F475199

General Info

Members Datasets Scaffolds Average Seq Length
686 290 1372 180

Family's Representative Sequence

Representative Sequence 3300042435|Ga0439434_0031575|Ga0439434_0031575_109_666
Length 185
Sequence MSRTIALDSFLLADADRVVARARAGDQAALEQLYRAFEAPVYNLARRICRTTEDAEDVLQETFFEVCRSIGRYREEGSLWGWVRTIAASKALMRLRRNKYRDTDELNDELVIGQRKEETHLRMDLEAALERLPETSRAVVWLHDVEGYTHDEIAGMMGKTASFSKSQLARAHARLRRWLGEEVLV

Samples

Sample ID Description Type Environment
1 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
192 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
260 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
263 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
264 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
265 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
266 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
267 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
273 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.02
Rhizosphere 91.84
Stem 0
Stem Tuber 0
Unclassified 21.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439434_0031575 3300042435 Bacteria 1611
2 Ga0058863_11731781 3300004799 Bacteria 846
3 Ga0058862_10047534 3300004803 Unclassified 565
4 Ga0065715_10363302 3300005293 Bacteria 932
5 Ga0070683_101007997 3300005329 Unclassified 799
6 Ga0070690_100011251 3300005330 Bacteria 5229
7 Ga0068869_100034358 3300005334 Bacteria 3586
8 Ga0070666_10193131 3300005335 Bacteria 1431
9 Ga0070680_100029768 3300005336 Bacteria 4383
10 Ga0070680_100033249 3300005336 Bacteria 4155
11 Ga0070680_100183025 3300005336 Bacteria 1765
12 Ga0070680_100525113 3300005336 Bacteria 1014
13 Ga0070682_100267759 3300005337 Bacteria 1240
14 Ga0070660_100957345 3300005339 Bacteria 723
15 Ga0070689_101060078 3300005340 Bacteria 723
16 Ga0070691_10098121 3300005341 Bacteria 1452
17 Ga0070691_10262915 3300005341 Bacteria 930
18 Ga0070661_100624612 3300005344 Bacteria 873
19 Ga0070692_10050709 3300005345 Unclassified 2156
20 Ga0070692_10162238 3300005345 Bacteria 1282
21 Ga0070692_10512752 3300005345 Bacteria 779
22 Ga0070668_100282918 3300005347 Bacteria 1386
23 Ga0070669_100003834 3300005353 Bacteria 10858
24 Ga0070669_100413474 3300005353 Unclassified 1106
25 Ga0070675_100089952 3300005354 Bacteria 2571
26 Ga0070671_100028927 3300005355 Bacteria 4567
27 Ga0070671_100853265 3300005355 Bacteria 794
28 Ga0070674_100004305 3300005356 Bacteria 8102
29 Ga0070688_100564168 3300005365 Unclassified 867
30 Ga0070659_100114880 3300005366 Bacteria 2175
31 Ga0070659_100356395 3300005366 Bacteria 1228
32 Ga0070667_100010120 3300005367 Bacteria 7802
33 Ga0070709_10207767 3300005434 Bacteria 1390
34 Ga0070709_10683409 3300005434 Bacteria 797
35 Ga0070701_10178859 3300005438 Bacteria 1240
36 Ga0070701_10230518 3300005438 Bacteria 1109
37 Ga0070711_100000102 3300005439 Bacteria 44792
38 Ga0070711_100761413 3300005439 Bacteria 819
39 Ga0070705_100005926 3300005440 Bacteria 5977
40 Ga0070705_100012010 3300005440 Bacteria 4387
41 Ga0070705_100037361 3300005440 Bacteria 2738
42 Ga0070700_100110730 3300005441 Bacteria 1825
43 Ga0070700_100507475 3300005441 Bacteria 929
44 Ga0070694_100022371 3300005444 Bacteria 4050
45 Ga0070694_100161116 3300005444 Bacteria 1646
46 Ga0070708_100002594 3300005445 Bacteria 13974
47 Ga0070708_100041538 3300005445 Bacteria 4032
48 Ga0070708_100059681 3300005445 Bacteria 3402
49 Ga0070708_100073459 3300005445 Unclassified 3083
50 Ga0070708_100263574 3300005445 Unclassified 1620
51 Ga0070663_100154417 3300005455 Bacteria 1762
52 Ga0070663_100566497 3300005455 Bacteria 951
53 Ga0070663_101048340 3300005455 Unclassified 711
54 Ga0070662_100000777 3300005457 Bacteria 19681
55 Ga0070681_10137902 3300005458 Bacteria 2369
56 Ga0068867_100001516 3300005459 Bacteria 16088
57 Ga0070706_100042627 3300005467 Bacteria 4193
58 Ga0070706_100670593 3300005467 Unclassified 962
59 Ga0070706_100767066 3300005467 Unclassified 893
60 Ga0070707_100002297 3300005468 Bacteria 18268
61 Ga0070707_100012208 3300005468 Bacteria 8018
62 Ga0070707_100072853 3300005468 Bacteria 3312
63 Ga0070707_100218541 3300005468 Unclassified 1857
64 Ga0070707_100381693 3300005468 Bacteria 1369
65 Ga0070707_100531370 3300005468 Bacteria 1138
66 Ga0070698_100010863 3300005471 Bacteria 9688
67 Ga0070698_100032052 3300005471 Bacteria 5446
68 Ga0070698_100094655 3300005471 Bacteria 2966
69 Ga0070698_100099506 3300005471 Bacteria 2881
70 Ga0070698_100286524 3300005471 Bacteria 1578
71 Ga0070698_100856901 3300005471 Unclassified 854
72 Ga0070699_100001206 3300005518 Bacteria 23893
73 Ga0070699_100001560 3300005518 Bacteria 20969
74 Ga0070699_100003944 3300005518 Bacteria 13109
75 Ga0070699_100024573 3300005518 Bacteria 5194
76 Ga0070699_100049215 3300005518 Bacteria 3648
77 Ga0070699_100072113 3300005518 Unclassified 3004
78 Ga0070699_100130662 3300005518 Unclassified 2214
79 Ga0070679_100063566 3300005530 Bacteria 3679
80 Ga0070679_100117920 3300005530 Bacteria 2639
81 Ga0070679_100378334 3300005530 Bacteria 1363
82 Ga0070684_101036402 3300005535 Bacteria 770
83 Ga0070697_100049445 3300005536 Bacteria 3413
84 Ga0070697_100116433 3300005536 Bacteria 2232
85 Ga0070697_100924547 3300005536 Bacteria 774
86 Ga0068853_100419163 3300005539 Bacteria 1255
87 Ga0068853_100469796 3300005539 Bacteria 1185
88 Ga0070672_100141839 3300005543 Bacteria 1982
89 Ga0070686_100143449 3300005544 Unclassified 1665
90 Ga0070686_100168115 3300005544 Bacteria 1549
91 Ga0070686_100557900 3300005544 Bacteria 897
92 Ga0070695_100007192 3300005545 Bacteria 6600
93 Ga0070695_100098576 3300005545 Bacteria 1964
94 Ga0070695_100130546 3300005545 Bacteria 1731
95 Ga0070695_100144550 3300005545 Bacteria 1653
96 Ga0070695_100418389 3300005545 Bacteria 1020
97 Ga0070696_100002315 3300005546 Bacteria 12568
98 Ga0070696_100021954 3300005546 Bacteria 4331
99 Ga0070696_100024646 3300005546 Bacteria 4090
100 Ga0070696_100045007 3300005546 Bacteria 3057
101 Ga0070696_100055845 3300005546 Unclassified 2754
102 Ga0070696_100181802 3300005546 Bacteria 1560
103 Ga0070696_100199998 3300005546 Bacteria 1491
104 Ga0070696_100259198 3300005546 Unclassified 1318
105 Ga0070696_100349770 3300005546 Unclassified 1144
106 Ga0070696_101151383 3300005546 Bacteria 654
107 Ga0070693_100001534 3300005547 Bacteria 10426
108 Ga0070693_100050989 3300005547 Unclassified 2368
109 Ga0070693_100141054 3300005547 Bacteria 1517
110 Ga0070665_100128144 3300005548 Unclassified 2540
111 Ga0070665_100271467 3300005548 Bacteria 1698
112 Ga0070704_100000855 3300005549 Bacteria 15211
113 Ga0070704_100006919 3300005549 Bacteria 6720
114 Ga0068855_100111162 3300005563 Bacteria 3145
115 Ga0070664_100015342 3300005564 Bacteria 6265
116 Ga0070664_100854615 3300005564 Bacteria 852
117 Ga0068857_101028156 3300005577 Bacteria 794
118 Ga0068857_101032048 3300005577 Bacteria 792
119 Ga0068854_100009366 3300005578 Bacteria 6322
120 Ga0068854_100929561 3300005578 Unclassified 766
121 Ga0068856_100501079 3300005614 Bacteria 1235
122 Ga0070702_100006351 3300005615 Bacteria 5589
123 Ga0068852_100678687 3300005616 Bacteria 1039
124 Ga0068859_100032642 3300005617 Bacteria 5229
125 Ga0068859_100140770 3300005617 Bacteria 2486
126 Ga0068859_100671415 3300005617 Bacteria 1128
127 Ga0068864_100001860 3300005618 Bacteria 17319
128 Ga0068864_100016288 3300005618 Bacteria 6187
129 Ga0068864_100028332 3300005618 Unclassified 4732
130 Ga0068864_100918073 3300005618 Bacteria 865
131 Ga0068866_10000032 3300005718 Bacteria 56456
132 Ga0068866_10792209 3300005718 Bacteria 658
133 Ga0068861_100010300 3300005719 Bacteria 6487
134 Ga0068851_10325479 3300005834 Bacteria 889
135 Ga0068870_10015518 3300005840 Bacteria 3616
136 Ga0068870_10548462 3300005840 Bacteria 778
137 Ga0068863_100049521 3300005841 Unclassified 3984
138 Ga0068863_100168876 3300005841 Unclassified 2098
139 Ga0068858_100060625 3300005842 Unclassified 3497
140 Ga0068860_100018732 3300005843 Bacteria 6727
141 Ga0068860_100291380 3300005843 Unclassified 1597
142 Ga0068860_100390387 3300005843 Bacteria 1375
143 Ga0068860_100714083 3300005843 Bacteria 1013
144 Ga0068860_101212113 3300005843 Unclassified 775
145 Ga0068862_101198624 3300005844 Bacteria 758
146 Ga0081455_10047462 3300005937 Unclassified 3719
147 Ga0081538_10067306 3300005981 Bacteria 2001
148 Ga0070715_10080104 3300006163 Unclassified 1480
149 Ga0070715_10524791 3300006163 Unclassified 682
150 Ga0070712_100044684 3300006175 Bacteria 3055
151 Ga0097621_100090456 3300006237 Bacteria 2561
152 Ga0068871_100043892 3300006358 Unclassified 3593
153 Ga0075428_100005385 3300006844 Bacteria 14225
154 Ga0075428_100207787 3300006844 Bacteria 2116
155 Ga0075428_101465180 3300006844 Bacteria 716
156 Ga0075430_100211724 3300006846 Bacteria 1608
157 Ga0075430_100494912 3300006846 Unclassified 1009
158 Ga0075431_100013023 3300006847 Bacteria 8400
159 Ga0075431_100063152 3300006847 Bacteria 3821
160 Ga0075431_100075065 3300006847 Bacteria 3489
161 Ga0075431_100186529 3300006847 Bacteria 2127
162 Ga0075431_100343014 3300006847 Bacteria 1503
163 Ga0075431_100609703 3300006847 Unclassified 1075
164 Ga0075433_10069132 3300006852 Bacteria 3101
165 Ga0075433_10116747 3300006852 Bacteria 2368
166 Ga0075433_10161239 3300006852 Bacteria 1996
167 Ga0075433_10179885 3300006852 Bacteria 1881
168 Ga0075434_100001345 3300006871 Bacteria 20620
169 Ga0075434_100003406 3300006871 Bacteria 14234
170 Ga0075434_100076933 3300006871 Bacteria 3332
171 Ga0075429_100010791 3300006880 Bacteria 7900
172 Ga0075429_100043499 3300006880 Bacteria 3908
173 Ga0075429_100138559 3300006880 Bacteria 2130
174 Ga0068865_100008061 3300006881 Bacteria 6503
175 Ga0068865_100341299 3300006881 Bacteria 1210
176 Ga0068865_101322053 3300006881 Bacteria 641
177 Ga0075436_100032424 3300006914 Bacteria 3601
178 Ga0097620_100032641 3300006931 Bacteria 5229
179 Ga0097620_100140774 3300006931 Bacteria 2486
180 Ga0097620_100671424 3300006931 Bacteria 1128
181 Ga0075435_100080594 3300007076 Bacteria 2673
182 Ga0075435_100104673 3300007076 Bacteria 2348
183 Ga0075435_100185144 3300007076 Unclassified 1761
184 Ga0075435_100286487 3300007076 Bacteria 1407
185 Ga0105250_10158497 3300009092 Bacteria 944
186 Ga0105240_10072817 3300009093 Unclassified 4245
187 Ga0111539_10062423 3300009094 Bacteria 4411
188 Ga0105245_10039144 3300009098 Bacteria 4220
189 Ga0105247_10820402 3300009101 Bacteria 711
190 Ga0114129_10032491 3300009147 Bacteria 7376
191 Ga0114129_10088996 3300009147 Bacteria 4280
192 Ga0114129_10122655 3300009147 Bacteria 3575
193 Ga0114129_10308410 3300009147 Bacteria 2107
194 Ga0114129_10524197 3300009147 Bacteria 1544
195 Ga0114129_11044112 3300009147 Unclassified 1026
196 Ga0114129_11088404 3300009147 Bacteria 1001
197 Ga0114129_11209627 3300009147 Bacteria 941
198 Ga0114129_11532326 3300009147 Bacteria 818
199 Ga0105241_10017383 3300009174 Bacteria 5284
200 Ga0105241_10544772 3300009174 Bacteria 1041
201 Ga0105241_10787753 3300009174 Bacteria 875
202 Ga0105242_10001646 3300009176 Bacteria 17654
203 Ga0105248_10001568 3300009177 Bacteria 25438
204 Ga0105248_10031052 3300009177 Bacteria 5970
205 Ga0105248_10178643 3300009177 Bacteria 2392
206 Ga0105248_10675974 3300009177 Unclassified 1165
207 Ga0105248_10966132 3300009177 Bacteria 962
208 Ga0105248_11891517 3300009177 Unclassified 677
209 Ga0105237_10317984 3300009545 Bacteria 1560
210 Ga0105238_10512676 3300009551 Bacteria 1201
211 Ga0105249_10010310 3300009553 Bacteria 8211
212 Ga0105249_10069819 3300009553 Unclassified 3243
213 Ga0105249_10212988 3300009553 Unclassified 1897
214 Ga0105249_10235648 3300009553 Bacteria 1807
215 Ga0105249_10595025 3300009553 Bacteria 1160
216 Ga0105239_10003875 3300010375 Bacteria 18149
217 Ga0105239_10006776 3300010375 Bacteria 13228
218 Ga0105239_10914193 3300010375 Bacteria 1007
219 Ga0105246_10048552 3300011119 Bacteria 2902
220 Ga0105246_11188633 3300011119 Bacteria 701
221 Ga0157378_10000139 3300013297 Bacteria 68304
222 Ga0163162_10003097 3300013306 Bacteria 15878
223 Ga0163162_10029330 3300013306 Bacteria 5444
224 Ga0163162_10873565 3300013306 Bacteria 1013
225 Ga0157372_10118575 3300013307 Unclassified 3037
226 Ga0157375_10070463 3300013308 Bacteria 3506
227 Ga0157375_10071737 3300013308 Unclassified 3478
228 Ga0157375_11985476 3300013308 Bacteria 691
229 Ga0163163_10026921 3300014325 Bacteria 5501
230 Ga0163163_10084441 3300014325 Unclassified 3181
231 Ga0163163_10090141 3300014325 Unclassified 3079
232 Ga0163163_10316965 3300014325 Unclassified 1613
233 Ga0157380_10008310 3300014326 Bacteria 7397
234 Ga0157377_10371196 3300014745 Bacteria 966
235 Ga0157379_10010151 3300014968 Bacteria 8208
236 Ga0157379_10122476 3300014968 Bacteria 2340
237 Ga0157379_10149548 3300014968 Unclassified 2106
238 Ga0157379_10755839 3300014968 Bacteria 915
239 Ga0157379_11716877 3300014968 Bacteria 615
240 Ga0157376_10615504 3300014969 Bacteria 1082
241 Ga0163161_10071511 3300017792 Bacteria 2539
242 Ga0207697_10017558 3300025315 Bacteria 2940
243 Ga0207656_10451414 3300025321 Unclassified 650
244 Ga0207680_10150828 3300025903 Bacteria 1549
245 Ga0207645_10001229 3300025907 Bacteria 21105
246 Ga0207643_10001967 3300025908 Bacteria 11341
247 Ga0207684_10026040 3300025910 Bacteria 4985
248 Ga0207684_10411301 3300025910 Bacteria 1163
249 Ga0207654_10017992 3300025911 Unclassified 3704
250 Ga0207654_10289596 3300025911 Bacteria 1110
251 Ga0207707_10028011 3300025912 Unclassified 4925
252 Ga0207707_10037864 3300025912 Bacteria 4214
253 Ga0207707_10136560 3300025912 Bacteria 2144
254 Ga0207707_10211565 3300025912 Unclassified 1689
255 Ga0207695_10257778 3300025913 Bacteria 1642
256 Ga0207693_10062567 3300025915 Unclassified 2915
257 Ga0207693_10071148 3300025915 Unclassified 2722
258 Ga0207663_10064518 3300025916 Bacteria 2337
259 Ga0207663_10186168 3300025916 Bacteria 1487
260 Ga0207660_10041961 3300025917 Bacteria 3209
261 Ga0207660_10523827 3300025917 Bacteria 963
262 Ga0207657_10200591 3300025919 Unclassified 1605
263 Ga0207649_10494772 3300025920 Bacteria 929
264 Ga0207652_10016876 3300025921 Bacteria 5969
265 Ga0207652_10659745 3300025921 Bacteria 935
266 Ga0207646_10026635 3300025922 Bacteria 5274
267 Ga0207646_10220250 3300025922 Bacteria 1714
268 Ga0207646_10239499 3300025922 Bacteria 1639
269 Ga0207646_10356708 3300025922 Unclassified 1321
270 Ga0207681_10007199 3300025923 Bacteria 6825
271 Ga0207659_10050023 3300025926 Bacteria 2967
272 Ga0207659_10081037 3300025926 Bacteria 2399
273 Ga0207659_10138290 3300025926 Bacteria 1888
274 Ga0207687_10162736 3300025927 Bacteria 1714
275 Ga0207644_10148016 3300025931 Unclassified 1815
276 Ga0207644_10788811 3300025931 Bacteria 794
277 Ga0207690_10152833 3300025932 Bacteria 1713
278 Ga0207690_10209958 3300025932 Bacteria 1484
279 Ga0207690_10453253 3300025932 Bacteria 1031
280 Ga0207706_10000011 3300025933 Bacteria 196033
281 Ga0207706_10249272 3300025933 Bacteria 1551
282 Ga0207706_10869204 3300025933 Bacteria 763
283 Ga0207686_10000172 3300025934 Bacteria 49408
284 Ga0207709_10007865 3300025935 Bacteria 5909
285 Ga0207669_10000157 3300025937 Bacteria 32354
286 Ga0207669_10830320 3300025937 Bacteria 768
287 Ga0207704_10002088 3300025938 Bacteria 8954
288 Ga0207704_10489588 3300025938 Bacteria 989
289 Ga0207711_10002317 3300025941 Bacteria 17057
290 Ga0207711_10266398 3300025941 Bacteria 1576
291 Ga0207711_10286177 3300025941 Bacteria 1518
292 Ga0207689_10037850 3300025942 Bacteria 3998
293 Ga0207679_10009543 3300025945 Bacteria 6220
294 Ga0207679_10280425 3300025945 Bacteria 1429
295 Ga0207679_10665883 3300025945 Bacteria 942
296 Ga0207651_10438928 3300025960 Bacteria 1118
297 Ga0207712_10002980 3300025961 Bacteria 10809
298 Ga0207712_10038810 3300025961 Unclassified 3258
299 Ga0207712_10513498 3300025961 Unclassified 1026
300 Ga0207658_10913867 3300025986 Bacteria 799
301 Ga0207703_10024972 3300026035 Unclassified 4701
302 Ga0207703_10418405 3300026035 Unclassified 1246
303 Ga0207639_10544067 3300026041 Bacteria 1065
304 Ga0207639_10621818 3300026041 Bacteria 997
305 Ga0207678_10064660 3300026067 Unclassified 3143
306 Ga0207678_10130704 3300026067 Bacteria 2142
307 Ga0207678_10468046 3300026067 Unclassified 1097
308 Ga0207678_10805971 3300026067 Unclassified 829
309 Ga0207708_10253435 3300026075 Bacteria 1419
310 Ga0207702_10942387 3300026078 Bacteria 856
311 Ga0207641_10027227 3300026088 Bacteria 4721
312 Ga0207641_10037905 3300026088 Unclassified 4028
313 Ga0207641_11281545 3300026088 Bacteria 733
314 Ga0207648_10000011 3300026089 Bacteria 182284
315 Ga0207648_10333426 3300026089 Bacteria 1365
316 Ga0207676_10006300 3300026095 Bacteria 8381
317 Ga0207676_10340579 3300026095 Bacteria 1383
318 Ga0207676_10635609 3300026095 Bacteria 1028
319 Ga0207674_10765498 3300026116 Unclassified 932
320 Ga0207675_100011521 3300026118 Bacteria 8274
321 Ga0207683_10001778 3300026121 Bacteria 19080
322 Ga0207698_10498510 3300026142 Bacteria 1185
323 Ga0207698_11037715 3300026142 Bacteria 831
324 Ga0210000_1033317 3300027462 Bacteria 809
325 Ga0209974_10017856 3300027876 Bacteria 2353
326 Ga0209974_10032063 3300027876 Bacteria 1741
327 Ga0268266_10075592 3300028379 Unclassified 2926
328 Ga0268265_10061627 3300028380 Bacteria 2879
329 Ga0268265_10512233 3300028380 Bacteria 1133
330 Ga0268264_10007728 3300028381 Bacteria 8957
331 Ga0268264_10843938 3300028381 Bacteria 917
332 Ga0307408_100051148 3300031548 Unclassified 2975
333 Ga0307408_100165045 3300031548 Bacteria 1763
334 Ga0307408_100229906 3300031548 Unclassified 1518
335 Ga0307408_100287984 3300031548 Bacteria 1370
336 Ga0307408_100404857 3300031548 Bacteria 1172
337 Ga0307408_100785642 3300031548 Bacteria 863
338 Ga0307405_10004165 3300031731 Bacteria 6804
339 Ga0307405_10033580 3300031731 Bacteria 3045
340 Ga0307405_10510436 3300031731 Bacteria 965
341 Ga0307413_10004454 3300031824 Bacteria 6100
342 Ga0307413_10007272 3300031824 Bacteria 5127
343 Ga0307413_10007540 3300031824 Bacteria 5060
344 Ga0307413_10017314 3300031824 Bacteria 3750
345 Ga0307413_10059813 3300031824 Bacteria 2342
346 Ga0307413_10060053 3300031824 Bacteria 2339
347 Ga0307413_10099250 3300031824 Bacteria 1919
348 Ga0307410_10002699 3300031852 Bacteria 8663
349 Ga0307410_10057586 3300031852 Bacteria 2647
350 Ga0307410_10131559 3300031852 Bacteria 1838
351 Ga0307410_10585503 3300031852 Bacteria 929
352 Ga0307410_10708428 3300031852 Unclassified 849
353 Ga0307406_10679428 3300031901 Bacteria 857
354 Ga0307407_10005734 3300031903 Bacteria 5425
355 Ga0307407_10018773 3300031903 Unclassified 3506
356 Ga0307407_10100741 3300031903 Unclassified 1792
357 Ga0307407_10224024 3300031903 Bacteria 1273
358 Ga0307407_10603569 3300031903 Bacteria 817
359 Ga0307412_10011948 3300031911 Bacteria 5045
360 Ga0307412_10154589 3300031911 Bacteria 1697
361 Ga0307412_10309156 3300031911 Bacteria 1252
362 Ga0307409_100002275 3300031995 Bacteria 9945
363 Ga0307409_100091330 3300031995 Bacteria 2495
364 Ga0307409_100096578 3300031995 Bacteria 2438
365 Ga0307409_100160884 3300031995 Bacteria 1963
366 Ga0307416_100024136 3300032002 Bacteria 4431
367 Ga0307416_100029603 3300032002 Bacteria 4094
368 Ga0307416_100045355 3300032002 Bacteria 3461
369 Ga0307416_100072270 3300032002 Unclassified 2870
370 Ga0307416_100079063 3300032002 Bacteria 2770
371 Ga0307416_100086280 3300032002 Bacteria 2675
372 Ga0307416_100625476 3300032002 Unclassified 1159
373 Ga0307414_10006731 3300032004 Bacteria 6429
374 Ga0307414_10041942 3300032004 Bacteria 3105
375 Ga0307414_10088458 3300032004 Bacteria 2292
376 Ga0307414_10101065 3300032004 Bacteria 2170
377 Ga0307414_10228280 3300032004 Unclassified 1533
378 Ga0307411_10012443 3300032005 Unclassified 4644
379 Ga0307411_10024192 3300032005 Unclassified 3616
380 Ga0307411_10128694 3300032005 Bacteria 1846
381 Ga0307411_10345284 3300032005 Bacteria 1211
382 Ga0307411_10770474 3300032005 Bacteria 844
383 Ga0307411_10826035 3300032005 Unclassified 818
384 Ga0307415_100011456 3300032126 Bacteria 5076
385 Ga0307415_100087846 3300032126 Bacteria 2241
386 Ga0307415_100118496 3300032126 Unclassified 1980
387 Ga0307415_100125838 3300032126 Bacteria 1931
388 Ga0307415_100163279 3300032126 Unclassified 1729
389 Ga0307415_100286558 3300032126 Bacteria 1357
390 Ga0373928_0030593 3300035084 Bacteria 1191
391 Ga0373928_0143468 3300035084 Bacteria 656
392 Ga0373929_0020923 3300035085 Bacteria 1323
393 Ga0373940_0170410 3300035088 Bacteria 703
394 Ga0373949_0144662 3300035090 Bacteria 683
395 Ga0373951_0150653 3300035091 Bacteria 652
396 Ga0373932_0246169 3300035112 Bacteria 651
397 Ga0373939_0094819 3300035114 Bacteria 1015
398 Ga0373939_0103729 3300035114 Bacteria 980
399 Ga0373941_0160611 3300035115 Bacteria 831
400 Ga0373960_0174229 3300035121 Bacteria 748
401 Ga0373961_0044322 3300035241 Unclassified 1297
402 Ga0373961_0085816 3300035241 Bacteria 998
403 Ga0373961_0139437 3300035241 Bacteria 818
404 Ga0373962_0025813 3300035242 Bacteria 1580
405 Ga0316574_0045654 3300035398 Bacteria 2714
406 Ga0373931_0127275 3300035691 Bacteria 1462
407 Ga0373931_0753738 3300035691 Bacteria 646
408 Ga0373925_0342123 3300037068 Bacteria 1214
409 Ga0395905_0084365 3300037471 Bacteria 2976
410 Ga0395905_0980098 3300037471 Bacteria 748
411 Ga0395901_0833825 3300038443 Unclassified 909
412 Ga0242420_056267 3300038996 Unclassified 777
413 Ga0439439_0000401 3300041406 Bacteria 7230
414 Ga0439461_0062326 3300041410 Bacteria 850
415 Ga0451807_0740935 3300041486 Unclassified 885
416 Ga0451807_1594444 3300041486 Bacteria 2222
417 Ga0451849_0262525 3300041505 Unclassified 716
418 Ga0439431_0045682 3300041997 Bacteria 1125
419 Ga0439445_0044856 3300042004 Bacteria 1182
420 Ga0450921_004167 3300042123 Bacteria 1046
421 Ga0450896_020819 3300042133 Unclassified 961
422 Ga0439446_0002474 3300042156 Bacteria 4441
423 Ga0439446_0045349 3300042156 Bacteria 1303
424 Ga0439435_0010258 3300042436 Bacteria 2218
425 Ga0451577_0029171 3300042876 Bacteria 4986
426 Ga0451577_0045051 3300042876 Unclassified 3949
427 Ga0451577_0419946 3300042876 Bacteria 1214
428 Ga0451577_0601089 3300042876 Bacteria 998
429 Ga0453683_0008077 3300044673 Bacteria 7082
430 Ga0453683_0087489 3300044673 Bacteria 1953
431 Ga0453683_0450334 3300044673 Bacteria 832
432 Ga0453683_0606358 3300044673 Bacteria 714
433 Ga0453684_1097481 3300044712 Unclassified 841
434 Ga0453684_1588892 3300044712 Bacteria 672
435 Ga0451576_0039117 3300045051 Bacteria 5020
436 Ga0451576_0043261 3300045051 Unclassified 4753
437 Ga0451576_0060810 3300045051 Unclassified 3940
438 Ga0451576_0101612 3300045051 Bacteria 2990
439 Ga0451576_0391165 3300045051 Bacteria 1457
440 Ga0495603_0031150 3300046455 Bacteria 3211
441 Ga0495603_0224921 3300046455 Bacteria 1082
442 Ga0495590_0229310 3300046457 Unclassified 688
443 Ga0495580_0425106 3300046472 Bacteria 893
444 Ga0495639_0025905 3300046475 Bacteria 2589
445 Ga0495594_0003842 3300046499 Bacteria 7716
446 Ga0495594_0537573 3300046499 Bacteria 663
447 Ga0495618_0170710 3300046514 Bacteria 1384
448 Ga0495628_0352962 3300046516 Bacteria 1081
449 Ga0495644_0135173 3300046523 Unclassified 940
450 Ga0495640_0055778 3300046533 Bacteria 2702
451 Ga0495586_0020189 3300046535 Bacteria 3548
452 Ga0495586_0095484 3300046535 Unclassified 1645
453 Ga0495622_0017733 3300046557 Bacteria 3314
454 Ga0495622_0235078 3300046557 Bacteria 809
455 Ga0495667_0362787 3300046559 Unclassified 914
456 Ga0495634_0003912 3300046642 Bacteria 11827
457 Ga0495659_0093914 3300046664 Bacteria 1155
458 Ga0495588_0173303 3300046674 Bacteria 1141
459 Ga0495588_0183907 3300046674 Bacteria 1104
460 Ga0495657_0184570 3300046675 Unclassified 1278
461 Ga0495647_0004836 3300046681 Bacteria 4401
462 Ga0495670_0310980 3300046691 Bacteria 845
463 Ga0495636_0025903 3300047318 Unclassified 2383
464 Ga0495674_0250267 3300047319 Bacteria 1458
465 Ga0495676_0648973 3300047321 Bacteria 685
466 Ga0495680_0018395 3300047322 Bacteria 5934
467 Ga0496100_0020060 3300048903 Bacteria 4002
468 Ga0496100_0518736 3300048903 Bacteria 919
469 Ga0496101_0104052 3300048904 Unclassified 2129
470 Ga0496101_0241111 3300048904 Bacteria 1407
471 Ga0496101_0445426 3300048904 Bacteria 1022
472 Ga0496102_0004430 3300048905 Bacteria 11860
473 Ga0496102_0041289 3300048905 Unclassified 4176
474 Ga0496102_0044769 3300048905 Unclassified 4017
475 Ga0496102_0155598 3300048905 Bacteria 2149
476 Ga0496102_0206692 3300048905 Unclassified 1851
477 Ga0496102_1273946 3300048905 Bacteria 654
478 Ga0496103_0017126 3300048906 Bacteria 4333
479 Ga0496103_0270130 3300048906 Bacteria 1094
480 Ga0496103_0436400 3300048906 Bacteria 840
481 Ga0496104_0012154 3300048907 Bacteria 7733
482 Ga0496104_0516753 3300048907 Unclassified 1105
483 Ga0496104_0788460 3300048907 Unclassified 856
484 Ga0496105_0009978 3300048908 Bacteria 7451
485 Ga0496105_0222306 3300048908 Bacteria 1537
486 Ga0496105_0740195 3300048908 Bacteria 752
487 Ga0496106_0029511 3300048909 Bacteria 4087
488 Ga0496106_0105265 3300048909 Unclassified 2192
489 Ga0496106_0144630 3300048909 Unclassified 1872
490 Ga0496106_0283625 3300048909 Bacteria 1327
491 Ga0496106_0895049 3300048909 Unclassified 701
492 Ga0496107_0068715 3300048910 Bacteria 2571
493 Ga0496107_0137799 3300048910 Bacteria 1803
494 Ga0496108_0000530 3300048911 Bacteria 29778
495 Ga0496108_0017523 3300048911 Bacteria 5860
496 Ga0496108_0371112 3300048911 Unclassified 1249
497 Ga0496108_0375471 3300048911 Unclassified 1241
498 Ga0496108_1015538 3300048911 Unclassified 708
499 Ga0496109_0000886 3300048912 Bacteria 25030
500 Ga0496109_0004406 3300048912 Bacteria 11763
501 Ga0496109_0224109 3300048912 Bacteria 1768
502 Ga0496109_1255686 3300048912 Unclassified 677
503 Ga0496110_0095154 3300048913 Unclassified 2667
504 Ga0496110_0495702 3300048913 Bacteria 1112
505 Ga0496110_0838271 3300048913 Bacteria 824
506 Ga0496110_0888518 3300048913 Unclassified 797
507 Ga0496111_0008935 3300048914 Bacteria 6664
508 Ga0496111_0017882 3300048914 Bacteria 4904
509 Ga0496111_0033125 3300048914 Unclassified 3685
510 Ga0496112_0000343 3300048915 Bacteria 30294
511 Ga0496112_0006525 3300048915 Bacteria 10259
512 Ga0496112_0025908 3300048915 Bacteria 5635
513 Ga0496112_0048083 3300048915 Bacteria 4184
514 Ga0496113_0000225 3300048916 Bacteria 26482
515 Ga0496113_0001395 3300048916 Bacteria 13437
516 Ga0496114_0045367 3300048917 Bacteria 3651
517 Ga0496114_0130019 3300048917 Unclassified 2174
518 Ga0496115_0238999 3300048918 Unclassified 1497
519 Ga0496115_0673009 3300048918 Unclassified 816
520 Ga0501031_0240090 3300049568 Bacteria 1178
521 Ga0501033_0124194 3300049570 Bacteria 1872
522 Ga0501033_0406181 3300049570 Bacteria 949
523 Ga0501034_0044000 3300049571 Bacteria 4516
524 Ga0501034_0114976 3300049571 Bacteria 2679
525 Ga0501036_0257200 3300049572 Bacteria 1463
526 Ga0501036_0330619 3300049572 Bacteria 1273
527 Ga0501037_0319468 3300049573 Bacteria 1075
528 Ga0501038_0105018 3300049574 Bacteria 2347
529 Ga0501038_0574207 3300049574 Bacteria 856
530 Ga0501040_0025937 3300049576 Bacteria 3943
531 Ga0501040_0583164 3300049576 Bacteria 807
532 Ga0501041_0158922 3300049577 Bacteria 1412
533 Ga0501041_0509884 3300049577 Bacteria 765
534 Ga0501043_0792777 3300049579 Unclassified 686
535 Ga0501046_0017035 3300049580 Bacteria 6075
536 Ga0501046_0118158 3300049580 Bacteria 2019
537 Ga0501048_0065316 3300049582 Bacteria 2573
538 Ga0501048_0482762 3300049582 Unclassified 888
539 Ga0501067_0005831 3300049583 Bacteria 6831
540 Ga0501067_0009208 3300049583 Bacteria 5468
541 Ga0501067_0071434 3300049583 Bacteria 1922
542 Ga0501067_0130298 3300049583 Bacteria 1400
543 Ga0501067_0287159 3300049583 Bacteria 916
544 Ga0501068_0001812 3300049584 Bacteria 11354
545 Ga0501068_0007727 3300049584 Bacteria 5950
546 Ga0501068_0102951 3300049584 Unclassified 1770
547 Ga0501068_0245079 3300049584 Bacteria 1141
548 Ga0501069_0012776 3300049585 Bacteria 4470
549 Ga0501069_0014049 3300049585 Bacteria 4277
550 Ga0501069_0061873 3300049585 Bacteria 2090
551 Ga0501069_0106809 3300049585 Bacteria 1592
552 Ga0501069_0291042 3300049585 Bacteria 957
553 Ga0501070_0015434 3300049586 Bacteria 6425
554 Ga0501070_0033441 3300049586 Bacteria 4302
555 Ga0501070_0045161 3300049586 Bacteria 3665
556 Ga0501070_0083776 3300049586 Unclassified 2640
557 Ga0501070_0102547 3300049586 Unclassified 2366
558 Ga0501071_0004064 3300049587 Bacteria 9243
559 Ga0501071_0008957 3300049587 Bacteria 6639
560 Ga0501071_0271055 3300049587 Unclassified 1283
561 Ga0501071_0420351 3300049587 Unclassified 1021
562 Ga0501071_0546085 3300049587 Bacteria 890
563 Ga0501072_0018594 3300049588 Bacteria 5355
564 Ga0501072_0026418 3300049588 Bacteria 4527
565 Ga0501072_0042841 3300049588 Bacteria 3556
566 Ga0501072_0048033 3300049588 Bacteria 3361
567 Ga0501072_0730500 3300049588 Bacteria 777
568 Ga0501073_0029915 3300049589 Bacteria 3889
569 Ga0501073_0045950 3300049589 Unclassified 3074
570 Ga0501073_0052803 3300049589 Bacteria 2845
571 Ga0501073_0191313 3300049589 Bacteria 1416
572 Ga0501074_0008030 3300049590 Bacteria 7643
573 Ga0501074_0022454 3300049590 Bacteria 4584
574 Ga0501074_0046206 3300049590 Bacteria 3148
575 Ga0501074_0157615 3300049590 Unclassified 1621
576 Ga0501075_0010146 3300049591 Bacteria 6610
577 Ga0501075_0029007 3300049591 Bacteria 4090
578 Ga0501075_0178679 3300049591 Unclassified 1620
579 Ga0501075_0297449 3300049591 Bacteria 1230
580 Ga0501076_0007418 3300049592 Bacteria 7981
581 Ga0501076_0080019 3300049592 Bacteria 2622
582 Ga0501076_0124950 3300049592 Unclassified 2085
583 Ga0501076_0410356 3300049592 Bacteria 1114
584 Ga0501076_0516432 3300049592 Bacteria 985
585 Ga0501077_0000260 3300049593 Bacteria 31177
586 Ga0501077_0020192 3300049593 Bacteria 4218
587 Ga0501077_0045986 3300049593 Bacteria 2773
588 Ga0501077_0576539 3300049593 Unclassified 722
589 Ga0501202_089866 3300049652 Bacteria 733
590 Ga0501216_034690 3300049660 Bacteria 946
591 Ga0501217_019707 3300049661 Bacteria 1578
592 Ga0501217_020278 3300049661 Unclassified 1560
593 Ga0501233_010892 3300049668 Bacteria 1800
594 Ga0501249_061784 3300049679 Bacteria 868
595 Ga0501253_030460 3300049683 Bacteria 1025
596 Ga0501257_072002 3300049686 Unclassified 884
597 Ga0501221_011185 3300049704 Bacteria 1610
598 Ga0501234_025380 3300049707 Bacteria 951
599 Ga0501079_0006682 3300049741 Bacteria 8675
600 Ga0501079_0023522 3300049741 Bacteria 4728
601 Ga0501079_0225833 3300049741 Unclassified 1463
602 Ga0501079_0357893 3300049741 Bacteria 1144
603 Ga0501079_0859297 3300049741 Bacteria 714
604 Ga0501080_0032078 3300049742 Bacteria 4897
605 Ga0501080_0039082 3300049742 Bacteria 4429
606 Ga0501080_0047393 3300049742 Unclassified 4000
607 Ga0501080_0071855 3300049742 Bacteria 3219
608 Ga0501080_0127719 3300049742 Bacteria 2354
609 Ga0501080_0728523 3300049742 Bacteria 873
610 Ga0501080_0821118 3300049742 Unclassified 814
611 Ga0501080_1105087 3300049742 Unclassified 684
612 Ga0501081_0060736 3300049743 Bacteria 2619
613 Ga0501081_0063481 3300049743 Bacteria 2563
614 Ga0501081_0168698 3300049743 Unclassified 1580
615 Ga0501081_0276618 3300049743 Unclassified 1228
616 Ga0501081_0837442 3300049743 Bacteria 693
617 Ga0501083_0004893 3300049744 Bacteria 9472
618 Ga0501083_0084757 3300049744 Bacteria 2097
619 Ga0501083_0114634 3300049744 Bacteria 1770
620 Ga0501083_0578988 3300049744 Unclassified 730
621 Ga0501268_040747 3300049765 Bacteria 873
622 Ga0501270_008297 3300049767 Bacteria 1310
623 Ga0501270_029083 3300049767 Bacteria 900
624 Ga0501045_0012832 3300049824 Bacteria 5906
625 Ga0501045_0015441 3300049824 Bacteria 5418
626 Ga0501045_0179605 3300049824 Unclassified 1577
627 Ga0501045_0517635 3300049824 Unclassified 886
628 Ga0501045_0723335 3300049824 Unclassified 734
629 Ga0501212_014727 3300049851 Bacteria 1160
630 nmdc:mga05p37_105756_c1 3300050507 Bacteria 3462
631 nmdc:mga05p37_11492_c1 3300050507 Bacteria 10547
632 nmdc:mga05p37_1174461_c1 3300050507 Bacteria 796
633 nmdc:mga05p37_138024_c1 3300050507 Bacteria 2988
634 nmdc:mga05p37_165311_c1 3300050507 Bacteria 2701
635 nmdc:mga05p37_170861_c1 3300050507 Bacteria 2651
636 nmdc:mga05p37_360796_c1 3300050507 Unclassified 1708
637 nmdc:mga05p37_402334_c1 3300050507 Bacteria 1598
638 nmdc:mga05p37_763454_c1 3300050507 Unclassified 1064
639 nmdc:mga09592_136933_c1 3300050508 Bacteria 2109
640 nmdc:mga09592_23347_c1 3300050508 Bacteria 5108
641 nmdc:mga09592_364767_c1 3300050508 Unclassified 1250
642 nmdc:mga09592_483369_c1 3300050508 Unclassified 1067
643 nmdc:mga09592_771467_c1 3300050508 Bacteria 815
644 nmdc:mga0qj67_198609_c1 3300050509 Bacteria 1630
645 nmdc:mga0qj67_459318_c1 3300050509 Bacteria 1025
646 nmdc:mga06r32_20739_c1 3300050510 Bacteria 6053
647 nmdc:mga06r32_227606_c1 3300050510 Bacteria 1853
648 nmdc:mga06r32_58229_c1 3300050510 Bacteria 3713
649 nmdc:mga06r32_70819_c1 3300050510 Unclassified 3373
650 nmdc:mga06r32_943816_c1 3300050510 Unclassified 817
651 nmdc:mga08y16_412358_c1 3300050511 Bacteria 1381
652 nmdc:mga08y16_690933_c1 3300050511 Unclassified 1021
653 nmdc:mga0n895_1142893_c1 3300050512 Bacteria 754
654 nmdc:mga0n895_2011_c1 3300050512 Bacteria 15626
655 nmdc:mga0n895_540458_c1 3300050512 Archaea 1172
656 nmdc:mga0n895_893884_c1 3300050512 Bacteria 874
657 nmdc:mga0n895_918982_c1 3300050512 Bacteria 860
658 nmdc:mga0rr50_243400_c1 3300050513 Bacteria 1491
659 nmdc:mga0rr50_365627_c1 3300050513 Unclassified 1215
660 nmdc:mga0rr50_95824_c1 3300050513 Unclassified 2320
661 nmdc:mga08x19_10821_c1 3300050514 Bacteria 5486
662 nmdc:mga0a205_130456_c1 3300050515 Bacteria 2414
663 nmdc:mga0a205_185057_c1 3300050515 Bacteria 1976
664 nmdc:mga0a205_535171_c1 3300050515 Bacteria 1027
665 nmdc:mga0a205_59556_c1 3300050515 Bacteria 3688
666 nmdc:mga0a205_83247_c1 3300050515 Bacteria 3090
667 Ga0501084_0012198 3300054114 Bacteria 7111
668 Ga0501084_0018137 3300054114 Bacteria 5862
669 Ga0501084_0032795 3300054114 Bacteria 4346
670 Ga0501084_0078704 3300054114 Unclassified 2763
671 Ga0501084_0116453 3300054114 Bacteria 2246
672 Ga0501084_0180567 3300054114 Bacteria 1781
673 Ga0501084_0188597 3300054114 Bacteria 1740
674 Ga0590071_014604 3300059421 Bacteria 1842
675 Ga0590074_036714 3300059423 Unclassified 876
676 Ga0590075_004856 3300059424 Bacteria 3180
677 Ga0590075_016974 3300059424 Archaea 1793
678 Ga0501082_0023164 3300060353 Bacteria 5356
679 Ga0501082_0048394 3300060353 Bacteria 3664
680 Ga0501082_0079964 3300060353 Bacteria 2820
681 Ga0501082_0156280 3300060353 Bacteria 1981
682 Ga0501082_0195226 3300060353 Bacteria 1761
683 Ga0501082_0300056 3300060353 Bacteria 1399
684 Ga0530510_0025511 3300061734 Bacteria 4227
685 Ga0530510_0085130 3300061734 Unclassified 2303
686 Ga0530510_0370164 3300061734 Bacteria 1078
687 Ga0439434_0031575
688 Ga0058863_11731781
689 Ga0058862_10047534
690 Ga0065715_10363302
691 Ga0070683_101007997
692 Ga0070690_100011251
693 Ga0068869_100034358
694 Ga0070666_10193131
695 Ga0070680_100029768
696 Ga0070680_100033249
697 Ga0070680_100183025
698 Ga0070680_100525113
699 Ga0070682_100267759
700 Ga0070660_100957345
701 Ga0070689_101060078
702 Ga0070691_10098121
703 Ga0070691_10262915
704 Ga0070661_100624612
705 Ga0070692_10050709
706 Ga0070692_10162238
707 Ga0070692_10512752
708 Ga0070668_100282918
709 Ga0070669_100003834
710 Ga0070669_100413474
711 Ga0070675_100089952
712 Ga0070671_100028927
713 Ga0070671_100853265
714 Ga0070674_100004305
715 Ga0070688_100564168
716 Ga0070659_100114880
717 Ga0070659_100356395
718 Ga0070667_100010120
719 Ga0070709_10207767
720 Ga0070709_10683409
721 Ga0070701_10178859
722 Ga0070701_10230518
723 Ga0070711_100000102
724 Ga0070711_100761413
725 Ga0070705_100005926
726 Ga0070705_100012010
727 Ga0070705_100037361
728 Ga0070700_100110730
729 Ga0070700_100507475
730 Ga0070694_100022371
731 Ga0070694_100161116
732 Ga0070708_100002594
733 Ga0070708_100041538
734 Ga0070708_100059681
735 Ga0070708_100073459
736 Ga0070708_100263574
737 Ga0070663_100154417
738 Ga0070663_100566497
739 Ga0070663_101048340
740 Ga0070662_100000777
741 Ga0070681_10137902
742 Ga0068867_100001516
743 Ga0070706_100042627
744 Ga0070706_100670593
745 Ga0070706_100767066
746 Ga0070707_100002297
747 Ga0070707_100012208
748 Ga0070707_100072853
749 Ga0070707_100218541
750 Ga0070707_100381693
751 Ga0070707_100531370
752 Ga0070698_100010863
753 Ga0070698_100032052
754 Ga0070698_100094655
755 Ga0070698_100099506
756 Ga0070698_100286524
757 Ga0070698_100856901
758 Ga0070699_100001206
759 Ga0070699_100001560
760 Ga0070699_100003944
761 Ga0070699_100024573
762 Ga0070699_100049215
763 Ga0070699_100072113
764 Ga0070699_100130662
765 Ga0070679_100063566
766 Ga0070679_100117920
767 Ga0070679_100378334
768 Ga0070684_101036402
769 Ga0070697_100049445
770 Ga0070697_100116433
771 Ga0070697_100924547
772 Ga0068853_100419163
773 Ga0068853_100469796
774 Ga0070672_100141839
775 Ga0070686_100143449
776 Ga0070686_100168115
777 Ga0070686_100557900
778 Ga0070695_100007192
779 Ga0070695_100098576
780 Ga0070695_100130546
781 Ga0070695_100144550
782 Ga0070695_100418389
783 Ga0070696_100002315
784 Ga0070696_100021954
785 Ga0070696_100024646
786 Ga0070696_100045007
787 Ga0070696_100055845
788 Ga0070696_100181802
789 Ga0070696_100199998
790 Ga0070696_100259198
791 Ga0070696_100349770
792 Ga0070696_101151383
793 Ga0070693_100001534
794 Ga0070693_100050989
795 Ga0070693_100141054
796 Ga0070665_100128144
797 Ga0070665_100271467
798 Ga0070704_100000855
799 Ga0070704_100006919
800 Ga0068855_100111162
801 Ga0070664_100015342
802 Ga0070664_100854615
803 Ga0068857_101028156
804 Ga0068857_101032048
805 Ga0068854_100009366
806 Ga0068854_100929561
807 Ga0068856_100501079
808 Ga0070702_100006351
809 Ga0068852_100678687
810 Ga0068859_100032642
811 Ga0068859_100140770
812 Ga0068859_100671415
813 Ga0068864_100001860
814 Ga0068864_100016288
815 Ga0068864_100028332
816 Ga0068864_100918073
817 Ga0068866_10000032
818 Ga0068866_10792209
819 Ga0068861_100010300
820 Ga0068851_10325479
821 Ga0068870_10015518
822 Ga0068870_10548462
823 Ga0068863_100049521
824 Ga0068863_100168876
825 Ga0068858_100060625
826 Ga0068860_100018732
827 Ga0068860_100291380
828 Ga0068860_100390387
829 Ga0068860_100714083
830 Ga0068860_101212113
831 Ga0068862_101198624
832 Ga0081455_10047462
833 Ga0081538_10067306
834 Ga0070715_10080104
835 Ga0070715_10524791
836 Ga0070712_100044684
837 Ga0097621_100090456
838 Ga0068871_100043892
839 Ga0075428_100005385
840 Ga0075428_100207787
841 Ga0075428_101465180
842 Ga0075430_100211724
843 Ga0075430_100494912
844 Ga0075431_100013023
845 Ga0075431_100063152
846 Ga0075431_100075065
847 Ga0075431_100186529
848 Ga0075431_100343014
849 Ga0075431_100609703
850 Ga0075433_10069132
851 Ga0075433_10116747
852 Ga0075433_10161239
853 Ga0075433_10179885
854 Ga0075434_100001345
855 Ga0075434_100003406
856 Ga0075434_100076933
857 Ga0075429_100010791
858 Ga0075429_100043499
859 Ga0075429_100138559
860 Ga0068865_100008061
861 Ga0068865_100341299
862 Ga0068865_101322053
863 Ga0075436_100032424
864 Ga0097620_100032641
865 Ga0097620_100140774
866 Ga0097620_100671424
867 Ga0075435_100080594
868 Ga0075435_100104673
869 Ga0075435_100185144
870 Ga0075435_100286487
871 Ga0105250_10158497
872 Ga0105240_10072817
873 Ga0111539_10062423
874 Ga0105245_10039144
875 Ga0105247_10820402
876 Ga0114129_10032491
877 Ga0114129_10088996
878 Ga0114129_10122655
879 Ga0114129_10308410
880 Ga0114129_10524197
881 Ga0114129_11044112
882 Ga0114129_11088404
883 Ga0114129_11209627
884 Ga0114129_11532326
885 Ga0105241_10017383
886 Ga0105241_10544772
887 Ga0105241_10787753
888 Ga0105242_10001646
889 Ga0105248_10001568
890 Ga0105248_10031052
891 Ga0105248_10178643
892 Ga0105248_10675974
893 Ga0105248_10966132
894 Ga0105248_11891517
895 Ga0105237_10317984
896 Ga0105238_10512676
897 Ga0105249_10010310
898 Ga0105249_10069819
899 Ga0105249_10212988
900 Ga0105249_10235648
901 Ga0105249_10595025
902 Ga0105239_10003875
903 Ga0105239_10006776
904 Ga0105239_10914193
905 Ga0105246_10048552
906 Ga0105246_11188633
907 Ga0157378_10000139
908 Ga0163162_10003097
909 Ga0163162_10029330
910 Ga0163162_10873565
911 Ga0157372_10118575
912 Ga0157375_10070463
913 Ga0157375_10071737
914 Ga0157375_11985476
915 Ga0163163_10026921
916 Ga0163163_10084441
917 Ga0163163_10090141
918 Ga0163163_10316965
919 Ga0157380_10008310
920 Ga0157377_10371196
921 Ga0157379_10010151
922 Ga0157379_10122476
923 Ga0157379_10149548
924 Ga0157379_10755839
925 Ga0157379_11716877
926 Ga0157376_10615504
927 Ga0163161_10071511
928 Ga0207697_10017558
929 Ga0207656_10451414
930 Ga0207680_10150828
931 Ga0207645_10001229
932 Ga0207643_10001967
933 Ga0207684_10026040
934 Ga0207684_10411301
935 Ga0207654_10017992
936 Ga0207654_10289596
937 Ga0207707_10028011
938 Ga0207707_10037864
939 Ga0207707_10136560
940 Ga0207707_10211565
941 Ga0207695_10257778
942 Ga0207693_10062567
943 Ga0207693_10071148
944 Ga0207663_10064518
945 Ga0207663_10186168
946 Ga0207660_10041961
947 Ga0207660_10523827
948 Ga0207657_10200591
949 Ga0207649_10494772
950 Ga0207652_10016876
951 Ga0207652_10659745
952 Ga0207646_10026635
953 Ga0207646_10220250
954 Ga0207646_10239499
955 Ga0207646_10356708
956 Ga0207681_10007199
957 Ga0207659_10050023
958 Ga0207659_10081037
959 Ga0207659_10138290
960 Ga0207687_10162736
961 Ga0207644_10148016
962 Ga0207644_10788811
963 Ga0207690_10152833
964 Ga0207690_10209958
965 Ga0207690_10453253
966 Ga0207706_10000011
967 Ga0207706_10249272
968 Ga0207706_10869204
969 Ga0207686_10000172
970 Ga0207709_10007865
971 Ga0207669_10000157
972 Ga0207669_10830320
973 Ga0207704_10002088
974 Ga0207704_10489588
975 Ga0207711_10002317
976 Ga0207711_10266398
977 Ga0207711_10286177
978 Ga0207689_10037850
979 Ga0207679_10009543
980 Ga0207679_10280425
981 Ga0207679_10665883
982 Ga0207651_10438928
983 Ga0207712_10002980
984 Ga0207712_10038810
985 Ga0207712_10513498
986 Ga0207658_10913867
987 Ga0207703_10024972
988 Ga0207703_10418405
989 Ga0207639_10544067
990 Ga0207639_10621818
991 Ga0207678_10064660
992 Ga0207678_10130704
993 Ga0207678_10468046
994 Ga0207678_10805971
995 Ga0207708_10253435
996 Ga0207702_10942387
997 Ga0207641_10027227
998 Ga0207641_10037905
999 Ga0207641_11281545
1000 Ga0207648_10000011
1001 Ga0207648_10333426
1002 Ga0207676_10006300
1003 Ga0207676_10340579
1004 Ga0207676_10635609
1005 Ga0207674_10765498
1006 Ga0207675_100011521
1007 Ga0207683_10001778
1008 Ga0207698_10498510
1009 Ga0207698_11037715
1010 Ga0210000_1033317
1011 Ga0209974_10017856
1012 Ga0209974_10032063
1013 Ga0268266_10075592
1014 Ga0268265_10061627
1015 Ga0268265_10512233
1016 Ga0268264_10007728
1017 Ga0268264_10843938
1018 Ga0307408_100051148
1019 Ga0307408_100165045
1020 Ga0307408_100229906
1021 Ga0307408_100287984
1022 Ga0307408_100404857
1023 Ga0307408_100785642
1024 Ga0307405_10004165
1025 Ga0307405_10033580
1026 Ga0307405_10510436
1027 Ga0307413_10004454
1028 Ga0307413_10007272
1029 Ga0307413_10007540
1030 Ga0307413_10017314
1031 Ga0307413_10059813
1032 Ga0307413_10060053
1033 Ga0307413_10099250
1034 Ga0307410_10002699
1035 Ga0307410_10057586
1036 Ga0307410_10131559
1037 Ga0307410_10585503
1038 Ga0307410_10708428
1039 Ga0307406_10679428
1040 Ga0307407_10005734
1041 Ga0307407_10018773
1042 Ga0307407_10100741
1043 Ga0307407_10224024
1044 Ga0307407_10603569
1045 Ga0307412_10011948
1046 Ga0307412_10154589
1047 Ga0307412_10309156
1048 Ga0307409_100002275
1049 Ga0307409_100091330
1050 Ga0307409_100096578
1051 Ga0307409_100160884
1052 Ga0307416_100024136
1053 Ga0307416_100029603
1054 Ga0307416_100045355
1055 Ga0307416_100072270
1056 Ga0307416_100079063
1057 Ga0307416_100086280
1058 Ga0307416_100625476
1059 Ga0307414_10006731
1060 Ga0307414_10041942
1061 Ga0307414_10088458
1062 Ga0307414_10101065
1063 Ga0307414_10228280
1064 Ga0307411_10012443
1065 Ga0307411_10024192
1066 Ga0307411_10128694
1067 Ga0307411_10345284
1068 Ga0307411_10770474
1069 Ga0307411_10826035
1070 Ga0307415_100011456
1071 Ga0307415_100087846
1072 Ga0307415_100118496
1073 Ga0307415_100125838
1074 Ga0307415_100163279
1075 Ga0307415_100286558
1076 Ga0373928_0030593
1077 Ga0373928_0143468
1078 Ga0373929_0020923
1079 Ga0373940_0170410
1080 Ga0373949_0144662
1081 Ga0373951_0150653
1082 Ga0373932_0246169
1083 Ga0373939_0094819
1084 Ga0373939_0103729
1085 Ga0373941_0160611
1086 Ga0373960_0174229
1087 Ga0373961_0044322
1088 Ga0373961_0085816
1089 Ga0373961_0139437
1090 Ga0373962_0025813
1091 Ga0316574_0045654
1092 Ga0373931_0127275
1093 Ga0373931_0753738
1094 Ga0373925_0342123
1095 Ga0395905_0084365
1096 Ga0395905_0980098
1097 Ga0395901_0833825
1098 Ga0242420_056267
1099 Ga0439439_0000401
1100 Ga0439461_0062326
1101 Ga0451807_0740935
1102 Ga0451807_1594444
1103 Ga0451849_0262525
1104 Ga0439431_0045682
1105 Ga0439445_0044856
1106 Ga0450921_004167
1107 Ga0450896_020819
1108 Ga0439446_0002474
1109 Ga0439446_0045349
1110 Ga0439435_0010258
1111 Ga0451577_0029171
1112 Ga0451577_0045051
1113 Ga0451577_0419946
1114 Ga0451577_0601089
1115 Ga0453683_0008077
1116 Ga0453683_0087489
1117 Ga0453683_0450334
1118 Ga0453683_0606358
1119 Ga0453684_1097481
1120 Ga0453684_1588892
1121 Ga0451576_0039117
1122 Ga0451576_0043261
1123 Ga0451576_0060810
1124 Ga0451576_0101612
1125 Ga0451576_0391165
1126 Ga0495603_0031150
1127 Ga0495603_0224921
1128 Ga0495590_0229310
1129 Ga0495580_0425106
1130 Ga0495639_0025905
1131 Ga0495594_0003842
1132 Ga0495594_0537573
1133 Ga0495618_0170710
1134 Ga0495628_0352962
1135 Ga0495644_0135173
1136 Ga0495640_0055778
1137 Ga0495586_0020189
1138 Ga0495586_0095484
1139 Ga0495622_0017733
1140 Ga0495622_0235078
1141 Ga0495667_0362787
1142 Ga0495634_0003912
1143 Ga0495659_0093914
1144 Ga0495588_0173303
1145 Ga0495588_0183907
1146 Ga0495657_0184570
1147 Ga0495647_0004836
1148 Ga0495670_0310980
1149 Ga0495636_0025903
1150 Ga0495674_0250267
1151 Ga0495676_0648973
1152 Ga0495680_0018395
1153 Ga0496100_0020060
1154 Ga0496100_0518736
1155 Ga0496101_0104052
1156 Ga0496101_0241111
1157 Ga0496101_0445426
1158 Ga0496102_0004430
1159 Ga0496102_0041289
1160 Ga0496102_0044769
1161 Ga0496102_0155598
1162 Ga0496102_0206692
1163 Ga0496102_1273946
1164 Ga0496103_0017126
1165 Ga0496103_0270130
1166 Ga0496103_0436400
1167 Ga0496104_0012154
1168 Ga0496104_0516753
1169 Ga0496104_0788460
1170 Ga0496105_0009978
1171 Ga0496105_0222306
1172 Ga0496105_0740195
1173 Ga0496106_0029511
1174 Ga0496106_0105265
1175 Ga0496106_0144630
1176 Ga0496106_0283625
1177 Ga0496106_0895049
1178 Ga0496107_0068715
1179 Ga0496107_0137799
1180 Ga0496108_0000530
1181 Ga0496108_0017523
1182 Ga0496108_0371112
1183 Ga0496108_0375471
1184 Ga0496108_1015538
1185 Ga0496109_0000886
1186 Ga0496109_0004406
1187 Ga0496109_0224109
1188 Ga0496109_1255686
1189 Ga0496110_0095154
1190 Ga0496110_0495702
1191 Ga0496110_0838271
1192 Ga0496110_0888518
1193 Ga0496111_0008935
1194 Ga0496111_0017882
1195 Ga0496111_0033125
1196 Ga0496112_0000343
1197 Ga0496112_0006525
1198 Ga0496112_0025908
1199 Ga0496112_0048083
1200 Ga0496113_0000225
1201 Ga0496113_0001395
1202 Ga0496114_0045367
1203 Ga0496114_0130019
1204 Ga0496115_0238999
1205 Ga0496115_0673009
1206 Ga0501031_0240090
1207 Ga0501033_0124194
1208 Ga0501033_0406181
1209 Ga0501034_0044000
1210 Ga0501034_0114976
1211 Ga0501036_0257200
1212 Ga0501036_0330619
1213 Ga0501037_0319468
1214 Ga0501038_0105018
1215 Ga0501038_0574207
1216 Ga0501040_0025937
1217 Ga0501040_0583164
1218 Ga0501041_0158922
1219 Ga0501041_0509884
1220 Ga0501043_0792777
1221 Ga0501046_0017035
1222 Ga0501046_0118158
1223 Ga0501048_0065316
1224 Ga0501048_0482762
1225 Ga0501067_0005831
1226 Ga0501067_0009208
1227 Ga0501067_0071434
1228 Ga0501067_0130298
1229 Ga0501067_0287159
1230 Ga0501068_0001812
1231 Ga0501068_0007727
1232 Ga0501068_0102951
1233 Ga0501068_0245079
1234 Ga0501069_0012776
1235 Ga0501069_0014049
1236 Ga0501069_0061873
1237 Ga0501069_0106809
1238 Ga0501069_0291042
1239 Ga0501070_0015434
1240 Ga0501070_0033441
1241 Ga0501070_0045161
1242 Ga0501070_0083776
1243 Ga0501070_0102547
1244 Ga0501071_0004064
1245 Ga0501071_0008957
1246 Ga0501071_0271055
1247 Ga0501071_0420351
1248 Ga0501071_0546085
1249 Ga0501072_0018594
1250 Ga0501072_0026418
1251 Ga0501072_0042841
1252 Ga0501072_0048033
1253 Ga0501072_0730500
1254 Ga0501073_0029915
1255 Ga0501073_0045950
1256 Ga0501073_0052803
1257 Ga0501073_0191313
1258 Ga0501074_0008030
1259 Ga0501074_0022454
1260 Ga0501074_0046206
1261 Ga0501074_0157615
1262 Ga0501075_0010146
1263 Ga0501075_0029007
1264 Ga0501075_0178679
1265 Ga0501075_0297449
1266 Ga0501076_0007418
1267 Ga0501076_0080019
1268 Ga0501076_0124950
1269 Ga0501076_0410356
1270 Ga0501076_0516432
1271 Ga0501077_0000260
1272 Ga0501077_0020192
1273 Ga0501077_0045986
1274 Ga0501077_0576539
1275 Ga0501202_089866
1276 Ga0501216_034690
1277 Ga0501217_019707
1278 Ga0501217_020278
1279 Ga0501233_010892
1280 Ga0501249_061784
1281 Ga0501253_030460
1282 Ga0501257_072002
1283 Ga0501221_011185
1284 Ga0501234_025380
1285 Ga0501079_0006682
1286 Ga0501079_0023522
1287 Ga0501079_0225833
1288 Ga0501079_0357893
1289 Ga0501079_0859297
1290 Ga0501080_0032078
1291 Ga0501080_0039082
1292 Ga0501080_0047393
1293 Ga0501080_0071855
1294 Ga0501080_0127719
1295 Ga0501080_0728523
1296 Ga0501080_0821118
1297 Ga0501080_1105087
1298 Ga0501081_0060736
1299 Ga0501081_0063481
1300 Ga0501081_0168698
1301 Ga0501081_0276618
1302 Ga0501081_0837442
1303 Ga0501083_0004893
1304 Ga0501083_0084757
1305 Ga0501083_0114634
1306 Ga0501083_0578988
1307 Ga0501268_040747
1308 Ga0501270_008297
1309 Ga0501270_029083
1310 Ga0501045_0012832
1311 Ga0501045_0015441
1312 Ga0501045_0179605
1313 Ga0501045_0517635
1314 Ga0501045_0723335
1315 Ga0501212_014727
1316 nmdc:mga05p37_105756_c1
1317 nmdc:mga05p37_11492_c1
1318 nmdc:mga05p37_1174461_c1
1319 nmdc:mga05p37_138024_c1
1320 nmdc:mga05p37_165311_c1
1321 nmdc:mga05p37_170861_c1
1322 nmdc:mga05p37_360796_c1
1323 nmdc:mga05p37_402334_c1
1324 nmdc:mga05p37_763454_c1
1325 nmdc:mga09592_136933_c1
1326 nmdc:mga09592_23347_c1
1327 nmdc:mga09592_364767_c1
1328 nmdc:mga09592_483369_c1
1329 nmdc:mga09592_771467_c1
1330 nmdc:mga0qj67_198609_c1
1331 nmdc:mga0qj67_459318_c1
1332 nmdc:mga06r32_20739_c1
1333 nmdc:mga06r32_227606_c1
1334 nmdc:mga06r32_58229_c1
1335 nmdc:mga06r32_70819_c1
1336 nmdc:mga06r32_943816_c1
1337 nmdc:mga08y16_412358_c1
1338 nmdc:mga08y16_690933_c1
1339 nmdc:mga0n895_1142893_c1
1340 nmdc:mga0n895_2011_c1
1341 nmdc:mga0n895_540458_c1
1342 nmdc:mga0n895_893884_c1
1343 nmdc:mga0n895_918982_c1
1344 nmdc:mga0rr50_243400_c1
1345 nmdc:mga0rr50_365627_c1
1346 nmdc:mga0rr50_95824_c1
1347 nmdc:mga08x19_10821_c1
1348 nmdc:mga0a205_130456_c1
1349 nmdc:mga0a205_185057_c1
1350 nmdc:mga0a205_535171_c1
1351 nmdc:mga0a205_59556_c1
1352 nmdc:mga0a205_83247_c1
1353 Ga0501084_0012198
1354 Ga0501084_0018137
1355 Ga0501084_0032795
1356 Ga0501084_0078704
1357 Ga0501084_0116453
1358 Ga0501084_0180567
1359 Ga0501084_0188597
1360 Ga0590071_014604
1361 Ga0590074_036714
1362 Ga0590075_004856
1363 Ga0590075_016974
1364 Ga0501082_0023164
1365 Ga0501082_0048394
1366 Ga0501082_0079964
1367 Ga0501082_0156280
1368 Ga0501082_0195226
1369 Ga0501082_0300056
1370 Ga0530510_0025511
1371 Ga0530510_0085130
1372 Ga0530510_0370164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

33

101

0.98

PF04545

Sigma70_r4

Sigma-70, region 4

128

177

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

122

175

0.95

PF07638

Sigma70_ECF

ECF sigma factor

13

185

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9728 121 171
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9716 121 171
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9502 13 100
6eo2-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed 0.9402 128 171
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9389 121 177
ID Description Score Start End Superfamily
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9728 121 171 1.10.10.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9716 121 171 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9688 121 171 1.10.10.10
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9628 121 176 1.10.10.10
4nqwA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9581 121 175 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9BAP8-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.724 9 136 GO:0006352
GO:0016987
AF-A0A7K1C7F9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.6844 14 155 GO:0003677
GO:0006352
GO:0016987
AF-A0A7C1PVA3-F1-model_v4 deleted 0.6818 1 150
AF-A0A7C1PVA3-F1-model_v4 deleted 0.6606 1 150
AF-A0A1H2C9P8-F1-model_v4 deleted 0.6563 1 178

Map