 Ga0501043_0106099
1236 Ga0501043_0139785
1237 Ga0501046_0002961
1238 Ga0501046_0172149
1239 Ga0501047_0009026
1240 Ga0501047_0045821
1241 Ga0501048_0001603
1242 Ga0501048_0239678
1243 Ga0501067_0002566
1244 Ga0501069_0005776
1245 Ga0501070_0021635
1246 Ga0501070_0025246
1247 Ga0501070_0032773
1248 Ga0501070_0037582
1249 Ga0501071_0002022
1250 Ga0501072_0005549
1251 Ga0501072_0006127
1252 Ga0501072_0056066
1253 Ga0501072_0143897
1254 Ga0501073_0002637
1255 Ga0501074_0014655
1256 Ga0501074_0125738
1257 Ga0501074_0189515
1258 Ga0501075_0021492
1259 Ga0501075_0111981
1260 Ga0501076_0061508
1261 Ga0501077_0059632
1262 Ga0501077_0086047
1263 Ga0501079_0011611
1264 Ga0501079_0097453
1265 Ga0501080_0003564
1266 Ga0501080_0088380
1267 Ga0501080_0239939
1268 Ga0501080_0293343
1269 Ga0501081_0042162
1270 Ga0501081_0056593
1271 Ga0501083_0029878
1272 Ga0501083_0091747
1273 Ga0501035_0018792
1274 Ga0501035_0040751
1275 Ga0501035_0107109
1276 Ga0501035_0353344
1277 Ga0501044_0100864
1278 Ga0501044_0165786
1279 Ga0501044_0175707
1280 Ga0501045_0283862
1281 nmdc:mga03683_15208_c1
1282 nmdc:mga03683_76049_c1
1283 nmdc:mga00v17_125313_c1
1284 nmdc:mga00v17_96533_c1
1285 nmdc:mga0yw44_58885_c1
1286 nmdc:mga0k408_63397_c1
1287 nmdc:mga05p37_112041_c1
1288 nmdc:mga05p37_273452_c1
1289 nmdc:mga05p37_355004_c1
1290 nmdc:mga05p37_367918_c1
1291 nmdc:mga05p37_37245_c1
1292 nmdc:mga05p37_61127_c1
1293 nmdc:mga09592_110005_c1
1294 nmdc:mga09592_11649_c2
1295 nmdc:mga09592_11976_c1
1296 nmdc:mga09592_13679_c1
1297 nmdc:mga09592_374533_c1
1298 nmdc:mga09592_4528_c2
1299 nmdc:mga0qj67_10775_c1
1300 nmdc:mga0qj67_134321_c1
1301 nmdc:mga0qj67_17744_c1
1302 nmdc:mga0qj67_20967_c1
1303 nmdc:mga0qj67_2921_c1
1304 nmdc:mga0qj67_3168_c1
1305 nmdc:mga0qj67_32029_c1
1306 nmdc:mga0qj67_42638_c1
1307 nmdc:mga06r32_112335_c1
1308 nmdc:mga06r32_1480_c1
1309 nmdc:mga06r32_164357_c1
1310 nmdc:mga06r32_226676_c1
1311 nmdc:mga06r32_240844_c1
1312 nmdc:mga06r32_28710_c1
1313 nmdc:mga06r32_56844_c1
1314 nmdc:mga08y16_178131_c1
1315 nmdc:mga08y16_266972_c1
1316 nmdc:mga08y16_349197_c1
1317 nmdc:mga08y16_9304_c1
1318 nmdc:mga0n895_130418_c1
1319 nmdc:mga0n895_223159_c1
1320 nmdc:mga0n895_24751_c1
1321 nmdc:mga0n895_782_c1
1322 nmdc:mga0n895_84016_c1
1323 nmdc:mga0n895_92025_c1
1324 nmdc:mga0rr50_298167_c1
1325 nmdc:mga0rr50_30396_c1
1326 nmdc:mga0rr50_33577_c1
1327 nmdc:mga08x19_222899_c1
1328 nmdc:mga08x19_5493_c1
1329 nmdc:mga0a205_135218_c1
1330 nmdc:mga0a205_184074_c1
1331 nmdc:mga0a205_216659_c1
1332 nmdc:mga0a205_41489_c1
1333 nmdc:mga0sz30_13769_c2
1334 nmdc:mga0sz30_84579_c1
1335 Ga0495601_0000003
1336 Ga0495601_0000334
1337 Ga0495601_0008241
1338 Ga0495601_0021514
1339 Ga0495601_0032027
1340 Ga0495601_0048524
1341 Ga0495612_0000007
1342 Ga0495612_0000550
1343 Ga0495595_0000197
1344 Ga0495595_0035084
1345 Ga0495595_0105811
1346 Ga0495619_0000009
1347 Ga0495619_0000950
1348 Ga0495619_0008078
1349 Ga0495619_0027141
1350 Ga0495619_0045638
1351 Ga0500651_0007853
1352 Ga0500641_0056811
1353 Ga0500595_008053
1354 Ga0500595_008074
1355 Ga0500642_0006484
1356 Ga0500652_000288
1357 Ga0500622_0013015
1358 Ga0500570_051020
1359 Ga0501084_0016775
1360 Ga0501084_0064643
1361 Ga0501084_0066038
1362 Ga0501082_0006130
1363 Ga0501082_0083861
1364 Ga0501082_0100611
1365 Ga0501082_0216044
1366 Ga0530510_0038856
1367 Ga0530510_0069206
1368 Ga0530510_0092472
1369 Ga0530510_0195529
1370 Ga0530510_0246022
1371 Ga0530510_0251134
1372 2946083795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

45

139

0.87

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

194

406

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdj-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine 0.8924 7 372
3bq6-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8877 8 372
3bq6-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8868 8 373
3bq5-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine (monoclinic) 0.8845 7 376
1t7l-assembly1.cif.gz_A crystal structure of cobalamin-independent methionine synthase from t. maritima 0.8827 7 376
ID Description Score Start End Superfamily
1xdjA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8876 8 374 3.20.20.210
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8656 317 338 3.50.80.10
2nq5A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.865 7 373 3.20.20.210
af_K7KK03_1_110_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8647 258 375 3.20.20.210
af_K7MME4_84_171_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8487 285 370 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A2W6B7R1-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9933 234 376 GO:0003871
GO:0008270
GO:0009086
AF-A0A2V6YR22-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9928 178 376 GO:0016740
AF-A0A251XH34-F1-model_v4 Uncharacterized protein 0.9917 215 330
AF-A0A7C7PFY4-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.991 157 374 GO:0003871
GO:0008270
GO:0009086
AF-A0A2W5ZWG7-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9906 1 376 GO:0003871
GO:0008270
GO:0009086

Map