F475207

General Info

Members Datasets Scaffolds Average Seq Length
686 336 1372 222

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0000249|Ga0495625_0000249_69383_70177
Length 264
Sequence MIASLNVATWLGKRYYALRRRAPASCDQLRRTKDAMINFPEDIFTEPTDVDPDTLANLGPLRPLAGVWEGRKGVDLNPKAEGPERRDYLERIELQPIDPQANGPQLFYGLRYHVHIVASDEDTTFHDQIGYWLWEPATGLIMQTLALPRGQVALARGQAAPDGSGLVVRAERGGPGYGICSTDFLEWAFRTDSYELEVRFSPDGGWSYLSTTMLQVRGRSEPFRHVDRNVLHKVAEPRPNPLARITTGDATLIEAHGFTSIGGG

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
191 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
281 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
282 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
283 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
284 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
289 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
290 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
291 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
292 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
293 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
294 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
295 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
296 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
297 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
301 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
306 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
307 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
308 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
311 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
312 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
313 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
317 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
318 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
319 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
320 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
321 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
322 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
323 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
324 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
325 2643221583 Caulobacter sp. Root655 Isolate Unclassified
326 2643221584 Caulobacter sp. Root656 Isolate Unclassified
327 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
328 2643221640 Caulobacter sp. Root342 Isolate Unclassified
329 2643221642 Caulobacter sp. Root343 Isolate Unclassified
330 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
331 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
332 2818991435 Caulobacter henricii 536 Isolate Unclassified
333 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
334 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
335 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
336 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.79
Metatranscriptomes 0
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.78
Nodule 0
Rhizoplane 4.81
Rhizosphere 66.62
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0000249 3300046660 Bacteria 84097
2 SwRhRL2b_contig_2020771 2162886007 Bacteria 1253
3 JGI24736J21556_1001507 3300001904 Bacteria 4253
4 JGI24741J21665_1001754 3300001915 Bacteria 5968
5 JGI24740J21852_10007012 3300001979 Bacteria 4620
6 JGI24739J22299_10004886 3300001989 Bacteria 5106
7 JGI24735J21928_10002223 3300002067 Bacteria 6806
8 JGI24738J21930_10007622 3300002075 Bacteria 2488
9 Ga0055526_1018641 3300003771 Bacteria 2579
10 Ga0055524_1021542 3300003775 Bacteria 2133
11 Ga0055536_1000868 3300003781 Bacteria 19640
12 Ga0055536_1004191 3300003781 Bacteria 7457
13 Ga0055536_1004367 3300003781 Bacteria 7262
14 Ga0055536_1004704 3300003781 Bacteria 6874
15 Ga0055528_1008845 3300003790 Bacteria 4263
16 Ga0055530_10000222 3300003791 Bacteria 50412
17 Ga0055530_10004612 3300003791 Bacteria 7014
18 Ga0055531_10001853 3300003794 Bacteria 14867
19 Ga0055531_10005504 3300003794 Bacteria 7402
20 Ga0055531_10020929 3300003794 Bacteria 2562
21 Ga0065165_1001578 3300005262 Bacteria 23475
22 Ga0065704_10088305 3300005289 Bacteria 2950
23 Ga0065704_10115627 3300005289 Bacteria 1864
24 Ga0070658_10000102 3300005327 Bacteria 75484
25 Ga0070658_10052742 3300005327 Bacteria 3299
26 Ga0070658_10367660 3300005327 Bacteria 1232
27 Ga0070690_100295670 3300005330 Unclassified 1160
28 Ga0070670_100000020 3300005331 Bacteria 215458
29 Ga0070670_100265936 3300005331 Bacteria 1496
30 Ga0070666_10033542 3300005335 Bacteria 3397
31 Ga0070666_10042194 3300005335 Bacteria 3051
32 Ga0068868_100477159 3300005338 Bacteria 1089
33 Ga0070660_100000847 3300005339 Bacteria 20378
34 Ga0070660_100035676 3300005339 Bacteria 3765
35 Ga0070660_100042317 3300005339 Bacteria 3476
36 Ga0070660_100370368 3300005339 Bacteria 1182
37 Ga0070668_100001335 3300005347 Bacteria 17624
38 Ga0070668_100002029 3300005347 Bacteria 14799
39 Ga0070668_100164847 3300005347 Bacteria 1800
40 Ga0070669_100001287 3300005353 Bacteria 18135
41 Ga0070671_100001778 3300005355 Bacteria 16362
42 Ga0070671_100005770 3300005355 Bacteria 9859
43 Ga0070671_100302711 3300005355 Bacteria 1361
44 Ga0070671_100408929 3300005355 Bacteria 1161
45 Ga0070659_100001070 3300005366 Bacteria 20035
46 Ga0070659_100037730 3300005366 Bacteria 3767
47 Ga0070659_100145258 3300005366 Bacteria 1932
48 Ga0070659_100200959 3300005366 Bacteria 1641
49 Ga0070659_100225477 3300005366 Bacteria 1548
50 Ga0070667_100000016 3300005367 Bacteria 237028
51 Ga0070667_100001248 3300005367 Bacteria 23106
52 Ga0070667_100005535 3300005367 Bacteria 10541
53 Ga0070667_100047716 3300005367 Bacteria 3603
54 Ga0070667_100162507 3300005367 Bacteria 1968
55 Ga0070714_100341518 3300005435 Bacteria 1404
56 Ga0070714_100931577 3300005435 Bacteria 844
57 Ga0070663_100019776 3300005455 Bacteria 4446
58 Ga0070663_100108889 3300005455 Bacteria 2079
59 Ga0070662_100073258 3300005457 Bacteria 2530
60 Ga0070681_10265426 3300005458 Bacteria 1628
61 Ga0070685_10284450 3300005466 Unclassified 1108
62 Ga0070697_100510805 3300005536 Bacteria 1051
63 Ga0068853_100176182 3300005539 Bacteria 1937
64 Ga0068853_100668854 3300005539 Bacteria 989
65 Ga0070686_100173512 3300005544 Bacteria 1527
66 Ga0070695_100011009 3300005545 Bacteria 5407
67 Ga0070696_100190849 3300005546 Bacteria 1525
68 Ga0070665_100000145 3300005548 Bacteria 131599
69 Ga0070665_100000505 3300005548 Bacteria 55944
70 Ga0070665_100001851 3300005548 Bacteria 24031
71 Ga0070665_100003414 3300005548 Bacteria 16973
72 Ga0070665_100032439 3300005548 Bacteria 5256
73 Ga0070665_100133153 3300005548 Bacteria 2488
74 Ga0068855_100685772 3300005563 Bacteria 1097
75 Ga0070664_100075743 3300005564 Bacteria 2890
76 Ga0070664_100200587 3300005564 Bacteria 1780
77 Ga0068857_100141555 3300005577 Bacteria 2174
78 Ga0068854_100168745 3300005578 Bacteria 1701
79 Ga0068856_100003533 3300005614 Bacteria 15763
80 Ga0068856_100142151 3300005614 Bacteria 2407
81 Ga0068856_100583161 3300005614 Bacteria 1139
82 Ga0068859_100050592 3300005617 Bacteria 4174
83 Ga0068859_100289983 3300005617 Bacteria 1729
84 Ga0068859_101191107 3300005617 Bacteria 839
85 Ga0068864_100000060 3300005618 Bacteria 124506
86 Ga0068864_100000228 3300005618 Bacteria 50664
87 Ga0068864_100242995 3300005618 Bacteria 1668
88 Ga0068851_10013664 3300005834 Bacteria 3844
89 Ga0068863_100000023 3300005841 Bacteria 186490
90 Ga0068863_100003621 3300005841 Bacteria 15252
91 Ga0068863_100029334 3300005841 Bacteria 5251
92 Ga0068863_100035538 3300005841 Bacteria 4746
93 Ga0068863_100197994 3300005841 Bacteria 1932
94 Ga0068863_100622325 3300005841 Bacteria 1069
95 Ga0068858_100008595 3300005842 Bacteria 9807
96 Ga0068858_100011301 3300005842 Bacteria 8435
97 Ga0068858_100027403 3300005842 Bacteria 5294
98 Ga0068858_100097249 3300005842 Unclassified 2744
99 Ga0068858_100175867 3300005842 Bacteria 2020
100 Ga0068860_100000196 3300005843 Bacteria 97096
101 Ga0068860_100000310 3300005843 Bacteria 67162
102 Ga0068860_100231238 3300005843 Bacteria 1797
103 Ga0068862_100000032 3300005844 Bacteria 179887
104 Ga0068862_100005889 3300005844 Bacteria 10210
105 Ga0068862_100017249 3300005844 Bacteria 6010
106 Ga0068862_100092771 3300005844 Bacteria 2632
107 Ga0068862_100866371 3300005844 Bacteria 886
108 Ga0081540_1000179 3300005983 Bacteria 65936
109 Ga0070717_10009962 3300006028 Bacteria 7150
110 Ga0075363_100067429 3300006048 Bacteria 1939
111 Ga0075363_100230362 3300006048 Bacteria 1063
112 Ga0075364_10003820 3300006051 Bacteria 8623
113 Ga0070712_100069766 3300006175 Bacteria 2508
114 Ga0075362_10001011 3300006177 Bacteria 8643
115 Ga0075367_10011982 3300006178 Bacteria 4606
116 Ga0075367_10038072 3300006178 Bacteria 2798
117 Ga0075369_10005460 3300006186 Bacteria 4752
118 Ga0075369_10158321 3300006186 Bacteria 1037
119 Ga0075366_10014535 3300006195 Bacteria 4496
120 Ga0075366_10029738 3300006195 Bacteria 3211
121 Ga0075366_10040817 3300006195 Bacteria 2745
122 Ga0075366_10042707 3300006195 Bacteria 2685
123 Ga0075366_10059723 3300006195 Bacteria 2264
124 Ga0075366_10080296 3300006195 Bacteria 1948
125 Ga0075366_10170738 3300006195 Bacteria 1319
126 Ga0097621_100084684 3300006237 Bacteria 2644
127 Ga0075370_10023096 3300006353 Bacteria 3422
128 Ga0075370_10043685 3300006353 Bacteria 2533
129 Ga0075434_100002162 3300006871 Bacteria 17128
130 Ga0068865_100277269 3300006881 Bacteria 1334
131 Ga0097620_100050592 3300006931 Bacteria 4174
132 Ga0097620_100289997 3300006931 Bacteria 1729
133 Ga0097620_101190995 3300006931 Bacteria 839
134 Ga0075435_100490402 3300007076 Bacteria 1062
135 Ga0105250_10012457 3300009092 Bacteria 3510
136 Ga0105240_10066331 3300009093 Bacteria 4478
137 Ga0105240_10175669 3300009093 Bacteria 2532
138 Ga0105240_10331835 3300009093 Bacteria 1730
139 Ga0105247_10012174 3300009101 Bacteria 5172
140 Ga0105247_10022771 3300009101 Bacteria 3773
141 Ga0114129_10005640 3300009147 Bacteria 17714
142 Ga0105241_10001537 3300009174 Bacteria 17688
143 Ga0105248_10001464 3300009177 Bacteria 26304
144 Ga0105248_10001756 3300009177 Bacteria 24138
145 Ga0105248_10008233 3300009177 Bacteria 11454
146 Ga0105248_10037485 3300009177 Bacteria 5424
147 Ga0105248_10040905 3300009177 Bacteria 5197
148 Ga0105248_10128248 3300009177 Bacteria 2862
149 Ga0105248_10142284 3300009177 Bacteria 2706
150 Ga0105248_10348979 3300009177 Bacteria 1666
151 Ga0105237_10068201 3300009545 Bacteria 3551
152 Ga0105238_10063781 3300009551 Bacteria 3685
153 Ga0105238_10123025 3300009551 Bacteria 2574
154 Ga0105238_10167776 3300009551 Bacteria 2171
155 Ga0105238_10172073 3300009551 Bacteria 2142
156 Ga0105249_10001654 3300009553 Bacteria 19525
157 Ga0105249_10042449 3300009553 Bacteria 4136
158 Ga0105249_10209530 3300009553 Bacteria 1912
159 Ga0105249_10786893 3300009553 Bacteria 1015
160 Ga0105239_10074094 3300010375 Bacteria 3743
161 Ga0105239_10265706 3300010375 Bacteria 1929
162 Ga0105239_10363631 3300010375 Bacteria 1634
163 Ga0105239_10459069 3300010375 Bacteria 1446
164 Ga0105239_10548570 3300010375 Bacteria 1316
165 Ga0105239_10876771 3300010375 Bacteria 1030
166 Ga0157373_10050188 3300013100 Bacteria 2972
167 Ga0157373_10262425 3300013100 Bacteria 1222
168 Ga0157374_10484675 3300013296 Bacteria 1240
169 Ga0157378_10247825 3300013297 Bacteria 1704
170 Ga0163162_10043873 3300013306 Bacteria 4477
171 Ga0163162_10762570 3300013306 Bacteria 1086
172 Ga0157372_10301414 3300013307 Bacteria 1864
173 Ga0163163_10071930 3300014325 Bacteria 3447
174 Ga0163163_10082334 3300014325 Bacteria 3222
175 Ga0163163_10204287 3300014325 Bacteria 2024
176 Ga0163163_10229698 3300014325 Bacteria 1904
177 Ga0163163_10293911 3300014325 Bacteria 1677
178 Ga0163163_10734921 3300014325 Bacteria 1050
179 Ga0182008_10065988 3300014497 Bacteria 1780
180 Ga0157379_10000848 3300014968 Bacteria 24754
181 Ga0157379_10065925 3300014968 Bacteria 3237
182 Ga0157379_10125336 3300014968 Bacteria 2311
183 Ga0157379_10294411 3300014968 Bacteria 1479
184 Ga0163161_10341393 3300017792 Bacteria 1188
185 Ga0209437_105181 3300025233 Bacteria 2234
186 Ga0209026_1012154 3300025250 Bacteria 1513
187 Ga0209148_1000285 3300025254 Bacteria 75960
188 Ga0209233_1000058 3300025261 Bacteria 421872
189 Ga0209565_1000297 3300025263 Bacteria 47258
190 Ga0209455_1006483 3300025272 Bacteria 3445
191 Ga0209673_1001189 3300025273 Bacteria 27984
192 Ga0209675_1000097 3300025291 Bacteria 131546
193 Ga0209676_1000085 3300025292 Bacteria 273425
194 Ga0209676_1000272 3300025292 Bacteria 107765
195 Ga0209676_1000373 3300025292 Bacteria 83050
196 Ga0209676_1000927 3300025292 Bacteria 36244
197 Ga0209025_1026095 3300025294 Bacteria 2946
198 Ga0209564_1007305 3300025295 Bacteria 5732
199 Ga0209564_1034009 3300025295 Bacteria 1503
200 Ga0209758_1000919 3300025297 Bacteria 39837
201 Ga0209758_1000965 3300025297 Bacteria 38806
202 Ga0209758_1059339 3300025297 Bacteria 1274
203 Ga0209050_1000344 3300025298 Bacteria 92033
204 Ga0209050_1000387 3300025298 Bacteria 83122
205 Ga0209050_1000627 3300025298 Bacteria 55036
206 Ga0209050_1007357 3300025298 Bacteria 6192
207 Ga0209050_1017467 3300025298 Bacteria 2858
208 Ga0209256_1000360 3300025299 Bacteria 74074
209 Ga0209256_1008273 3300025299 Bacteria 4864
210 Ga0209256_1008623 3300025299 Bacteria 4676
211 Ga0209051_1055833 3300025303 Bacteria 1279
212 Ga0209257_1000187 3300025304 Bacteria 154077
213 Ga0209257_1000624 3300025304 Bacteria 56974
214 Ga0209257_1000739 3300025304 Bacteria 49548
215 Ga0209257_1007538 3300025304 Bacteria 6537
216 Ga0209257_1009271 3300025304 Bacteria 5322
217 Ga0207697_10022861 3300025315 Bacteria 2561
218 Ga0207696_1013014 3300025711 Bacteria 2919
219 Ga0207710_10021049 3300025900 Bacteria 2792
220 Ga0207688_10098178 3300025901 Bacteria 1688
221 Ga0207680_10045818 3300025903 Bacteria 2581
222 Ga0207647_10162008 3300025904 Bacteria 1304
223 Ga0207699_10166453 3300025906 Bacteria 1472
224 Ga0207705_10000054 3300025909 Bacteria 161842
225 Ga0207705_10000263 3300025909 Bacteria 50599
226 Ga0207654_10326094 3300025911 Bacteria 1051
227 Ga0207707_10109284 3300025912 Bacteria 2417
228 Ga0207695_10068001 3300025913 Bacteria 3651
229 Ga0207695_10128134 3300025913 Bacteria 2498
230 Ga0207695_10141520 3300025913 Bacteria 2353
231 Ga0207695_10224291 3300025913 Bacteria 1786
232 Ga0207671_10007571 3300025914 Bacteria 9404
233 Ga0207693_10058755 3300025915 Bacteria 3013
234 Ga0207660_10039638 3300025917 Bacteria 3294
235 Ga0207660_10096912 3300025917 Bacteria 2197
236 Ga0207657_10000114 3300025919 Bacteria 79120
237 Ga0207657_10000810 3300025919 Bacteria 33018
238 Ga0207657_10005221 3300025919 Bacteria 13607
239 Ga0207657_10006066 3300025919 Bacteria 12570
240 Ga0207657_10148318 3300025919 Bacteria 1912
241 Ga0207657_10279904 3300025919 Bacteria 1324
242 Ga0207681_10001436 3300025923 Bacteria 15337
243 Ga0207681_10161574 3300025923 Bacteria 1689
244 Ga0207694_10003358 3300025924 Bacteria 12741
245 Ga0207694_10335599 3300025924 Bacteria 1249
246 Ga0207650_10000381 3300025925 Bacteria 41633
247 Ga0207650_10428543 3300025925 Bacteria 1098
248 Ga0207687_10001232 3300025927 Bacteria 17531
249 Ga0207664_10123397 3300025929 Bacteria 2171
250 Ga0207644_10000056 3300025931 Bacteria 84033
251 Ga0207644_10001408 3300025931 Bacteria 15493
252 Ga0207644_10002514 3300025931 Bacteria 11798
253 Ga0207644_10216101 3300025931 Bacteria 1517
254 Ga0207690_10000053 3300025932 Bacteria 105125
255 Ga0207690_10031990 3300025932 Bacteria 3372
256 Ga0207690_10057056 3300025932 Bacteria 2637
257 Ga0207690_10220428 3300025932 Bacteria 1451
258 Ga0207711_10000731 3300025941 Bacteria 32250
259 Ga0207711_10001333 3300025941 Bacteria 23353
260 Ga0207711_10001926 3300025941 Bacteria 18849
261 Ga0207711_10044357 3300025941 Bacteria 3796
262 Ga0207711_10087849 3300025941 Bacteria 2728
263 Ga0207711_10437173 3300025941 Bacteria 1217
264 Ga0207711_10443031 3300025941 Bacteria 1209
265 Ga0207711_10482047 3300025941 Bacteria 1155
266 Ga0207679_10048382 3300025945 Bacteria 3095
267 Ga0207679_10060210 3300025945 Bacteria 2820
268 Ga0207667_10050437 3300025949 Bacteria 4391
269 Ga0207667_10091412 3300025949 Bacteria 3144
270 Ga0207712_10002612 3300025961 Bacteria 11556
271 Ga0207712_10018540 3300025961 Bacteria 4535
272 Ga0207712_10089212 3300025961 Bacteria 2266
273 Ga0207668_10000001 3300025972 Bacteria 266091
274 Ga0207668_10012418 3300025972 Bacteria 5214
275 Ga0207640_10002116 3300025981 Bacteria 10664
276 Ga0207658_10000075 3300025986 Bacteria 109004
277 Ga0207658_10000516 3300025986 Bacteria 35271
278 Ga0207658_10022156 3300025986 Bacteria 4420
279 Ga0207658_10241126 3300025986 Bacteria 1531
280 Ga0207658_10544399 3300025986 Bacteria 1038
281 Ga0207677_10518319 3300026023 Bacteria 1034
282 Ga0207703_10000447 3300026035 Bacteria 43512
283 Ga0207703_10000571 3300026035 Bacteria 37816
284 Ga0207703_10011378 3300026035 Bacteria 6921
285 Ga0207703_10018812 3300026035 Bacteria 5395
286 Ga0207703_10148874 3300026035 Bacteria 2039
287 Ga0207703_10372031 3300026035 Bacteria 1320
288 Ga0207639_10000083 3300026041 Bacteria 81290
289 Ga0207639_10112961 3300026041 Bacteria 2218
290 Ga0207678_10000186 3300026067 Bacteria 53291
291 Ga0207678_10115550 3300026067 Bacteria 2289
292 Ga0207702_10010771 3300026078 Bacteria 7633
293 Ga0207702_10324362 3300026078 Bacteria 1467
294 Ga0207641_10000067 3300026088 Bacteria 155379
295 Ga0207641_10001366 3300026088 Bacteria 24146
296 Ga0207641_10001725 3300026088 Bacteria 21104
297 Ga0207641_10003461 3300026088 Bacteria 13981
298 Ga0207641_10009847 3300026088 Bacteria 7869
299 Ga0207676_10000643 3300026095 Bacteria 27996
300 Ga0207676_10001043 3300026095 Bacteria 21158
301 Ga0207676_10001977 3300026095 Bacteria 14926
302 Ga0207676_10101501 3300026095 Bacteria 2386
303 Ga0207674_10003894 3300026116 Bacteria 18157
304 Ga0207674_10007275 3300026116 Bacteria 12904
305 Ga0209981_1017953 3300027378 Bacteria 1001
306 Ga0209813_10049114 3300027866 Bacteria 1312
307 Ga0207428_10165426 3300027907 Bacteria 1677
308 Ga0268266_10000355 3300028379 Bacteria 70950
309 Ga0268266_10000992 3300028379 Bacteria 35787
310 Ga0268266_10001259 3300028379 Bacteria 30951
311 Ga0268266_10002845 3300028379 Bacteria 18035
312 Ga0268266_10022548 3300028379 Bacteria 5364
313 Ga0268265_10000081 3300028380 Bacteria 120869
314 Ga0268265_10013766 3300028380 Bacteria 5505
315 Ga0268265_10055791 3300028380 Bacteria 3003
316 Ga0268265_10151236 3300028380 Bacteria 1958
317 Ga0268264_10000087 3300028381 Bacteria 236696
318 Ga0268264_10000431 3300028381 Bacteria 58140
319 Ga0268264_10959381 3300028381 Bacteria 860
320 Ga0265318_10051332 3300028577 Bacteria 1548
321 Ga0307517_10001697 3300028786 Bacteria 36390
322 Ga0307515_10090948 3300028794 Bacteria 3820
323 Ga0307515_10293569 3300028794 Bacteria 1318
324 Ga0265338_10008048 3300028800 Bacteria 12895
325 Ga0265338_10062625 3300028800 Bacteria 3249
326 Ga0265338_10305876 3300028800 Bacteria 1154
327 Ga0265332_10058936 3300031238 Bacteria 1644
328 Ga0265328_10008706 3300031239 Bacteria 4168
329 Ga0265320_10001699 3300031240 Bacteria 15633
330 Ga0265320_10029828 3300031240 Bacteria 2819
331 Ga0265325_10074995 3300031241 Bacteria 1690
332 Ga0265340_10077188 3300031247 Bacteria 1572
333 Ga0265340_10157395 3300031247 Bacteria 1033
334 Ga0265331_10033333 3300031250 Bacteria 2547
335 Ga0265327_10000240 3300031251 Bacteria 109753
336 Ga0265327_10001145 3300031251 Bacteria 36229
337 Ga0265327_10131443 3300031251 Bacteria 1177
338 Ga0265316_10038457 3300031344 Bacteria 3855
339 Ga0265316_10080382 3300031344 Bacteria 2500
340 Ga0307513_10068482 3300031456 Bacteria 3718
341 Ga0307513_10148565 3300031456 Bacteria 2257
342 Ga0307408_100137040 3300031548 Bacteria 1916
343 Ga0265313_10099476 3300031595 Bacteria 1292
344 Ga0265313_10133945 3300031595 Bacteria 1071
345 Ga0307508_10171949 3300031616 Bacteria 1770
346 Ga0265314_10019498 3300031711 Bacteria 5255
347 Ga0265314_10104610 3300031711 Bacteria 1812
348 Ga0265342_10137553 3300031712 Bacteria 1365
349 Ga0265342_10163281 3300031712 Bacteria 1230
350 Ga0307516_10036465 3300031730 Bacteria 4920
351 Ga0307516_10532934 3300031730 Bacteria 828
352 Ga0307405_10067926 3300031731 Bacteria 2279
353 Ga0307405_10997798 3300031731 Bacteria 714
354 Ga0307413_10004947 3300031824 Bacteria 5873
355 Ga0307410_10181356 3300031852 Bacteria 1594
356 Ga0307410_10209390 3300031852 Bacteria 1493
357 Ga0307410_10282364 3300031852 Bacteria 1303
358 Ga0307406_10125680 3300031901 Bacteria 1791
359 Ga0307406_10262801 3300031901 Bacteria 1307
360 Ga0307412_10000892 3300031911 Bacteria 17180
361 Ga0307412_10005746 3300031911 Bacteria 6974
362 Ga0307412_10027478 3300031911 Bacteria 3548
363 Ga0307412_10073152 3300031911 Bacteria 2344
364 Ga0307412_10405379 3300031911 Bacteria 1111
365 Ga0307409_100037201 3300031995 Bacteria 3586
366 Ga0307416_100033072 3300032002 Bacteria 3916
367 Ga0307416_100756943 3300032002 Bacteria 1064
368 Ga0307416_100806442 3300032002 Bacteria 1035
369 Ga0307414_10039902 3300032004 Bacteria 3167
370 Ga0307414_10076175 3300032004 Bacteria 2437
371 Ga0307414_10199203 3300032004 Bacteria 1627
372 Ga0307414_10282165 3300032004 Bacteria 1396
373 Ga0307414_10528254 3300032004 Bacteria 1048
374 Ga0307414_10915764 3300032004 Bacteria 804
375 Ga0307411_10016852 3300032005 Bacteria 4145
376 Ga0307411_10080186 3300032005 Bacteria 2243
377 Ga0307411_10348780 3300032005 Bacteria 1206
378 Ga0307415_100040517 3300032126 Bacteria 3086
379 Ga0307510_10004286 3300033180 Bacteria 16771
380 Ga0307510_10102844 3300033180 Bacteria 2637
381 Ga0307510_10184838 3300033180 Bacteria 1641
382 Ga0373944_0017399 3300035089 Bacteria 2040
383 Ga0373936_0004530 3300035113 Bacteria 5262
384 Ga0373956_0170476 3300035119 Bacteria 1027
385 Ga0373943_0257092 3300035170 Bacteria 982
386 Ga0373946_0105171 3300035171 Bacteria 1270
387 Ga0373927_0000173 3300035695 Bacteria 50996
388 Ga0373933_0060069 3300035724 Bacteria 2291
389 Ga0373937_0045395 3300036401 Bacteria 4015
390 Ga0373937_0265600 3300036401 Bacteria 1619
391 Ga0373937_0748518 3300036401 Bacteria 925
392 Ga0373925_0000049 3300037068 Bacteria 128065
393 Ga0395899_0040149 3300037312 Bacteria 3500
394 Ga0395899_0049886 3300037312 Bacteria 3110
395 Ga0395900_0022716 3300037418 Bacteria 6420
396 Ga0395900_0055440 3300037418 Bacteria 4081
397 Ga0395900_0216909 3300037418 Bacteria 1930
398 Ga0395900_0288510 3300037418 Bacteria 1630
399 Ga0395900_0449674 3300037418 Bacteria 1245
400 Ga0395898_0002186 3300037466 Bacteria 23900
401 Ga0395898_0091703 3300037466 Bacteria 2923
402 Ga0395898_0144230 3300037466 Unclassified 2279
403 Ga0395905_0005653 3300037471 Bacteria 12717
404 Ga0395905_0010395 3300037471 Bacteria 9060
405 Ga0395905_0013648 3300037471 Bacteria 7783
406 Ga0395905_0018130 3300037471 Bacteria 6680
407 Ga0395905_0021056 3300037471 Bacteria 6174
408 Ga0395905_0042184 3300037471 Bacteria 4281
409 Ga0395905_0191642 3300037471 Unclassified 1917
410 Ga0395905_0460204 3300037471 Bacteria 1170
411 Ga0395905_0569501 3300037471 Bacteria 1034
412 Ga0395905_0847324 3300037471 Bacteria 817
413 Ga0395901_0012439 3300038443 Bacteria 8635
414 Ga0395901_0025491 3300038443 Bacteria 6071
415 Ga0395901_0307897 3300038443 Bacteria 1641
416 Ga0395901_0380984 3300038443 Bacteria 1452
417 Ga0395901_0507839 3300038443 Bacteria 1227
418 Ga0436365_0536452 3300039437 Bacteria 11193
419 Ga0436365_1556495 3300039437 Bacteria 1518
420 Ga0436365_1890662 3300039437 Bacteria 719
421 Ga0436361_0125416 3300039447 Bacteria 1108
422 Ga0451795_0160777 3300041456 Bacteria 1536
423 Ga0451806_261415 3300041462 Bacteria 1300
424 Ga0439448_0003232 3300042005 Bacteria 4500
425 Ga0439459_0015016 3300042438 Bacteria 1415
426 Ga0466965_0087410 3300044683 Bacteria 1582
427 Ga0466965_0282314 3300044683 Bacteria 897
428 Ga0466957_0563988 3300044842 Bacteria 794
429 Ga0466958_0088031 3300045836 Bacteria 1918
430 Ga0466967_0389666 3300045976 Bacteria 1354
431 Ga0495617_020418 3300046452 Bacteria 2239
432 Ga0495627_000114 3300046453 Bacteria 100085
433 Ga0495627_000975 3300046453 Bacteria 19521
434 Ga0495590_0001381 3300046457 Bacteria 10543
435 Ga0495638_0000188 3300046460 Bacteria 94506
436 Ga0495638_0000292 3300046460 Bacteria 65766
437 Ga0495638_0000659 3300046460 Bacteria 37742
438 Ga0495638_0005797 3300046460 Bacteria 9090
439 Ga0495638_0006272 3300046460 Bacteria 8678
440 Ga0495638_0027187 3300046460 Bacteria 3705
441 Ga0495638_0036318 3300046460 Bacteria 3140
442 Ga0495638_0041030 3300046460 Bacteria 2930
443 Ga0495650_0000168 3300046471 Bacteria 145714
444 Ga0495650_0000470 3300046471 Bacteria 62114
445 Ga0495650_0012138 3300046471 Bacteria 4658
446 Ga0495650_0032618 3300046471 Bacteria 2327
447 Ga0495583_0000002 3300046506 Bacteria 782521
448 Ga0495583_0001366 3300046506 Bacteria 25162
449 Ga0495606_0003607 3300046507 Bacteria 16276
450 Ga0495606_0122835 3300046507 Bacteria 1552
451 Ga0495610_0000024 3300046512 Bacteria 304748
452 Ga0495610_0009572 3300046512 Bacteria 6111
453 Ga0495610_0016848 3300046512 Bacteria 4188
454 Ga0495616_0000206 3300046513 Bacteria 49005
455 Ga0495616_0073219 3300046513 Bacteria 1653
456 Ga0495631_0019031 3300046518 Bacteria 3225
457 Ga0495632_0000727 3300046519 Bacteria 29842
458 Ga0495632_0034763 3300046519 Bacteria 2576
459 Ga0495637_0020670 3300046520 Bacteria 3025
460 Ga0495637_0033331 3300046520 Bacteria 2263
461 Ga0495637_0050106 3300046520 Bacteria 1752
462 Ga0495643_0006441 3300046522 Bacteria 7740
463 Ga0495643_0216908 3300046522 Bacteria 910
464 Ga0495663_0074676 3300046525 Bacteria 1084
465 Ga0495642_0009568 3300046528 Bacteria 3709
466 Ga0495654_0000085 3300046530 Bacteria 107010
467 Ga0495597_0004297 3300046542 Bacteria 7873
468 Ga0495597_0153548 3300046542 Bacteria 943
469 Ga0495622_0001106 3300046557 Bacteria 14103
470 Ga0495622_0046688 3300046557 Bacteria 2012
471 Ga0495633_0119645 3300046558 Bacteria 1220
472 Ga0495668_0000019 3300046616 Bacteria 416042
473 Ga0495668_0013101 3300046616 Bacteria 4905
474 Ga0495668_0015148 3300046616 Bacteria 4508
475 Ga0495668_0033164 3300046616 Bacteria 2902
476 Ga0495668_0047397 3300046616 Bacteria 2386
477 Ga0495668_0151236 3300046616 Bacteria 1271
478 Ga0495668_0186134 3300046616 Bacteria 1137
479 Ga0495611_0108508 3300046648 Bacteria 1291
480 Ga0495625_0000255 3300046660 Bacteria 82750
481 Ga0495625_0000408 3300046660 Bacteria 65240
482 Ga0495625_0000505 3300046660 Bacteria 57930
483 Ga0495625_0012001 3300046660 Bacteria 7032
484 Ga0495625_0100011 3300046660 Bacteria 1993
485 Ga0495625_0112556 3300046660 Bacteria 1859
486 Ga0495625_0333652 3300046660 Bacteria 962
487 Ga0495661_0048224 3300046665 Bacteria 2589
488 Ga0495669_0000147 3300046684 Bacteria 45027
489 Ga0495669_0011897 3300046684 Bacteria 3701
490 Ga0495669_0131824 3300046684 Bacteria 1176
491 Ga0495624_0215730 3300046690 Bacteria 1164
492 Ga0495670_0041176 3300046691 Bacteria 2304
493 Ga0495589_0000845 3300046794 Bacteria 19242
494 Ga0495600_0005075 3300046809 Bacteria 7912
495 Ga0495600_0111385 3300046809 Bacteria 1782
496 Ga0495660_0066348 3300046810 Bacteria 1925
497 Ga0495581_0053153 3300047315 Bacteria 2340
498 Ga0495672_0006003 3300047320 Bacteria 9509
499 Ga0495687_047451 3300047443 Bacteria 1848
500 Ga0495679_013732 3300047446 Bacteria 3026
501 Ga0495673_0000056 3300047469 Bacteria 245918
502 Ga0495673_0002738 3300047469 Bacteria 12081
503 Ga0495681_0120656 3300047470 Bacteria 1125
504 Ga0495686_0000293 3300047472 Bacteria 87130
505 Ga0495686_0003429 3300047472 Bacteria 13750
506 Ga0495686_0004600 3300047472 Bacteria 11247
507 Ga0495686_0027692 3300047472 Bacteria 3698
508 Ga0495593_0055835 3300047673 Bacteria 2077
509 Ga0495602_0279389 3300048088 Bacteria 1231
510 Ga0496100_0413705 3300048903 Bacteria 1029
511 Ga0496101_0012799 3300048904 Bacteria 5610
512 Ga0496101_0167967 3300048904 Bacteria 1685
513 Ga0496102_0000640 3300048905 Bacteria 35507
514 Ga0496102_0066468 3300048905 Bacteria 3304
515 Ga0496102_0095292 3300048905 Bacteria 2758
516 Ga0496102_0115112 3300048905 Bacteria 2509
517 Ga0496103_0000197 3300048906 Bacteria 60344
518 Ga0496103_0050779 3300048906 Bacteria 2566
519 Ga0496103_0217965 3300048906 Bacteria 1227
520 Ga0496104_0113320 3300048907 Bacteria 2600
521 Ga0496104_0139363 3300048907 Bacteria 2331
522 Ga0496104_0339146 3300048907 Bacteria 1416
523 Ga0496105_0094859 3300048908 Bacteria 2464
524 Ga0496106_0001585 3300048909 Bacteria 17095
525 Ga0496106_0017910 3300048909 Bacteria 5239
526 Ga0496107_0000132 3300048910 Bacteria 36454
527 Ga0496107_0024670 3300048910 Bacteria 4254
528 Ga0496108_0069521 3300048911 Bacteria 2971
529 Ga0496109_0275791 3300048912 Bacteria 1584
530 Ga0496110_0834664 3300048913 Unclassified 826
531 Ga0496111_0004034 3300048914 Bacteria 9216
532 Ga0496111_0062633 3300048914 Bacteria 2697
533 Ga0496112_0140291 3300048915 Bacteria 2386
534 Ga0496113_0002148 3300048916 Bacteria 11372
535 Ga0496113_0160786 3300048916 Bacteria 1775
536 Ga0496114_0028745 3300048917 Bacteria 4565
537 Ga0496115_0000166 3300048918 Bacteria 61341
538 Ga0496115_0041744 3300048918 Bacteria 3652
539 Ga0496115_0560892 3300048918 Bacteria 912
540 Ga0496116_0006381 3300048919 Bacteria 10718
541 Ga0496116_0053528 3300048919 Bacteria 2665
542 Ga0496117_0000467 3300048920 Bacteria 67483
543 Ga0496117_0002744 3300048920 Bacteria 21590
544 Ga0496117_0014560 3300048920 Bacteria 6768
545 Ga0496117_0038318 3300048920 Bacteria 3557
546 Ga0496117_0076485 3300048920 Bacteria 2219
547 Ga0496117_0301204 3300048920 Bacteria 849
548 Ga0496118_0000310 3300048921 Bacteria 84607
549 Ga0496118_0000459 3300048921 Bacteria 67483
550 Ga0496118_0008784 3300048921 Bacteria 10361
551 Ga0496118_0061500 3300048921 Bacteria 2780
552 Ga0496118_0107468 3300048921 Bacteria 1863
553 Ga0496119_0043930 3300048922 Bacteria 2819
554 Ga0496119_0081527 3300048922 Bacteria 1863
555 Ga0496119_0096747 3300048922 Bacteria 1665
556 Ga0496119_0100417 3300048922 Bacteria 1625
557 Ga0496120_0017447 3300048923 Bacteria 4654
558 Ga0496120_0046822 3300048923 Bacteria 2497
559 Ga0496121_0000152 3300048924 Bacteria 150767
560 Ga0496121_0006484 3300048924 Bacteria 14498
561 Ga0496121_0006787 3300048924 Bacteria 14023
562 Ga0496121_0041140 3300048924 Bacteria 4044
563 Ga0496121_0052912 3300048924 Bacteria 3405
564 Ga0496121_0158609 3300048924 Bacteria 1657
565 Ga0496121_0295707 3300048924 Bacteria 1101
566 Ga0496122_0007934 3300048925 Bacteria 11616
567 Ga0496122_0043899 3300048925 Bacteria 3497
568 Ga0496122_0177352 3300048925 Bacteria 1276
569 Ga0496123_0097524 3300048926 Bacteria 1722
570 Ga0496123_0193839 3300048926 Bacteria 1048
571 Ga0496124_0000121 3300048927 Bacteria 162988
572 Ga0496124_0000499 3300048927 Bacteria 67483
573 Ga0496124_0011941 3300048927 Bacteria 8643
574 Ga0496124_0066695 3300048927 Bacteria 2996
575 Ga0496124_0075869 3300048927 Bacteria 2777
576 Ga0496124_0132604 3300048927 Bacteria 1977
577 Ga0496124_0132697 3300048927 Bacteria 1976
578 Ga0496124_0444729 3300048927 Unclassified 886
579 Ga0496125_0008331 3300048928 Bacteria 10876
580 Ga0496125_0048089 3300048928 Bacteria 3560
581 Ga0496125_0086293 3300048928 Bacteria 2374
582 Ga0496126_0006453 3300048929 Bacteria 13068
583 Ga0496126_0014348 3300048929 Bacteria 8013
584 Ga0496126_0211850 3300048929 Bacteria 1631
585 Ga0496126_0227488 3300048929 Bacteria 1564
586 Ga0495678_002468 3300049459 Bacteria 12490
587 Ga0501036_0101171 3300049572 Bacteria 2438
588 Ga0501043_0296790 3300049579 Bacteria 1236
589 Ga0501047_0000266 3300049581 Bacteria 60893
590 Ga0501047_0000471 3300049581 Bacteria 43820
591 Ga0501047_0000893 3300049581 Bacteria 30459
592 Ga0501047_0396785 3300049581 Bacteria 1213
593 Ga0501070_0037037 3300049586 Bacteria 4072
594 Ga0501072_0001051 3300049588 Bacteria 20459
595 Ga0501080_0091915 3300049742 Bacteria 2819
596 Ga0501080_0349363 3300049742 Bacteria 1336
597 Ga0501083_0173642 3300049744 Bacteria 1408
598 Ga0501044_0053834 3300049823 Bacteria 4139
599 nmdc:mga03n38_158366_c1 3300050490 Bacteria 1145
600 nmdc:mga00v17_6139_c1 3300050491 Bacteria 6011
601 nmdc:mga0k408_21903_c1 3300050493 Bacteria 3593
602 nmdc:mga0k408_73870_c1 3300050493 Bacteria 1992
603 nmdc:mga0k408_87260_c1 3300050493 Bacteria 1832
604 nmdc:mga07m45_25958_c1 3300050496 Bacteria 3218
605 nmdc:mga07m45_46050_c1 3300050496 Bacteria 2450
606 nmdc:mga05p37_5458_c1 3300050507 Bacteria 14925
607 nmdc:mga08y16_111549_c1 3300050511 Bacteria 2847
608 nmdc:mga0rr50_82781_c1 3300050513 Bacteria 2479
609 nmdc:mga0a205_5883_c1 3300050515 Bacteria 11048
610 nmdc:mga0sz30_5449_c1 3300050516 Bacteria 4667
611 Ga0500635_0000208 3300053080 Bacteria 28812
612 Ga0500578_0000124 3300053086 Bacteria 92437
613 Ga0500643_005104 3300053087 Bacteria 5737
614 Ga0500643_023865 3300053087 Bacteria 1949
615 Ga0500643_049116 3300053087 Bacteria 1211
616 Ga0500644_0003731 3300053088 Bacteria 3783
617 Ga0500647_0063478 3300053091 Bacteria 1777
618 Ga0500651_0176347 3300053093 Bacteria 1271
619 Ga0500566_0033160 3300053094 Bacteria 3010
620 Ga0500641_0000924 3300053096 Bacteria 10475
621 Ga0500556_0101808 3300053104 Bacteria 1107
622 Ga0500562_000453 3300053108 Bacteria 9951
623 Ga0500562_000907 3300053108 Bacteria 7190
624 Ga0500569_000410 3300053109 Bacteria 7007
625 Ga0500592_015687 3300053116 Bacteria 1216
626 Ga0500594_0000184 3300053118 Bacteria 15781
627 Ga0500595_001453 3300053119 Bacteria 12624
628 Ga0500595_004634 3300053119 Bacteria 6131
629 Ga0500595_018235 3300053119 Bacteria 2571
630 Ga0500595_050724 3300053119 Bacteria 1287
631 Ga0500608_000004 3300053122 Bacteria 108109
632 Ga0500608_054398 3300053122 Bacteria 1920
633 Ga0500618_000022 3300053125 Bacteria 157907
634 Ga0500642_0091905 3300053130 Bacteria 1403
635 Ga0500642_0185545 3300053130 Bacteria 972
636 Ga0500655_017611 3300053133 Bacteria 1323
637 Ga0500658_0010960 3300053134 Bacteria 3342
638 Ga0500559_0002236 3300053136 Bacteria 10228
639 Ga0500559_0004502 3300053136 Bacteria 6598
640 Ga0500559_0005625 3300053136 Bacteria 5743
641 Ga0500564_053379 3300053138 Bacteria 1846
642 Ga0500604_0034821 3300053151 Bacteria 1496
643 Ga0500616_0005230 3300053153 Bacteria 8876
644 Ga0500619_002204 3300053154 Bacteria 3693
645 Ga0500622_0002350 3300053156 Bacteria 13748
646 Ga0500622_0020115 3300053156 Bacteria 3545
647 Ga0500622_0203062 3300053156 Bacteria 900
648 Ga0500627_0102408 3300053158 Bacteria 1286
649 Ga0500627_0190553 3300053158 Bacteria 921
650 Ga0500636_0006613 3300053177 Bacteria 6662
651 Ga0500637_0000774 3300053178 Bacteria 12861
652 Ga0500637_0109424 3300053178 Bacteria 1602
653 Ga0500576_039266 3300053725 Bacteria 2135
654 Ga0500645_001242 3300053730 Bacteria 13444
655 Ga0500645_002350 3300053730 Bacteria 8520
656 Ga0500645_005215 3300053730 Bacteria 4836
657 Ga0500645_018801 3300053730 Bacteria 2153
658 Ga0500645_049253 3300053730 Bacteria 1233
659 Ga0500609_000278 3300053731 Bacteria 7501
660 Ga0500552_000084 3300053733 Bacteria 7639
661 Ga0500596_005428 3300053735 Bacteria 2244
662 Ga0500601_003505 3300053737 Bacteria 1703
663 Ga0501084_0044996 3300054114 Bacteria 3696
664 Ga0501082_0287939 3300060353 Bacteria 1430
665 2511125608 2510917020 Bacteria 5657507
666 2585147804 2582581279 Bacteria 4980720
667 2585151448 2582581280 Bacteria 5994497
668 2585196162 2582581293 Bacteria 5907401
669 2587917379 2585428106 Bacteria 5179711
670 2600202623 2599185354 Bacteria 4398675
671 2643750132 2643221545 Bacteria 5083237
672 2643779000 2643221552 Bacteria 5708754
673 2643782267 2643221552 Bacteria 5708754
674 2643822937 2643221560 Bacteria 4801179
675 2643926037 2643221583 Bacteria 5218014
676 2643928944 2643221584 Bacteria 5511711
677 2644001631 2643221598 Bacteria 4578346
678 2644227100 2643221640 Bacteria 5258820
679 2644233432 2643221642 Bacteria 5357871
680 2644507021 2643221691 Bacteria 5093099
681 2753764418 2751185897 Bacteria 5322941
682 2819536960 2818991435 Bacteria 5433759
683 2819645372 2818991454 Bacteria 5563326
684 2857507815 2857504554 Bacteria 5369913
685 2884964854 2884960567 Bacteria 5437054
686 2928533402 2928531327 Bacteria 5101314
687 Ga0495625_0000249
688 SwRhRL2b_contig_2020771
689 JGI24736J21556_1001507
690 JGI24741J21665_1001754
691 JGI24740J21852_10007012
692 JGI24739J22299_10004886
693 JGI24735J21928_10002223
694 JGI24738J21930_10007622
695 Ga0055526_1018641
696 Ga0055524_1021542
697 Ga0055536_1000868
698 Ga0055536_1004191
699 Ga0055536_1004367
700 Ga0055536_1004704
701 Ga0055528_1008845
702 Ga0055530_10000222
703 Ga0055530_10004612
704 Ga0055531_10001853
705 Ga0055531_10005504
706 Ga0055531_10020929
707 Ga0065165_1001578
708 Ga0065704_10088305
709 Ga0065704_10115627
710 Ga0070658_10000102
711 Ga0070658_10052742
712 Ga0070658_10367660
713 Ga0070690_100295670
714 Ga0070670_100000020
715 Ga0070670_100265936
716 Ga0070666_10033542
717 Ga0070666_10042194
718 Ga0068868_100477159
719 Ga0070660_100000847
720 Ga0070660_100035676
721 Ga0070660_100042317
722 Ga0070660_100370368
723 Ga0070668_100001335
724 Ga0070668_100002029
725 Ga0070668_100164847
726 Ga0070669_100001287
727 Ga0070671_100001778
728 Ga0070671_100005770
729 Ga0070671_100302711
730 Ga0070671_100408929
731 Ga0070659_100001070
732 Ga0070659_100037730
733 Ga0070659_100145258
734 Ga0070659_100200959
735 Ga0070659_100225477
736 Ga0070667_100000016
737 Ga0070667_100001248
738 Ga0070667_100005535
739 Ga0070667_100047716
740 Ga0070667_100162507
741 Ga0070714_100341518
742 Ga0070714_100931577
743 Ga0070663_100019776
744 Ga0070663_100108889
745 Ga0070662_100073258
746 Ga0070681_10265426
747 Ga0070685_10284450
748 Ga0070697_100510805
749 Ga0068853_100176182
750 Ga0068853_100668854
751 Ga0070686_100173512
752 Ga0070695_100011009
753 Ga0070696_100190849
754 Ga0070665_100000145
755 Ga0070665_100000505
756 Ga0070665_100001851
757 Ga0070665_100003414
758 Ga0070665_100032439
759 Ga0070665_100133153
760 Ga0068855_100685772
761 Ga0070664_100075743
762 Ga0070664_100200587
763 Ga0068857_100141555
764 Ga0068854_100168745
765 Ga0068856_100003533
766 Ga0068856_100142151
767 Ga0068856_100583161
768 Ga0068859_100050592
769 Ga0068859_100289983
770 Ga0068859_101191107
771 Ga0068864_100000060
772 Ga0068864_100000228
773 Ga0068864_100242995
774 Ga0068851_10013664
775 Ga0068863_100000023
776 Ga0068863_100003621
777 Ga0068863_100029334
778 Ga0068863_100035538
779 Ga0068863_100197994
780 Ga0068863_100622325
781 Ga0068858_100008595
782 Ga0068858_100011301
783 Ga0068858_100027403
784 Ga0068858_100097249
785 Ga0068858_100175867
786 Ga0068860_100000196
787 Ga0068860_100000310
788 Ga0068860_100231238
789 Ga0068862_100000032
790 Ga0068862_100005889
791 Ga0068862_100017249
792 Ga0068862_100092771
793 Ga0068862_100866371
794 Ga0081540_1000179
795 Ga0070717_10009962
796 Ga0075363_100067429
797 Ga0075363_100230362
798 Ga0075364_10003820
799 Ga0070712_100069766
800 Ga0075362_10001011
801 Ga0075367_10011982
802 Ga0075367_10038072
803 Ga0075369_10005460
804 Ga0075369_10158321
805 Ga0075366_10014535
806 Ga0075366_10029738
807 Ga0075366_10040817
808 Ga0075366_10042707
809 Ga0075366_10059723
810 Ga0075366_10080296
811 Ga0075366_10170738
812 Ga0097621_100084684
813 Ga0075370_10023096
814 Ga0075370_10043685
815 Ga0075434_100002162
816 Ga0068865_100277269
817 Ga0097620_100050592
818 Ga0097620_100289997
819 Ga0097620_101190995
820 Ga0075435_100490402
821 Ga0105250_10012457
822 Ga0105240_10066331
823 Ga0105240_10175669
824 Ga0105240_10331835
825 Ga0105247_10012174
826 Ga0105247_10022771
827 Ga0114129_10005640
828 Ga0105241_10001537
829 Ga0105248_10001464
830 Ga0105248_10001756
831 Ga0105248_10008233
832 Ga0105248_10037485
833 Ga0105248_10040905
834 Ga0105248_10128248
835 Ga0105248_10142284
836 Ga0105248_10348979
837 Ga0105237_10068201
838 Ga0105238_10063781
839 Ga0105238_10123025
840 Ga0105238_10167776
841 Ga0105238_10172073
842 Ga0105249_10001654
843 Ga0105249_10042449
844 Ga0105249_10209530
845 Ga0105249_10786893
846 Ga0105239_10074094
847 Ga0105239_10265706
848 Ga0105239_10363631
849 Ga0105239_10459069
850 Ga0105239_10548570
851 Ga0105239_10876771
852 Ga0157373_10050188
853 Ga0157373_10262425
854 Ga0157374_10484675
855 Ga0157378_10247825
856 Ga0163162_10043873
857 Ga0163162_10762570
858 Ga0157372_10301414
859 Ga0163163_10071930
860 Ga0163163_10082334
861 Ga0163163_10204287
862 Ga0163163_10229698
863 Ga0163163_10293911
864 Ga0163163_10734921
865 Ga0182008_10065988
866 Ga0157379_10000848
867 Ga0157379_10065925
868 Ga0157379_10125336
869 Ga0157379_10294411
870 Ga0163161_10341393
871 Ga0209437_105181
872 Ga0209026_1012154
873 Ga0209148_1000285
874 Ga0209233_1000058
875 Ga0209565_1000297
876 Ga0209455_1006483
877 Ga0209673_1001189
878 Ga0209675_1000097
879 Ga0209676_1000085
880 Ga0209676_1000272
881 Ga0209676_1000373
882 Ga0209676_1000927
883 Ga0209025_1026095
884 Ga0209564_1007305
885 Ga0209564_1034009
886 Ga0209758_1000919
887 Ga0209758_1000965
888 Ga0209758_1059339
889 Ga0209050_1000344
890 Ga0209050_1000387
891 Ga0209050_1000627
892 Ga0209050_1007357
893 Ga0209050_1017467
894 Ga0209256_1000360
895 Ga0209256_1008273
896 Ga0209256_1008623
897 Ga0209051_1055833
898 Ga0209257_1000187
899 Ga0209257_1000624
900 Ga0209257_1000739
901 Ga0209257_1007538
902 Ga0209257_1009271
903 Ga0207697_10022861
904 Ga0207696_1013014
905 Ga0207710_10021049
906 Ga0207688_10098178
907 Ga0207680_10045818
908 Ga0207647_10162008
909 Ga0207699_10166453
910 Ga0207705_10000054
911 Ga0207705_10000263
912 Ga0207654_10326094
913 Ga0207707_10109284
914 Ga0207695_10068001
915 Ga0207695_10128134
916 Ga0207695_10141520
917 Ga0207695_10224291
918 Ga0207671_10007571
919 Ga0207693_10058755
920 Ga0207660_10039638
921 Ga0207660_10096912
922 Ga0207657_10000114
923 Ga0207657_10000810
924 Ga0207657_10005221
925 Ga0207657_10006066
926 Ga0207657_10148318
927 Ga0207657_10279904
928 Ga0207681_10001436
929 Ga0207681_10161574
930 Ga0207694_10003358
931 Ga0207694_10335599
932 Ga0207650_10000381
933 Ga0207650_10428543
934 Ga0207687_10001232
935 Ga0207664_10123397
936 Ga0207644_10000056
937 Ga0207644_10001408
938 Ga0207644_10002514
939 Ga0207644_10216101
940 Ga0207690_10000053
941 Ga0207690_10031990
942 Ga0207690_10057056
943 Ga0207690_10220428
944 Ga0207711_10000731
945 Ga0207711_10001333
946 Ga0207711_10001926
947 Ga0207711_10044357
948 Ga0207711_10087849
949 Ga0207711_10437173
950 Ga0207711_10443031
951 Ga0207711_10482047
952 Ga0207679_10048382
953 Ga0207679_10060210
954 Ga0207667_10050437
955 Ga0207667_10091412
956 Ga0207712_10002612
957 Ga0207712_10018540
958 Ga0207712_10089212
959 Ga0207668_10000001
960 Ga0207668_10012418
961 Ga0207640_10002116
962 Ga0207658_10000075
963 Ga0207658_10000516
964 Ga0207658_10022156
965 Ga0207658_10241126
966 Ga0207658_10544399
967 Ga0207677_10518319
968 Ga0207703_10000447
969 Ga0207703_10000571
970 Ga0207703_10011378
971 Ga0207703_10018812
972 Ga0207703_10148874
973 Ga0207703_10372031
974 Ga0207639_10000083
975 Ga0207639_10112961
976 Ga0207678_10000186
977 Ga0207678_10115550
978 Ga0207702_10010771
979 Ga0207702_10324362
980 Ga0207641_10000067
981 Ga0207641_10001366
982 Ga0207641_10001725
983 Ga0207641_10003461
984 Ga0207641_10009847
985 Ga0207676_10000643
986 Ga0207676_10001043
987 Ga0207676_10001977
988 Ga0207676_10101501
989 Ga0207674_10003894
990 Ga0207674_10007275
991 Ga0209981_1017953
992 Ga0209813_10049114
993 Ga0207428_10165426
994 Ga0268266_10000355
995 Ga0268266_10000992
996 Ga0268266_10001259
997 Ga0268266_10002845
998 Ga0268266_10022548
999 Ga0268265_10000081
1000 Ga0268265_10013766
1001 Ga0268265_10055791
1002 Ga0268265_10151236
1003 Ga0268264_10000087
1004 Ga0268264_10000431
1005 Ga0268264_10959381
1006 Ga0265318_10051332
1007 Ga0307517_10001697
1008 Ga0307515_10090948
1009 Ga0307515_10293569
1010 Ga0265338_10008048
1011 Ga0265338_10062625
1012 Ga0265338_10305876
1013 Ga0265332_10058936
1014 Ga0265328_10008706
1015 Ga0265320_10001699
1016 Ga0265320_10029828
1017 Ga0265325_10074995
1018 Ga0265340_10077188
1019 Ga0265340_10157395
1020 Ga0265331_10033333
1021 Ga0265327_10000240
1022 Ga0265327_10001145
1023 Ga0265327_10131443
1024 Ga0265316_10038457
1025 Ga0265316_10080382
1026 Ga0307513_10068482
1027 Ga0307513_10148565
1028 Ga0307408_100137040
1029 Ga0265313_10099476
1030 Ga0265313_10133945
1031 Ga0307508_10171949
1032 Ga0265314_10019498
1033 Ga0265314_10104610
1034 Ga0265342_10137553
1035 Ga0265342_10163281
1036 Ga0307516_10036465
1037 Ga0307516_10532934
1038 Ga0307405_10067926
1039 Ga0307405_10997798
1040 Ga0307413_10004947
1041 Ga0307410_10181356
1042 Ga0307410_10209390
1043 Ga0307410_10282364
1044 Ga0307406_10125680
1045 Ga0307406_10262801
1046 Ga0307412_10000892
1047 Ga0307412_10005746
1048 Ga0307412_10027478
1049 Ga0307412_10073152
1050 Ga0307412_10405379
1051 Ga0307409_100037201
1052 Ga0307416_100033072
1053 Ga0307416_100756943
1054 Ga0307416_100806442
1055 Ga0307414_10039902
1056 Ga0307414_10076175
1057 Ga0307414_10199203
1058 Ga0307414_10282165
1059 Ga0307414_10528254
1060 Ga0307414_10915764
1061 Ga0307411_10016852
1062 Ga0307411_10080186
1063 Ga0307411_10348780
1064 Ga0307415_100040517
1065 Ga0307510_10004286
1066 Ga0307510_10102844
1067 Ga0307510_10184838
1068 Ga0373944_0017399
1069 Ga0373936_0004530
1070 Ga0373956_0170476
1071 Ga0373943_0257092
1072 Ga0373946_0105171
1073 Ga0373927_0000173
1074 Ga0373933_0060069
1075 Ga0373937_0045395
1076 Ga0373937_0265600
1077 Ga0373937_0748518
1078 Ga0373925_0000049
1079 Ga0395899_0040149
1080 Ga0395899_0049886
1081 Ga0395900_0022716
1082 Ga0395900_0055440
1083 Ga0395900_0216909
1084 Ga0395900_0288510
1085 Ga0395900_0449674
1086 Ga0395898_0002186
1087 Ga0395898_0091703
1088 Ga0395898_0144230
1089 Ga0395905_0005653
1090 Ga0395905_0010395
1091 Ga0395905_0013648
1092 Ga0395905_0018130
1093 Ga0395905_0021056
1094 Ga0395905_0042184
1095 Ga0395905_0191642
1096 Ga0395905_0460204
1097 Ga0395905_0569501
1098 Ga0395905_0847324
1099 Ga0395901_0012439
1100 Ga0395901_0025491
1101 Ga0395901_0307897
1102 Ga0395901_0380984
1103 Ga0395901_0507839
1104 Ga0436365_0536452
1105 Ga0436365_1556495
1106 Ga0436365_1890662
1107 Ga0436361_0125416
1108 Ga0451795_0160777
1109 Ga0451806_261415
1110 Ga0439448_0003232
1111 Ga0439459_0015016
1112 Ga0466965_0087410
1113 Ga0466965_0282314
1114 Ga0466957_0563988
1115 Ga0466958_0088031
1116 Ga0466967_0389666
1117 Ga0495617_020418
1118 Ga0495627_000114
1119 Ga0495627_000975
1120 Ga0495590_0001381
1121 Ga0495638_0000188
1122 Ga0495638_0000292
1123 Ga0495638_0000659
1124 Ga0495638_0005797
1125 Ga0495638_0006272
1126 Ga0495638_0027187
1127 Ga0495638_0036318
1128 Ga0495638_0041030
1129 Ga0495650_0000168
1130 Ga0495650_0000470
1131 Ga0495650_0012138
1132 Ga0495650_0032618
1133 Ga0495583_0000002
1134 Ga0495583_0001366
1135 Ga0495606_0003607
1136 Ga0495606_0122835
1137 Ga0495610_0000024
1138 Ga0495610_0009572
1139 Ga0495610_0016848
1140 Ga0495616_0000206
1141 Ga0495616_0073219
1142 Ga0495631_0019031
1143 Ga0495632_0000727
1144 Ga0495632_0034763
1145 Ga0495637_0020670
1146 Ga0495637_0033331
1147 Ga0495637_0050106
1148 Ga0495643_0006441
1149 Ga0495643_0216908
1150 Ga0495663_0074676
1151 Ga0495642_0009568
1152 Ga0495654_0000085
1153 Ga0495597_0004297
1154 Ga0495597_0153548
1155 Ga0495622_0001106
1156 Ga0495622_0046688
1157 Ga0495633_0119645
1158 Ga0495668_0000019
1159 Ga0495668_0013101
1160 Ga0495668_0015148
1161 Ga0495668_0033164
1162 Ga0495668_0047397
1163 Ga0495668_0151236
1164 Ga0495668_0186134
1165 Ga0495611_0108508
1166 Ga0495625_0000255
1167 Ga0495625_0000408
1168 Ga0495625_0000505
1169 Ga0495625_0012001
1170 Ga0495625_0100011
1171 Ga0495625_0112556
1172 Ga0495625_0333652
1173 Ga0495661_0048224
1174 Ga0495669_0000147
1175 Ga0495669_0011897
1176 Ga0495669_0131824
1177 Ga0495624_0215730
1178 Ga0495670_0041176
1179 Ga0495589_0000845
1180 Ga0495600_0005075
1181 Ga0495600_0111385
1182 Ga0495660_0066348
1183 Ga0495581_0053153
1184 Ga0495672_0006003
1185 Ga0495687_047451
1186 Ga0495679_013732
1187 Ga0495673_0000056
1188 Ga0495673_0002738
1189 Ga0495681_0120656
1190 Ga0495686_0000293
1191 Ga0495686_0003429
1192 Ga0495686_0004600
1193 Ga0495686_0027692
1194 Ga0495593_0055835
1195 Ga0495602_0279389
1196 Ga0496100_0413705
1197 Ga0496101_0012799
1198 Ga0496101_0167967
1199 Ga0496102_0000640
1200 Ga0496102_0066468
1201 Ga0496102_0095292
1202 Ga0496102_0115112
1203 Ga0496103_0000197
1204 Ga0496103_0050779
1205 Ga0496103_0217965
1206 Ga0496104_0113320
1207 Ga0496104_0139363
1208 Ga0496104_0339146
1209 Ga0496105_0094859
1210 Ga0496106_0001585
1211 Ga0496106_0017910
1212 Ga0496107_0000132
1213 Ga0496107_0024670
1214 Ga0496108_0069521
1215 Ga0496109_0275791
1216 Ga0496110_0834664
1217 Ga0496111_0004034
1218 Ga0496111_0062633
1219 Ga0496112_0140291
1220 Ga0496113_0002148
1221 Ga0496113_0160786
1222 Ga0496114_0028745
1223 Ga0496115_0000166
1224 Ga0496115_0041744
1225 Ga0496115_0560892
1226 Ga0496116_0006381
1227 Ga0496116_0053528
1228 Ga0496117_0000467
1229 Ga0496117_0002744
1230 Ga0496117_0014560
1231 Ga0496117_0038318
1232 Ga0496117_0076485
1233 Ga0496117_0301204
1234 Ga0496118_0000310
1235 Ga0496118_0000459
1236 Ga0496118_0008784
1237 Ga0496118_0061500
1238 Ga0496118_0107468
1239 Ga0496119_0043930
1240 Ga0496119_0081527
1241 Ga0496119_0096747
1242 Ga0496119_0100417
1243 Ga0496120_0017447
1244 Ga0496120_0046822
1245 Ga0496121_0000152
1246 Ga0496121_0006484
1247 Ga0496121_0006787
1248 Ga0496121_0041140
1249 Ga0496121_0052912
1250 Ga0496121_0158609
1251 Ga0496121_0295707
1252 Ga0496122_0007934
1253 Ga0496122_0043899
1254 Ga0496122_0177352
1255 Ga0496123_0097524
1256 Ga0496123_0193839
1257 Ga0496124_0000121
1258 Ga0496124_0000499
1259 Ga0496124_0011941
1260 Ga0496124_0066695
1261 Ga0496124_0075869
1262 Ga0496124_0132604
1263 Ga0496124_0132697
1264 Ga0496124_0444729
1265 Ga0496125_0008331
1266 Ga0496125_0048089
1267 Ga0496125_0086293
1268 Ga0496126_0006453
1269 Ga0496126_0014348
1270 Ga0496126_0211850
1271 Ga0496126_0227488
1272 Ga0495678_002468
1273 Ga0501036_0101171
1274 Ga0501043_0296790
1275 Ga0501047_0000266
1276 Ga0501047_0000471
1277 Ga0501047_0000893
1278 Ga0501047_0396785
1279 Ga0501070_0037037
1280 Ga0501072_0001051
1281 Ga0501080_0091915
1282 Ga0501080_0349363
1283 Ga0501083_0173642
1284 Ga0501044_0053834
1285 nmdc:mga03n38_158366_c1
1286 nmdc:mga00v17_6139_c1
1287 nmdc:mga0k408_21903_c1
1288 nmdc:mga0k408_73870_c1
1289 nmdc:mga0k408_87260_c1
1290 nmdc:mga07m45_25958_c1
1291 nmdc:mga07m45_46050_c1
1292 nmdc:mga05p37_5458_c1
1293 nmdc:mga08y16_111549_c1
1294 nmdc:mga0rr50_82781_c1
1295 nmdc:mga0a205_5883_c1
1296 nmdc:mga0sz30_5449_c1
1297 Ga0500635_0000208
1298 Ga0500578_0000124
1299 Ga0500643_005104
1300 Ga0500643_023865
1301 Ga0500643_049116
1302 Ga0500644_0003731
1303 Ga0500647_0063478
1304 Ga0500651_0176347
1305 Ga0500566_0033160
1306 Ga0500641_0000924
1307 Ga0500556_0101808
1308 Ga0500562_000453
1309 Ga0500562_000907
1310 Ga0500569_000410
1311 Ga0500592_015687
1312 Ga0500594_0000184
1313 Ga0500595_001453
1314 Ga0500595_004634
1315 Ga0500595_018235
1316 Ga0500595_050724
1317 Ga0500608_000004
1318 Ga0500608_054398
1319 Ga0500618_000022
1320 Ga0500642_0091905
1321 Ga0500642_0185545
1322 Ga0500655_017611
1323 Ga0500658_0010960
1324 Ga0500559_0002236
1325 Ga0500559_0004502
1326 Ga0500559_0005625
1327 Ga0500564_053379
1328 Ga0500604_0034821
1329 Ga0500616_0005230
1330 Ga0500619_002204
1331 Ga0500622_0002350
1332 Ga0500622_0020115
1333 Ga0500622_0203062
1334 Ga0500627_0102408
1335 Ga0500627_0190553
1336 Ga0500636_0006613
1337 Ga0500637_0000774
1338 Ga0500637_0109424
1339 Ga0500576_039266
1340 Ga0500645_001242
1341 Ga0500645_002350
1342 Ga0500645_005215
1343 Ga0500645_018801
1344 Ga0500645_049253
1345 Ga0500609_000278
1346 Ga0500552_000084
1347 Ga0500596_005428
1348 Ga0500601_003505
1349 Ga0501084_0044996
1350 Ga0501082_0287939
1351 2511125608
1352 2585147804
1353 2585151448
1354 2585196162
1355 2587917379
1356 2600202623
1357 2643750132
1358 2643779000
1359 2643782267
1360 2643822937
1361 2643926037
1362 2643928944
1363 2644001631
1364 2644227100
1365 2644233432
1366 2644507021
1367 2753764418
1368 2819536960
1369 2819645372
1370 2857507815
1371 2884964854
1372 2928533402

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08768

THAP4_heme-bd

THAP4-like, heme-binding beta-barrel domain

57

233

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wje-assembly1.cif.gz_A crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana 0.8046 28 204
2a13-assembly1.cif.gz_A x-ray structure of protein from arabidopsis thaliana at1g79260 0.779 28 204
7bbm-assembly1.cif.gz_A-2 mutant nitrobindin m75l/h76l/q96c/m148l (nb4h) from arabidopsis thaliana with cofactor mnppix 0.7786 28 204
3ia8-assembly1.cif.gz_A the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens 0.7722 17 204
3wje-assembly1.cif.gz_A crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana 0.771 28 204
ID Description Score Start End Superfamily
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8157 28 204 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8124 28 204 2.40.128.20
af_Q18793_24_191_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8107 30 204 2.40.128.20
af_Q556I7_1_158_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7967 27 204 2.40.128.20
af_Q556I7_1_158_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.783 27 204 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A6N8DVE9-F1-model_v4 DUF1794 domain-containing protein 0.9915 7 220
AF-A0A1I5HHA4-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.9907 8 222
AF-A0A4R4DUM3-F1-model_v4 DUF1794 domain-containing protein 0.9907 11 211
AF-Q98LK1-F1-model_v4 Mll0991 protein 0.9903 7 220
AF-A0A0C5X2Z6-F1-model_v4 THAP4-like heme-binding beta-barrel domain-containing protein 0.9899 7 223

Map