F475207
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 686 | 336 | 1372 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0000249|Ga0495625_0000249_69383_70177 |
| Length | 264 |
| Sequence | MIASLNVATWLGKRYYALRRRAPASCDQLRRTKDAMINFPEDIFTEPTDVDPDTLANLGPLRPLAGVWEGRKGVDLNPKAEGPERRDYLERIELQPIDPQANGPQLFYGLRYHVHIVASDEDTTFHDQIGYWLWEPATGLIMQTLALPRGQVALARGQAAPDGSGLVVRAERGGPGYGICSTDFLEWAFRTDSYELEVRFSPDGGWSYLSTTMLQVRGRSEPFRHVDRNVLHKVAEPRPNPLARITTGDATLIEAHGFTSIGGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 146 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 174 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 190 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 192 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 193 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 252 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 258 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 281 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 282 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 283 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 285 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 286 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 287 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 288 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 290 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 291 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 292 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 293 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 294 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 295 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 297 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 298 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 300 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 302 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 305 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 308 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 309 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 311 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 312 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 317 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 318 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 319 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 320 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 321 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 322 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 323 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 324 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 325 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 326 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 327 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 328 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 329 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 330 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 331 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 332 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 333 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 334 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 335 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 336 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.79 |
| Metatranscriptomes | 0 |
| Isolates | 3.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.78 |
| Nodule | 0 |
| Rhizoplane | 4.81 |
| Rhizosphere | 66.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495625_0000249 | 3300046660 | Bacteria | 84097 |
| 2 | SwRhRL2b_contig_2020771 | 2162886007 | Bacteria | 1253 |
| 3 | JGI24736J21556_1001507 | 3300001904 | Bacteria | 4253 |
| 4 | JGI24741J21665_1001754 | 3300001915 | Bacteria | 5968 |
| 5 | JGI24740J21852_10007012 | 3300001979 | Bacteria | 4620 |
| 6 | JGI24739J22299_10004886 | 3300001989 | Bacteria | 5106 |
| 7 | JGI24735J21928_10002223 | 3300002067 | Bacteria | 6806 |
| 8 | JGI24738J21930_10007622 | 3300002075 | Bacteria | 2488 |
| 9 | Ga0055526_1018641 | 3300003771 | Bacteria | 2579 |
| 10 | Ga0055524_1021542 | 3300003775 | Bacteria | 2133 |
| 11 | Ga0055536_1000868 | 3300003781 | Bacteria | 19640 |
| 12 | Ga0055536_1004191 | 3300003781 | Bacteria | 7457 |
| 13 | Ga0055536_1004367 | 3300003781 | Bacteria | 7262 |
| 14 | Ga0055536_1004704 | 3300003781 | Bacteria | 6874 |
| 15 | Ga0055528_1008845 | 3300003790 | Bacteria | 4263 |
| 16 | Ga0055530_10000222 | 3300003791 | Bacteria | 50412 |
| 17 | Ga0055530_10004612 | 3300003791 | Bacteria | 7014 |
| 18 | Ga0055531_10001853 | 3300003794 | Bacteria | 14867 |
| 19 | Ga0055531_10005504 | 3300003794 | Bacteria | 7402 |
| 20 | Ga0055531_10020929 | 3300003794 | Bacteria | 2562 |
| 21 | Ga0065165_1001578 | 3300005262 | Bacteria | 23475 |
| 22 | Ga0065704_10088305 | 3300005289 | Bacteria | 2950 |
| 23 | Ga0065704_10115627 | 3300005289 | Bacteria | 1864 |
| 24 | Ga0070658_10000102 | 3300005327 | Bacteria | 75484 |
| 25 | Ga0070658_10052742 | 3300005327 | Bacteria | 3299 |
| 26 | Ga0070658_10367660 | 3300005327 | Bacteria | 1232 |
| 27 | Ga0070690_100295670 | 3300005330 | Unclassified | 1160 |
| 28 | Ga0070670_100000020 | 3300005331 | Bacteria | 215458 |
| 29 | Ga0070670_100265936 | 3300005331 | Bacteria | 1496 |
| 30 | Ga0070666_10033542 | 3300005335 | Bacteria | 3397 |
| 31 | Ga0070666_10042194 | 3300005335 | Bacteria | 3051 |
| 32 | Ga0068868_100477159 | 3300005338 | Bacteria | 1089 |
| 33 | Ga0070660_100000847 | 3300005339 | Bacteria | 20378 |
| 34 | Ga0070660_100035676 | 3300005339 | Bacteria | 3765 |
| 35 | Ga0070660_100042317 | 3300005339 | Bacteria | 3476 |
| 36 | Ga0070660_100370368 | 3300005339 | Bacteria | 1182 |
| 37 | Ga0070668_100001335 | 3300005347 | Bacteria | 17624 |
| 38 | Ga0070668_100002029 | 3300005347 | Bacteria | 14799 |
| 39 | Ga0070668_100164847 | 3300005347 | Bacteria | 1800 |
| 40 | Ga0070669_100001287 | 3300005353 | Bacteria | 18135 |
| 41 | Ga0070671_100001778 | 3300005355 | Bacteria | 16362 |
| 42 | Ga0070671_100005770 | 3300005355 | Bacteria | 9859 |
| 43 | Ga0070671_100302711 | 3300005355 | Bacteria | 1361 |
| 44 | Ga0070671_100408929 | 3300005355 | Bacteria | 1161 |
| 45 | Ga0070659_100001070 | 3300005366 | Bacteria | 20035 |
| 46 | Ga0070659_100037730 | 3300005366 | Bacteria | 3767 |
| 47 | Ga0070659_100145258 | 3300005366 | Bacteria | 1932 |
| 48 | Ga0070659_100200959 | 3300005366 | Bacteria | 1641 |
| 49 | Ga0070659_100225477 | 3300005366 | Bacteria | 1548 |
| 50 | Ga0070667_100000016 | 3300005367 | Bacteria | 237028 |
| 51 | Ga0070667_100001248 | 3300005367 | Bacteria | 23106 |
| 52 | Ga0070667_100005535 | 3300005367 | Bacteria | 10541 |
| 53 | Ga0070667_100047716 | 3300005367 | Bacteria | 3603 |
| 54 | Ga0070667_100162507 | 3300005367 | Bacteria | 1968 |
| 55 | Ga0070714_100341518 | 3300005435 | Bacteria | 1404 |
| 56 | Ga0070714_100931577 | 3300005435 | Bacteria | 844 |
| 57 | Ga0070663_100019776 | 3300005455 | Bacteria | 4446 |
| 58 | Ga0070663_100108889 | 3300005455 | Bacteria | 2079 |
| 59 | Ga0070662_100073258 | 3300005457 | Bacteria | 2530 |
| 60 | Ga0070681_10265426 | 3300005458 | Bacteria | 1628 |
| 61 | Ga0070685_10284450 | 3300005466 | Unclassified | 1108 |
| 62 | Ga0070697_100510805 | 3300005536 | Bacteria | 1051 |
| 63 | Ga0068853_100176182 | 3300005539 | Bacteria | 1937 |
| 64 | Ga0068853_100668854 | 3300005539 | Bacteria | 989 |
| 65 | Ga0070686_100173512 | 3300005544 | Bacteria | 1527 |
| 66 | Ga0070695_100011009 | 3300005545 | Bacteria | 5407 |
| 67 | Ga0070696_100190849 | 3300005546 | Bacteria | 1525 |
| 68 | Ga0070665_100000145 | 3300005548 | Bacteria | 131599 |
| 69 | Ga0070665_100000505 | 3300005548 | Bacteria | 55944 |
| 70 | Ga0070665_100001851 | 3300005548 | Bacteria | 24031 |
| 71 | Ga0070665_100003414 | 3300005548 | Bacteria | 16973 |
| 72 | Ga0070665_100032439 | 3300005548 | Bacteria | 5256 |
| 73 | Ga0070665_100133153 | 3300005548 | Bacteria | 2488 |
| 74 | Ga0068855_100685772 | 3300005563 | Bacteria | 1097 |
| 75 | Ga0070664_100075743 | 3300005564 | Bacteria | 2890 |
| 76 | Ga0070664_100200587 | 3300005564 | Bacteria | 1780 |
| 77 | Ga0068857_100141555 | 3300005577 | Bacteria | 2174 |
| 78 | Ga0068854_100168745 | 3300005578 | Bacteria | 1701 |
| 79 | Ga0068856_100003533 | 3300005614 | Bacteria | 15763 |
| 80 | Ga0068856_100142151 | 3300005614 | Bacteria | 2407 |
| 81 | Ga0068856_100583161 | 3300005614 | Bacteria | 1139 |
| 82 | Ga0068859_100050592 | 3300005617 | Bacteria | 4174 |
| 83 | Ga0068859_100289983 | 3300005617 | Bacteria | 1729 |
| 84 | Ga0068859_101191107 | 3300005617 | Bacteria | 839 |
| 85 | Ga0068864_100000060 | 3300005618 | Bacteria | 124506 |
| 86 | Ga0068864_100000228 | 3300005618 | Bacteria | 50664 |
| 87 | Ga0068864_100242995 | 3300005618 | Bacteria | 1668 |
| 88 | Ga0068851_10013664 | 3300005834 | Bacteria | 3844 |
| 89 | Ga0068863_100000023 | 3300005841 | Bacteria | 186490 |
| 90 | Ga0068863_100003621 | 3300005841 | Bacteria | 15252 |
| 91 | Ga0068863_100029334 | 3300005841 | Bacteria | 5251 |
| 92 | Ga0068863_100035538 | 3300005841 | Bacteria | 4746 |
| 93 | Ga0068863_100197994 | 3300005841 | Bacteria | 1932 |
| 94 | Ga0068863_100622325 | 3300005841 | Bacteria | 1069 |
| 95 | Ga0068858_100008595 | 3300005842 | Bacteria | 9807 |
| 96 | Ga0068858_100011301 | 3300005842 | Bacteria | 8435 |
| 97 | Ga0068858_100027403 | 3300005842 | Bacteria | 5294 |
| 98 | Ga0068858_100097249 | 3300005842 | Unclassified | 2744 |
| 99 | Ga0068858_100175867 | 3300005842 | Bacteria | 2020 |
| 100 | Ga0068860_100000196 | 3300005843 | Bacteria | 97096 |
| 101 | Ga0068860_100000310 | 3300005843 | Bacteria | 67162 |
| 102 | Ga0068860_100231238 | 3300005843 | Bacteria | 1797 |
| 103 | Ga0068862_100000032 | 3300005844 | Bacteria | 179887 |
| 104 | Ga0068862_100005889 | 3300005844 | Bacteria | 10210 |
| 105 | Ga0068862_100017249 | 3300005844 | Bacteria | 6010 |
| 106 | Ga0068862_100092771 | 3300005844 | Bacteria | 2632 |
| 107 | Ga0068862_100866371 | 3300005844 | Bacteria | 886 |
| 108 | Ga0081540_1000179 | 3300005983 | Bacteria | 65936 |
| 109 | Ga0070717_10009962 | 3300006028 | Bacteria | 7150 |
| 110 | Ga0075363_100067429 | 3300006048 | Bacteria | 1939 |
| 111 | Ga0075363_100230362 | 3300006048 | Bacteria | 1063 |
| 112 | Ga0075364_10003820 | 3300006051 | Bacteria | 8623 |
| 113 | Ga0070712_100069766 | 3300006175 | Bacteria | 2508 |
| 114 | Ga0075362_10001011 | 3300006177 | Bacteria | 8643 |
| 115 | Ga0075367_10011982 | 3300006178 | Bacteria | 4606 |
| 116 | Ga0075367_10038072 | 3300006178 | Bacteria | 2798 |
| 117 | Ga0075369_10005460 | 3300006186 | Bacteria | 4752 |
| 118 | Ga0075369_10158321 | 3300006186 | Bacteria | 1037 |
| 119 | Ga0075366_10014535 | 3300006195 | Bacteria | 4496 |
| 120 | Ga0075366_10029738 | 3300006195 | Bacteria | 3211 |
| 121 | Ga0075366_10040817 | 3300006195 | Bacteria | 2745 |
| 122 | Ga0075366_10042707 | 3300006195 | Bacteria | 2685 |
| 123 | Ga0075366_10059723 | 3300006195 | Bacteria | 2264 |
| 124 | Ga0075366_10080296 | 3300006195 | Bacteria | 1948 |
| 125 | Ga0075366_10170738 | 3300006195 | Bacteria | 1319 |
| 126 | Ga0097621_100084684 | 3300006237 | Bacteria | 2644 |
| 127 | Ga0075370_10023096 | 3300006353 | Bacteria | 3422 |
| 128 | Ga0075370_10043685 | 3300006353 | Bacteria | 2533 |
| 129 | Ga0075434_100002162 | 3300006871 | Bacteria | 17128 |
| 130 | Ga0068865_100277269 | 3300006881 | Bacteria | 1334 |
| 131 | Ga0097620_100050592 | 3300006931 | Bacteria | 4174 |
| 132 | Ga0097620_100289997 | 3300006931 | Bacteria | 1729 |
| 133 | Ga0097620_101190995 | 3300006931 | Bacteria | 839 |
| 134 | Ga0075435_100490402 | 3300007076 | Bacteria | 1062 |
| 135 | Ga0105250_10012457 | 3300009092 | Bacteria | 3510 |
| 136 | Ga0105240_10066331 | 3300009093 | Bacteria | 4478 |
| 137 | Ga0105240_10175669 | 3300009093 | Bacteria | 2532 |
| 138 | Ga0105240_10331835 | 3300009093 | Bacteria | 1730 |
| 139 | Ga0105247_10012174 | 3300009101 | Bacteria | 5172 |
| 140 | Ga0105247_10022771 | 3300009101 | Bacteria | 3773 |
| 141 | Ga0114129_10005640 | 3300009147 | Bacteria | 17714 |
| 142 | Ga0105241_10001537 | 3300009174 | Bacteria | 17688 |
| 143 | Ga0105248_10001464 | 3300009177 | Bacteria | 26304 |
| 144 | Ga0105248_10001756 | 3300009177 | Bacteria | 24138 |
| 145 | Ga0105248_10008233 | 3300009177 | Bacteria | 11454 |
| 146 | Ga0105248_10037485 | 3300009177 | Bacteria | 5424 |
| 147 | Ga0105248_10040905 | 3300009177 | Bacteria | 5197 |
| 148 | Ga0105248_10128248 | 3300009177 | Bacteria | 2862 |
| 149 | Ga0105248_10142284 | 3300009177 | Bacteria | 2706 |
| 150 | Ga0105248_10348979 | 3300009177 | Bacteria | 1666 |
| 151 | Ga0105237_10068201 | 3300009545 | Bacteria | 3551 |
| 152 | Ga0105238_10063781 | 3300009551 | Bacteria | 3685 |
| 153 | Ga0105238_10123025 | 3300009551 | Bacteria | 2574 |
| 154 | Ga0105238_10167776 | 3300009551 | Bacteria | 2171 |
| 155 | Ga0105238_10172073 | 3300009551 | Bacteria | 2142 |
| 156 | Ga0105249_10001654 | 3300009553 | Bacteria | 19525 |
| 157 | Ga0105249_10042449 | 3300009553 | Bacteria | 4136 |
| 158 | Ga0105249_10209530 | 3300009553 | Bacteria | 1912 |
| 159 | Ga0105249_10786893 | 3300009553 | Bacteria | 1015 |
| 160 | Ga0105239_10074094 | 3300010375 | Bacteria | 3743 |
| 161 | Ga0105239_10265706 | 3300010375 | Bacteria | 1929 |
| 162 | Ga0105239_10363631 | 3300010375 | Bacteria | 1634 |
| 163 | Ga0105239_10459069 | 3300010375 | Bacteria | 1446 |
| 164 | Ga0105239_10548570 | 3300010375 | Bacteria | 1316 |
| 165 | Ga0105239_10876771 | 3300010375 | Bacteria | 1030 |
| 166 | Ga0157373_10050188 | 3300013100 | Bacteria | 2972 |
| 167 | Ga0157373_10262425 | 3300013100 | Bacteria | 1222 |
| 168 | Ga0157374_10484675 | 3300013296 | Bacteria | 1240 |
| 169 | Ga0157378_10247825 | 3300013297 | Bacteria | 1704 |
| 170 | Ga0163162_10043873 | 3300013306 | Bacteria | 4477 |
| 171 | Ga0163162_10762570 | 3300013306 | Bacteria | 1086 |
| 172 | Ga0157372_10301414 | 3300013307 | Bacteria | 1864 |
| 173 | Ga0163163_10071930 | 3300014325 | Bacteria | 3447 |
| 174 | Ga0163163_10082334 | 3300014325 | Bacteria | 3222 |
| 175 | Ga0163163_10204287 | 3300014325 | Bacteria | 2024 |
| 176 | Ga0163163_10229698 | 3300014325 | Bacteria | 1904 |
| 177 | Ga0163163_10293911 | 3300014325 | Bacteria | 1677 |
| 178 | Ga0163163_10734921 | 3300014325 | Bacteria | 1050 |
| 179 | Ga0182008_10065988 | 3300014497 | Bacteria | 1780 |
| 180 | Ga0157379_10000848 | 3300014968 | Bacteria | 24754 |
| 181 | Ga0157379_10065925 | 3300014968 | Bacteria | 3237 |
| 182 | Ga0157379_10125336 | 3300014968 | Bacteria | 2311 |
| 183 | Ga0157379_10294411 | 3300014968 | Bacteria | 1479 |
| 184 | Ga0163161_10341393 | 3300017792 | Bacteria | 1188 |
| 185 | Ga0209437_105181 | 3300025233 | Bacteria | 2234 |
| 186 | Ga0209026_1012154 | 3300025250 | Bacteria | 1513 |
| 187 | Ga0209148_1000285 | 3300025254 | Bacteria | 75960 |
| 188 | Ga0209233_1000058 | 3300025261 | Bacteria | 421872 |
| 189 | Ga0209565_1000297 | 3300025263 | Bacteria | 47258 |
| 190 | Ga0209455_1006483 | 3300025272 | Bacteria | 3445 |
| 191 | Ga0209673_1001189 | 3300025273 | Bacteria | 27984 |
| 192 | Ga0209675_1000097 | 3300025291 | Bacteria | 131546 |
| 193 | Ga0209676_1000085 | 3300025292 | Bacteria | 273425 |
| 194 | Ga0209676_1000272 | 3300025292 | Bacteria | 107765 |
| 195 | Ga0209676_1000373 | 3300025292 | Bacteria | 83050 |
| 196 | Ga0209676_1000927 | 3300025292 | Bacteria | 36244 |
| 197 | Ga0209025_1026095 | 3300025294 | Bacteria | 2946 |
| 198 | Ga0209564_1007305 | 3300025295 | Bacteria | 5732 |
| 199 | Ga0209564_1034009 | 3300025295 | Bacteria | 1503 |
| 200 | Ga0209758_1000919 | 3300025297 | Bacteria | 39837 |
| 201 | Ga0209758_1000965 | 3300025297 | Bacteria | 38806 |
| 202 | Ga0209758_1059339 | 3300025297 | Bacteria | 1274 |
| 203 | Ga0209050_1000344 | 3300025298 | Bacteria | 92033 |
| 204 | Ga0209050_1000387 | 3300025298 | Bacteria | 83122 |
| 205 | Ga0209050_1000627 | 3300025298 | Bacteria | 55036 |
| 206 | Ga0209050_1007357 | 3300025298 | Bacteria | 6192 |
| 207 | Ga0209050_1017467 | 3300025298 | Bacteria | 2858 |
| 208 | Ga0209256_1000360 | 3300025299 | Bacteria | 74074 |
| 209 | Ga0209256_1008273 | 3300025299 | Bacteria | 4864 |
| 210 | Ga0209256_1008623 | 3300025299 | Bacteria | 4676 |
| 211 | Ga0209051_1055833 | 3300025303 | Bacteria | 1279 |
| 212 | Ga0209257_1000187 | 3300025304 | Bacteria | 154077 |
| 213 | Ga0209257_1000624 | 3300025304 | Bacteria | 56974 |
| 214 | Ga0209257_1000739 | 3300025304 | Bacteria | 49548 |
| 215 | Ga0209257_1007538 | 3300025304 | Bacteria | 6537 |
| 216 | Ga0209257_1009271 | 3300025304 | Bacteria | 5322 |
| 217 | Ga0207697_10022861 | 3300025315 | Bacteria | 2561 |
| 218 | Ga0207696_1013014 | 3300025711 | Bacteria | 2919 |
| 219 | Ga0207710_10021049 | 3300025900 | Bacteria | 2792 |
| 220 | Ga0207688_10098178 | 3300025901 | Bacteria | 1688 |
| 221 | Ga0207680_10045818 | 3300025903 | Bacteria | 2581 |
| 222 | Ga0207647_10162008 | 3300025904 | Bacteria | 1304 |
| 223 | Ga0207699_10166453 | 3300025906 | Bacteria | 1472 |
| 224 | Ga0207705_10000054 | 3300025909 | Bacteria | 161842 |
| 225 | Ga0207705_10000263 | 3300025909 | Bacteria | 50599 |
| 226 | Ga0207654_10326094 | 3300025911 | Bacteria | 1051 |
| 227 | Ga0207707_10109284 | 3300025912 | Bacteria | 2417 |
| 228 | Ga0207695_10068001 | 3300025913 | Bacteria | 3651 |
| 229 | Ga0207695_10128134 | 3300025913 | Bacteria | 2498 |
| 230 | Ga0207695_10141520 | 3300025913 | Bacteria | 2353 |
| 231 | Ga0207695_10224291 | 3300025913 | Bacteria | 1786 |
| 232 | Ga0207671_10007571 | 3300025914 | Bacteria | 9404 |
| 233 | Ga0207693_10058755 | 3300025915 | Bacteria | 3013 |
| 234 | Ga0207660_10039638 | 3300025917 | Bacteria | 3294 |
| 235 | Ga0207660_10096912 | 3300025917 | Bacteria | 2197 |
| 236 | Ga0207657_10000114 | 3300025919 | Bacteria | 79120 |
| 237 | Ga0207657_10000810 | 3300025919 | Bacteria | 33018 |
| 238 | Ga0207657_10005221 | 3300025919 | Bacteria | 13607 |
| 239 | Ga0207657_10006066 | 3300025919 | Bacteria | 12570 |
| 240 | Ga0207657_10148318 | 3300025919 | Bacteria | 1912 |
| 241 | Ga0207657_10279904 | 3300025919 | Bacteria | 1324 |
| 242 | Ga0207681_10001436 | 3300025923 | Bacteria | 15337 |
| 243 | Ga0207681_10161574 | 3300025923 | Bacteria | 1689 |
| 244 | Ga0207694_10003358 | 3300025924 | Bacteria | 12741 |
| 245 | Ga0207694_10335599 | 3300025924 | Bacteria | 1249 |
| 246 | Ga0207650_10000381 | 3300025925 | Bacteria | 41633 |
| 247 | Ga0207650_10428543 | 3300025925 | Bacteria | 1098 |
| 248 | Ga0207687_10001232 | 3300025927 | Bacteria | 17531 |
| 249 | Ga0207664_10123397 | 3300025929 | Bacteria | 2171 |
| 250 | Ga0207644_10000056 | 3300025931 | Bacteria | 84033 |
| 251 | Ga0207644_10001408 | 3300025931 | Bacteria | 15493 |
| 252 | Ga0207644_10002514 | 3300025931 | Bacteria | 11798 |
| 253 | Ga0207644_10216101 | 3300025931 | Bacteria | 1517 |
| 254 | Ga0207690_10000053 | 3300025932 | Bacteria | 105125 |
| 255 | Ga0207690_10031990 | 3300025932 | Bacteria | 3372 |
| 256 | Ga0207690_10057056 | 3300025932 | Bacteria | 2637 |
| 257 | Ga0207690_10220428 | 3300025932 | Bacteria | 1451 |
| 258 | Ga0207711_10000731 | 3300025941 | Bacteria | 32250 |
| 259 | Ga0207711_10001333 | 3300025941 | Bacteria | 23353 |
| 260 | Ga0207711_10001926 | 3300025941 | Bacteria | 18849 |
| 261 | Ga0207711_10044357 | 3300025941 | Bacteria | 3796 |
| 262 | Ga0207711_10087849 | 3300025941 | Bacteria | 2728 |
| 263 | Ga0207711_10437173 | 3300025941 | Bacteria | 1217 |
| 264 | Ga0207711_10443031 | 3300025941 | Bacteria | 1209 |
| 265 | Ga0207711_10482047 | 3300025941 | Bacteria | 1155 |
| 266 | Ga0207679_10048382 | 3300025945 | Bacteria | 3095 |
| 267 | Ga0207679_10060210 | 3300025945 | Bacteria | 2820 |
| 268 | Ga0207667_10050437 | 3300025949 | Bacteria | 4391 |
| 269 | Ga0207667_10091412 | 3300025949 | Bacteria | 3144 |
| 270 | Ga0207712_10002612 | 3300025961 | Bacteria | 11556 |
| 271 | Ga0207712_10018540 | 3300025961 | Bacteria | 4535 |
| 272 | Ga0207712_10089212 | 3300025961 | Bacteria | 2266 |
| 273 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 274 | Ga0207668_10012418 | 3300025972 | Bacteria | 5214 |
| 275 | Ga0207640_10002116 | 3300025981 | Bacteria | 10664 |
| 276 | Ga0207658_10000075 | 3300025986 | Bacteria | 109004 |
| 277 | Ga0207658_10000516 | 3300025986 | Bacteria | 35271 |
| 278 | Ga0207658_10022156 | 3300025986 | Bacteria | 4420 |
| 279 | Ga0207658_10241126 | 3300025986 | Bacteria | 1531 |
| 280 | Ga0207658_10544399 | 3300025986 | Bacteria | 1038 |
| 281 | Ga0207677_10518319 | 3300026023 | Bacteria | 1034 |
| 282 | Ga0207703_10000447 | 3300026035 | Bacteria | 43512 |
| 283 | Ga0207703_10000571 | 3300026035 | Bacteria | 37816 |
| 284 | Ga0207703_10011378 | 3300026035 | Bacteria | 6921 |
| 285 | Ga0207703_10018812 | 3300026035 | Bacteria | 5395 |
| 286 | Ga0207703_10148874 | 3300026035 | Bacteria | 2039 |
| 287 | Ga0207703_10372031 | 3300026035 | Bacteria | 1320 |
| 288 | Ga0207639_10000083 | 3300026041 | Bacteria | 81290 |
| 289 | Ga0207639_10112961 | 3300026041 | Bacteria | 2218 |
| 290 | Ga0207678_10000186 | 3300026067 | Bacteria | 53291 |
| 291 | Ga0207678_10115550 | 3300026067 | Bacteria | 2289 |
| 292 | Ga0207702_10010771 | 3300026078 | Bacteria | 7633 |
| 293 | Ga0207702_10324362 | 3300026078 | Bacteria | 1467 |
| 294 | Ga0207641_10000067 | 3300026088 | Bacteria | 155379 |
| 295 | Ga0207641_10001366 | 3300026088 | Bacteria | 24146 |
| 296 | Ga0207641_10001725 | 3300026088 | Bacteria | 21104 |
| 297 | Ga0207641_10003461 | 3300026088 | Bacteria | 13981 |
| 298 | Ga0207641_10009847 | 3300026088 | Bacteria | 7869 |
| 299 | Ga0207676_10000643 | 3300026095 | Bacteria | 27996 |
| 300 | Ga0207676_10001043 | 3300026095 | Bacteria | 21158 |
| 301 | Ga0207676_10001977 | 3300026095 | Bacteria | 14926 |
| 302 | Ga0207676_10101501 | 3300026095 | Bacteria | 2386 |
| 303 | Ga0207674_10003894 | 3300026116 | Bacteria | 18157 |
| 304 | Ga0207674_10007275 | 3300026116 | Bacteria | 12904 |
| 305 | Ga0209981_1017953 | 3300027378 | Bacteria | 1001 |
| 306 | Ga0209813_10049114 | 3300027866 | Bacteria | 1312 |
| 307 | Ga0207428_10165426 | 3300027907 | Bacteria | 1677 |
| 308 | Ga0268266_10000355 | 3300028379 | Bacteria | 70950 |
| 309 | Ga0268266_10000992 | 3300028379 | Bacteria | 35787 |
| 310 | Ga0268266_10001259 | 3300028379 | Bacteria | 30951 |
| 311 | Ga0268266_10002845 | 3300028379 | Bacteria | 18035 |
| 312 | Ga0268266_10022548 | 3300028379 | Bacteria | 5364 |
| 313 | Ga0268265_10000081 | 3300028380 | Bacteria | 120869 |
| 314 | Ga0268265_10013766 | 3300028380 | Bacteria | 5505 |
| 315 | Ga0268265_10055791 | 3300028380 | Bacteria | 3003 |
| 316 | Ga0268265_10151236 | 3300028380 | Bacteria | 1958 |
| 317 | Ga0268264_10000087 | 3300028381 | Bacteria | 236696 |
| 318 | Ga0268264_10000431 | 3300028381 | Bacteria | 58140 |
| 319 | Ga0268264_10959381 | 3300028381 | Bacteria | 860 |
| 320 | Ga0265318_10051332 | 3300028577 | Bacteria | 1548 |
| 321 | Ga0307517_10001697 | 3300028786 | Bacteria | 36390 |
| 322 | Ga0307515_10090948 | 3300028794 | Bacteria | 3820 |
| 323 | Ga0307515_10293569 | 3300028794 | Bacteria | 1318 |
| 324 | Ga0265338_10008048 | 3300028800 | Bacteria | 12895 |
| 325 | Ga0265338_10062625 | 3300028800 | Bacteria | 3249 |
| 326 | Ga0265338_10305876 | 3300028800 | Bacteria | 1154 |
| 327 | Ga0265332_10058936 | 3300031238 | Bacteria | 1644 |
| 328 | Ga0265328_10008706 | 3300031239 | Bacteria | 4168 |
| 329 | Ga0265320_10001699 | 3300031240 | Bacteria | 15633 |
| 330 | Ga0265320_10029828 | 3300031240 | Bacteria | 2819 |
| 331 | Ga0265325_10074995 | 3300031241 | Bacteria | 1690 |
| 332 | Ga0265340_10077188 | 3300031247 | Bacteria | 1572 |
| 333 | Ga0265340_10157395 | 3300031247 | Bacteria | 1033 |
| 334 | Ga0265331_10033333 | 3300031250 | Bacteria | 2547 |
| 335 | Ga0265327_10000240 | 3300031251 | Bacteria | 109753 |
| 336 | Ga0265327_10001145 | 3300031251 | Bacteria | 36229 |
| 337 | Ga0265327_10131443 | 3300031251 | Bacteria | 1177 |
| 338 | Ga0265316_10038457 | 3300031344 | Bacteria | 3855 |
| 339 | Ga0265316_10080382 | 3300031344 | Bacteria | 2500 |
| 340 | Ga0307513_10068482 | 3300031456 | Bacteria | 3718 |
| 341 | Ga0307513_10148565 | 3300031456 | Bacteria | 2257 |
| 342 | Ga0307408_100137040 | 3300031548 | Bacteria | 1916 |
| 343 | Ga0265313_10099476 | 3300031595 | Bacteria | 1292 |
| 344 | Ga0265313_10133945 | 3300031595 | Bacteria | 1071 |
| 345 | Ga0307508_10171949 | 3300031616 | Bacteria | 1770 |
| 346 | Ga0265314_10019498 | 3300031711 | Bacteria | 5255 |
| 347 | Ga0265314_10104610 | 3300031711 | Bacteria | 1812 |
| 348 | Ga0265342_10137553 | 3300031712 | Bacteria | 1365 |
| 349 | Ga0265342_10163281 | 3300031712 | Bacteria | 1230 |
| 350 | Ga0307516_10036465 | 3300031730 | Bacteria | 4920 |
| 351 | Ga0307516_10532934 | 3300031730 | Bacteria | 828 |
| 352 | Ga0307405_10067926 | 3300031731 | Bacteria | 2279 |
| 353 | Ga0307405_10997798 | 3300031731 | Bacteria | 714 |
| 354 | Ga0307413_10004947 | 3300031824 | Bacteria | 5873 |
| 355 | Ga0307410_10181356 | 3300031852 | Bacteria | 1594 |
| 356 | Ga0307410_10209390 | 3300031852 | Bacteria | 1493 |
| 357 | Ga0307410_10282364 | 3300031852 | Bacteria | 1303 |
| 358 | Ga0307406_10125680 | 3300031901 | Bacteria | 1791 |
| 359 | Ga0307406_10262801 | 3300031901 | Bacteria | 1307 |
| 360 | Ga0307412_10000892 | 3300031911 | Bacteria | 17180 |
| 361 | Ga0307412_10005746 | 3300031911 | Bacteria | 6974 |
| 362 | Ga0307412_10027478 | 3300031911 | Bacteria | 3548 |
| 363 | Ga0307412_10073152 | 3300031911 | Bacteria | 2344 |
| 364 | Ga0307412_10405379 | 3300031911 | Bacteria | 1111 |
| 365 | Ga0307409_100037201 | 3300031995 | Bacteria | 3586 |
| 366 | Ga0307416_100033072 | 3300032002 | Bacteria | 3916 |
| 367 | Ga0307416_100756943 | 3300032002 | Bacteria | 1064 |
| 368 | Ga0307416_100806442 | 3300032002 | Bacteria | 1035 |
| 369 | Ga0307414_10039902 | 3300032004 | Bacteria | 3167 |
| 370 | Ga0307414_10076175 | 3300032004 | Bacteria | 2437 |
| 371 | Ga0307414_10199203 | 3300032004 | Bacteria | 1627 |
| 372 | Ga0307414_10282165 | 3300032004 | Bacteria | 1396 |
| 373 | Ga0307414_10528254 | 3300032004 | Bacteria | 1048 |
| 374 | Ga0307414_10915764 | 3300032004 | Bacteria | 804 |
| 375 | Ga0307411_10016852 | 3300032005 | Bacteria | 4145 |
| 376 | Ga0307411_10080186 | 3300032005 | Bacteria | 2243 |
| 377 | Ga0307411_10348780 | 3300032005 | Bacteria | 1206 |
| 378 | Ga0307415_100040517 | 3300032126 | Bacteria | 3086 |
| 379 | Ga0307510_10004286 | 3300033180 | Bacteria | 16771 |
| 380 | Ga0307510_10102844 | 3300033180 | Bacteria | 2637 |
| 381 | Ga0307510_10184838 | 3300033180 | Bacteria | 1641 |
| 382 | Ga0373944_0017399 | 3300035089 | Bacteria | 2040 |
| 383 | Ga0373936_0004530 | 3300035113 | Bacteria | 5262 |
| 384 | Ga0373956_0170476 | 3300035119 | Bacteria | 1027 |
| 385 | Ga0373943_0257092 | 3300035170 | Bacteria | 982 |
| 386 | Ga0373946_0105171 | 3300035171 | Bacteria | 1270 |
| 387 | Ga0373927_0000173 | 3300035695 | Bacteria | 50996 |
| 388 | Ga0373933_0060069 | 3300035724 | Bacteria | 2291 |
| 389 | Ga0373937_0045395 | 3300036401 | Bacteria | 4015 |
| 390 | Ga0373937_0265600 | 3300036401 | Bacteria | 1619 |
| 391 | Ga0373937_0748518 | 3300036401 | Bacteria | 925 |
| 392 | Ga0373925_0000049 | 3300037068 | Bacteria | 128065 |
| 393 | Ga0395899_0040149 | 3300037312 | Bacteria | 3500 |
| 394 | Ga0395899_0049886 | 3300037312 | Bacteria | 3110 |
| 395 | Ga0395900_0022716 | 3300037418 | Bacteria | 6420 |
| 396 | Ga0395900_0055440 | 3300037418 | Bacteria | 4081 |
| 397 | Ga0395900_0216909 | 3300037418 | Bacteria | 1930 |
| 398 | Ga0395900_0288510 | 3300037418 | Bacteria | 1630 |
| 399 | Ga0395900_0449674 | 3300037418 | Bacteria | 1245 |
| 400 | Ga0395898_0002186 | 3300037466 | Bacteria | 23900 |
| 401 | Ga0395898_0091703 | 3300037466 | Bacteria | 2923 |
| 402 | Ga0395898_0144230 | 3300037466 | Unclassified | 2279 |
| 403 | Ga0395905_0005653 | 3300037471 | Bacteria | 12717 |
| 404 | Ga0395905_0010395 | 3300037471 | Bacteria | 9060 |
| 405 | Ga0395905_0013648 | 3300037471 | Bacteria | 7783 |
| 406 | Ga0395905_0018130 | 3300037471 | Bacteria | 6680 |
| 407 | Ga0395905_0021056 | 3300037471 | Bacteria | 6174 |
| 408 | Ga0395905_0042184 | 3300037471 | Bacteria | 4281 |
| 409 | Ga0395905_0191642 | 3300037471 | Unclassified | 1917 |
| 410 | Ga0395905_0460204 | 3300037471 | Bacteria | 1170 |
| 411 | Ga0395905_0569501 | 3300037471 | Bacteria | 1034 |
| 412 | Ga0395905_0847324 | 3300037471 | Bacteria | 817 |
| 413 | Ga0395901_0012439 | 3300038443 | Bacteria | 8635 |
| 414 | Ga0395901_0025491 | 3300038443 | Bacteria | 6071 |
| 415 | Ga0395901_0307897 | 3300038443 | Bacteria | 1641 |
| 416 | Ga0395901_0380984 | 3300038443 | Bacteria | 1452 |
| 417 | Ga0395901_0507839 | 3300038443 | Bacteria | 1227 |
| 418 | Ga0436365_0536452 | 3300039437 | Bacteria | 11193 |
| 419 | Ga0436365_1556495 | 3300039437 | Bacteria | 1518 |
| 420 | Ga0436365_1890662 | 3300039437 | Bacteria | 719 |
| 421 | Ga0436361_0125416 | 3300039447 | Bacteria | 1108 |
| 422 | Ga0451795_0160777 | 3300041456 | Bacteria | 1536 |
| 423 | Ga0451806_261415 | 3300041462 | Bacteria | 1300 |
| 424 | Ga0439448_0003232 | 3300042005 | Bacteria | 4500 |
| 425 | Ga0439459_0015016 | 3300042438 | Bacteria | 1415 |
| 426 | Ga0466965_0087410 | 3300044683 | Bacteria | 1582 |
| 427 | Ga0466965_0282314 | 3300044683 | Bacteria | 897 |
| 428 | Ga0466957_0563988 | 3300044842 | Bacteria | 794 |
| 429 | Ga0466958_0088031 | 3300045836 | Bacteria | 1918 |
| 430 | Ga0466967_0389666 | 3300045976 | Bacteria | 1354 |
| 431 | Ga0495617_020418 | 3300046452 | Bacteria | 2239 |
| 432 | Ga0495627_000114 | 3300046453 | Bacteria | 100085 |
| 433 | Ga0495627_000975 | 3300046453 | Bacteria | 19521 |
| 434 | Ga0495590_0001381 | 3300046457 | Bacteria | 10543 |
| 435 | Ga0495638_0000188 | 3300046460 | Bacteria | 94506 |
| 436 | Ga0495638_0000292 | 3300046460 | Bacteria | 65766 |
| 437 | Ga0495638_0000659 | 3300046460 | Bacteria | 37742 |
| 438 | Ga0495638_0005797 | 3300046460 | Bacteria | 9090 |
| 439 | Ga0495638_0006272 | 3300046460 | Bacteria | 8678 |
| 440 | Ga0495638_0027187 | 3300046460 | Bacteria | 3705 |
| 441 | Ga0495638_0036318 | 3300046460 | Bacteria | 3140 |
| 442 | Ga0495638_0041030 | 3300046460 | Bacteria | 2930 |
| 443 | Ga0495650_0000168 | 3300046471 | Bacteria | 145714 |
| 444 | Ga0495650_0000470 | 3300046471 | Bacteria | 62114 |
| 445 | Ga0495650_0012138 | 3300046471 | Bacteria | 4658 |
| 446 | Ga0495650_0032618 | 3300046471 | Bacteria | 2327 |
| 447 | Ga0495583_0000002 | 3300046506 | Bacteria | 782521 |
| 448 | Ga0495583_0001366 | 3300046506 | Bacteria | 25162 |
| 449 | Ga0495606_0003607 | 3300046507 | Bacteria | 16276 |
| 450 | Ga0495606_0122835 | 3300046507 | Bacteria | 1552 |
| 451 | Ga0495610_0000024 | 3300046512 | Bacteria | 304748 |
| 452 | Ga0495610_0009572 | 3300046512 | Bacteria | 6111 |
| 453 | Ga0495610_0016848 | 3300046512 | Bacteria | 4188 |
| 454 | Ga0495616_0000206 | 3300046513 | Bacteria | 49005 |
| 455 | Ga0495616_0073219 | 3300046513 | Bacteria | 1653 |
| 456 | Ga0495631_0019031 | 3300046518 | Bacteria | 3225 |
| 457 | Ga0495632_0000727 | 3300046519 | Bacteria | 29842 |
| 458 | Ga0495632_0034763 | 3300046519 | Bacteria | 2576 |
| 459 | Ga0495637_0020670 | 3300046520 | Bacteria | 3025 |
| 460 | Ga0495637_0033331 | 3300046520 | Bacteria | 2263 |
| 461 | Ga0495637_0050106 | 3300046520 | Bacteria | 1752 |
| 462 | Ga0495643_0006441 | 3300046522 | Bacteria | 7740 |
| 463 | Ga0495643_0216908 | 3300046522 | Bacteria | 910 |
| 464 | Ga0495663_0074676 | 3300046525 | Bacteria | 1084 |
| 465 | Ga0495642_0009568 | 3300046528 | Bacteria | 3709 |
| 466 | Ga0495654_0000085 | 3300046530 | Bacteria | 107010 |
| 467 | Ga0495597_0004297 | 3300046542 | Bacteria | 7873 |
| 468 | Ga0495597_0153548 | 3300046542 | Bacteria | 943 |
| 469 | Ga0495622_0001106 | 3300046557 | Bacteria | 14103 |
| 470 | Ga0495622_0046688 | 3300046557 | Bacteria | 2012 |
| 471 | Ga0495633_0119645 | 3300046558 | Bacteria | 1220 |
| 472 | Ga0495668_0000019 | 3300046616 | Bacteria | 416042 |
| 473 | Ga0495668_0013101 | 3300046616 | Bacteria | 4905 |
| 474 | Ga0495668_0015148 | 3300046616 | Bacteria | 4508 |
| 475 | Ga0495668_0033164 | 3300046616 | Bacteria | 2902 |
| 476 | Ga0495668_0047397 | 3300046616 | Bacteria | 2386 |
| 477 | Ga0495668_0151236 | 3300046616 | Bacteria | 1271 |
| 478 | Ga0495668_0186134 | 3300046616 | Bacteria | 1137 |
| 479 | Ga0495611_0108508 | 3300046648 | Bacteria | 1291 |
| 480 | Ga0495625_0000255 | 3300046660 | Bacteria | 82750 |
| 481 | Ga0495625_0000408 | 3300046660 | Bacteria | 65240 |
| 482 | Ga0495625_0000505 | 3300046660 | Bacteria | 57930 |
| 483 | Ga0495625_0012001 | 3300046660 | Bacteria | 7032 |
| 484 | Ga0495625_0100011 | 3300046660 | Bacteria | 1993 |
| 485 | Ga0495625_0112556 | 3300046660 | Bacteria | 1859 |
| 486 | Ga0495625_0333652 | 3300046660 | Bacteria | 962 |
| 487 | Ga0495661_0048224 | 3300046665 | Bacteria | 2589 |
| 488 | Ga0495669_0000147 | 3300046684 | Bacteria | 45027 |
| 489 | Ga0495669_0011897 | 3300046684 | Bacteria | 3701 |
| 490 | Ga0495669_0131824 | 3300046684 | Bacteria | 1176 |
| 491 | Ga0495624_0215730 | 3300046690 | Bacteria | 1164 |
| 492 | Ga0495670_0041176 | 3300046691 | Bacteria | 2304 |
| 493 | Ga0495589_0000845 | 3300046794 | Bacteria | 19242 |
| 494 | Ga0495600_0005075 | 3300046809 | Bacteria | 7912 |
| 495 | Ga0495600_0111385 | 3300046809 | Bacteria | 1782 |
| 496 | Ga0495660_0066348 | 3300046810 | Bacteria | 1925 |
| 497 | Ga0495581_0053153 | 3300047315 | Bacteria | 2340 |
| 498 | Ga0495672_0006003 | 3300047320 | Bacteria | 9509 |
| 499 | Ga0495687_047451 | 3300047443 | Bacteria | 1848 |
| 500 | Ga0495679_013732 | 3300047446 | Bacteria | 3026 |
| 501 | Ga0495673_0000056 | 3300047469 | Bacteria | 245918 |
| 502 | Ga0495673_0002738 | 3300047469 | Bacteria | 12081 |
| 503 | Ga0495681_0120656 | 3300047470 | Bacteria | 1125 |
| 504 | Ga0495686_0000293 | 3300047472 | Bacteria | 87130 |
| 505 | Ga0495686_0003429 | 3300047472 | Bacteria | 13750 |
| 506 | Ga0495686_0004600 | 3300047472 | Bacteria | 11247 |
| 507 | Ga0495686_0027692 | 3300047472 | Bacteria | 3698 |
| 508 | Ga0495593_0055835 | 3300047673 | Bacteria | 2077 |
| 509 | Ga0495602_0279389 | 3300048088 | Bacteria | 1231 |
| 510 | Ga0496100_0413705 | 3300048903 | Bacteria | 1029 |
| 511 | Ga0496101_0012799 | 3300048904 | Bacteria | 5610 |
| 512 | Ga0496101_0167967 | 3300048904 | Bacteria | 1685 |
| 513 | Ga0496102_0000640 | 3300048905 | Bacteria | 35507 |
| 514 | Ga0496102_0066468 | 3300048905 | Bacteria | 3304 |
| 515 | Ga0496102_0095292 | 3300048905 | Bacteria | 2758 |
| 516 | Ga0496102_0115112 | 3300048905 | Bacteria | 2509 |
| 517 | Ga0496103_0000197 | 3300048906 | Bacteria | 60344 |
| 518 | Ga0496103_0050779 | 3300048906 | Bacteria | 2566 |
| 519 | Ga0496103_0217965 | 3300048906 | Bacteria | 1227 |
| 520 | Ga0496104_0113320 | 3300048907 | Bacteria | 2600 |
| 521 | Ga0496104_0139363 | 3300048907 | Bacteria | 2331 |
| 522 | Ga0496104_0339146 | 3300048907 | Bacteria | 1416 |
| 523 | Ga0496105_0094859 | 3300048908 | Bacteria | 2464 |
| 524 | Ga0496106_0001585 | 3300048909 | Bacteria | 17095 |
| 525 | Ga0496106_0017910 | 3300048909 | Bacteria | 5239 |
| 526 | Ga0496107_0000132 | 3300048910 | Bacteria | 36454 |
| 527 | Ga0496107_0024670 | 3300048910 | Bacteria | 4254 |
| 528 | Ga0496108_0069521 | 3300048911 | Bacteria | 2971 |
| 529 | Ga0496109_0275791 | 3300048912 | Bacteria | 1584 |
| 530 | Ga0496110_0834664 | 3300048913 | Unclassified | 826 |
| 531 | Ga0496111_0004034 | 3300048914 | Bacteria | 9216 |
| 532 | Ga0496111_0062633 | 3300048914 | Bacteria | 2697 |
| 533 | Ga0496112_0140291 | 3300048915 | Bacteria | 2386 |
| 534 | Ga0496113_0002148 | 3300048916 | Bacteria | 11372 |
| 535 | Ga0496113_0160786 | 3300048916 | Bacteria | 1775 |
| 536 | Ga0496114_0028745 | 3300048917 | Bacteria | 4565 |
| 537 | Ga0496115_0000166 | 3300048918 | Bacteria | 61341 |
| 538 | Ga0496115_0041744 | 3300048918 | Bacteria | 3652 |
| 539 | Ga0496115_0560892 | 3300048918 | Bacteria | 912 |
| 540 | Ga0496116_0006381 | 3300048919 | Bacteria | 10718 |
| 541 | Ga0496116_0053528 | 3300048919 | Bacteria | 2665 |
| 542 | Ga0496117_0000467 | 3300048920 | Bacteria | 67483 |
| 543 | Ga0496117_0002744 | 3300048920 | Bacteria | 21590 |
| 544 | Ga0496117_0014560 | 3300048920 | Bacteria | 6768 |
| 545 | Ga0496117_0038318 | 3300048920 | Bacteria | 3557 |
| 546 | Ga0496117_0076485 | 3300048920 | Bacteria | 2219 |
| 547 | Ga0496117_0301204 | 3300048920 | Bacteria | 849 |
| 548 | Ga0496118_0000310 | 3300048921 | Bacteria | 84607 |
| 549 | Ga0496118_0000459 | 3300048921 | Bacteria | 67483 |
| 550 | Ga0496118_0008784 | 3300048921 | Bacteria | 10361 |
| 551 | Ga0496118_0061500 | 3300048921 | Bacteria | 2780 |
| 552 | Ga0496118_0107468 | 3300048921 | Bacteria | 1863 |
| 553 | Ga0496119_0043930 | 3300048922 | Bacteria | 2819 |
| 554 | Ga0496119_0081527 | 3300048922 | Bacteria | 1863 |
| 555 | Ga0496119_0096747 | 3300048922 | Bacteria | 1665 |
| 556 | Ga0496119_0100417 | 3300048922 | Bacteria | 1625 |
| 557 | Ga0496120_0017447 | 3300048923 | Bacteria | 4654 |
| 558 | Ga0496120_0046822 | 3300048923 | Bacteria | 2497 |
| 559 | Ga0496121_0000152 | 3300048924 | Bacteria | 150767 |
| 560 | Ga0496121_0006484 | 3300048924 | Bacteria | 14498 |
| 561 | Ga0496121_0006787 | 3300048924 | Bacteria | 14023 |
| 562 | Ga0496121_0041140 | 3300048924 | Bacteria | 4044 |
| 563 | Ga0496121_0052912 | 3300048924 | Bacteria | 3405 |
| 564 | Ga0496121_0158609 | 3300048924 | Bacteria | 1657 |
| 565 | Ga0496121_0295707 | 3300048924 | Bacteria | 1101 |
| 566 | Ga0496122_0007934 | 3300048925 | Bacteria | 11616 |
| 567 | Ga0496122_0043899 | 3300048925 | Bacteria | 3497 |
| 568 | Ga0496122_0177352 | 3300048925 | Bacteria | 1276 |
| 569 | Ga0496123_0097524 | 3300048926 | Bacteria | 1722 |
| 570 | Ga0496123_0193839 | 3300048926 | Bacteria | 1048 |
| 571 | Ga0496124_0000121 | 3300048927 | Bacteria | 162988 |
| 572 | Ga0496124_0000499 | 3300048927 | Bacteria | 67483 |
| 573 | Ga0496124_0011941 | 3300048927 | Bacteria | 8643 |
| 574 | Ga0496124_0066695 | 3300048927 | Bacteria | 2996 |
| 575 | Ga0496124_0075869 | 3300048927 | Bacteria | 2777 |
| 576 | Ga0496124_0132604 | 3300048927 | Bacteria | 1977 |
| 577 | Ga0496124_0132697 | 3300048927 | Bacteria | 1976 |
| 578 | Ga0496124_0444729 | 3300048927 | Unclassified | 886 |
| 579 | Ga0496125_0008331 | 3300048928 | Bacteria | 10876 |
| 580 | Ga0496125_0048089 | 3300048928 | Bacteria | 3560 |
| 581 | Ga0496125_0086293 | 3300048928 | Bacteria | 2374 |
| 582 | Ga0496126_0006453 | 3300048929 | Bacteria | 13068 |
| 583 | Ga0496126_0014348 | 3300048929 | Bacteria | 8013 |
| 584 | Ga0496126_0211850 | 3300048929 | Bacteria | 1631 |
| 585 | Ga0496126_0227488 | 3300048929 | Bacteria | 1564 |
| 586 | Ga0495678_002468 | 3300049459 | Bacteria | 12490 |
| 587 | Ga0501036_0101171 | 3300049572 | Bacteria | 2438 |
| 588 | Ga0501043_0296790 | 3300049579 | Bacteria | 1236 |
| 589 | Ga0501047_0000266 | 3300049581 | Bacteria | 60893 |
| 590 | Ga0501047_0000471 | 3300049581 | Bacteria | 43820 |
| 591 | Ga0501047_0000893 | 3300049581 | Bacteria | 30459 |
| 592 | Ga0501047_0396785 | 3300049581 | Bacteria | 1213 |
| 593 | Ga0501070_0037037 | 3300049586 | Bacteria | 4072 |
| 594 | Ga0501072_0001051 | 3300049588 | Bacteria | 20459 |
| 595 | Ga0501080_0091915 | 3300049742 | Bacteria | 2819 |
| 596 | Ga0501080_0349363 | 3300049742 | Bacteria | 1336 |
| 597 | Ga0501083_0173642 | 3300049744 | Bacteria | 1408 |
| 598 | Ga0501044_0053834 | 3300049823 | Bacteria | 4139 |
| 599 | nmdc:mga03n38_158366_c1 | 3300050490 | Bacteria | 1145 |
| 600 | nmdc:mga00v17_6139_c1 | 3300050491 | Bacteria | 6011 |
| 601 | nmdc:mga0k408_21903_c1 | 3300050493 | Bacteria | 3593 |
| 602 | nmdc:mga0k408_73870_c1 | 3300050493 | Bacteria | 1992 |
| 603 | nmdc:mga0k408_87260_c1 | 3300050493 | Bacteria | 1832 |
| 604 | nmdc:mga07m45_25958_c1 | 3300050496 | Bacteria | 3218 |
| 605 | nmdc:mga07m45_46050_c1 | 3300050496 | Bacteria | 2450 |
| 606 | nmdc:mga05p37_5458_c1 | 3300050507 | Bacteria | 14925 |
| 607 | nmdc:mga08y16_111549_c1 | 3300050511 | Bacteria | 2847 |
| 608 | nmdc:mga0rr50_82781_c1 | 3300050513 | Bacteria | 2479 |
| 609 | nmdc:mga0a205_5883_c1 | 3300050515 | Bacteria | 11048 |
| 610 | nmdc:mga0sz30_5449_c1 | 3300050516 | Bacteria | 4667 |
| 611 | Ga0500635_0000208 | 3300053080 | Bacteria | 28812 |
| 612 | Ga0500578_0000124 | 3300053086 | Bacteria | 92437 |
| 613 | Ga0500643_005104 | 3300053087 | Bacteria | 5737 |
| 614 | Ga0500643_023865 | 3300053087 | Bacteria | 1949 |
| 615 | Ga0500643_049116 | 3300053087 | Bacteria | 1211 |
| 616 | Ga0500644_0003731 | 3300053088 | Bacteria | 3783 |
| 617 | Ga0500647_0063478 | 3300053091 | Bacteria | 1777 |
| 618 | Ga0500651_0176347 | 3300053093 | Bacteria | 1271 |
| 619 | Ga0500566_0033160 | 3300053094 | Bacteria | 3010 |
| 620 | Ga0500641_0000924 | 3300053096 | Bacteria | 10475 |
| 621 | Ga0500556_0101808 | 3300053104 | Bacteria | 1107 |
| 622 | Ga0500562_000453 | 3300053108 | Bacteria | 9951 |
| 623 | Ga0500562_000907 | 3300053108 | Bacteria | 7190 |
| 624 | Ga0500569_000410 | 3300053109 | Bacteria | 7007 |
| 625 | Ga0500592_015687 | 3300053116 | Bacteria | 1216 |
| 626 | Ga0500594_0000184 | 3300053118 | Bacteria | 15781 |
| 627 | Ga0500595_001453 | 3300053119 | Bacteria | 12624 |
| 628 | Ga0500595_004634 | 3300053119 | Bacteria | 6131 |
| 629 | Ga0500595_018235 | 3300053119 | Bacteria | 2571 |
| 630 | Ga0500595_050724 | 3300053119 | Bacteria | 1287 |
| 631 | Ga0500608_000004 | 3300053122 | Bacteria | 108109 |
| 632 | Ga0500608_054398 | 3300053122 | Bacteria | 1920 |
| 633 | Ga0500618_000022 | 3300053125 | Bacteria | 157907 |
| 634 | Ga0500642_0091905 | 3300053130 | Bacteria | 1403 |
| 635 | Ga0500642_0185545 | 3300053130 | Bacteria | 972 |
| 636 | Ga0500655_017611 | 3300053133 | Bacteria | 1323 |
| 637 | Ga0500658_0010960 | 3300053134 | Bacteria | 3342 |
| 638 | Ga0500559_0002236 | 3300053136 | Bacteria | 10228 |
| 639 | Ga0500559_0004502 | 3300053136 | Bacteria | 6598 |
| 640 | Ga0500559_0005625 | 3300053136 | Bacteria | 5743 |
| 641 | Ga0500564_053379 | 3300053138 | Bacteria | 1846 |
| 642 | Ga0500604_0034821 | 3300053151 | Bacteria | 1496 |
| 643 | Ga0500616_0005230 | 3300053153 | Bacteria | 8876 |
| 644 | Ga0500619_002204 | 3300053154 | Bacteria | 3693 |
| 645 | Ga0500622_0002350 | 3300053156 | Bacteria | 13748 |
| 646 | Ga0500622_0020115 | 3300053156 | Bacteria | 3545 |
| 647 | Ga0500622_0203062 | 3300053156 | Bacteria | 900 |
| 648 | Ga0500627_0102408 | 3300053158 | Bacteria | 1286 |
| 649 | Ga0500627_0190553 | 3300053158 | Bacteria | 921 |
| 650 | Ga0500636_0006613 | 3300053177 | Bacteria | 6662 |
| 651 | Ga0500637_0000774 | 3300053178 | Bacteria | 12861 |
| 652 | Ga0500637_0109424 | 3300053178 | Bacteria | 1602 |
| 653 | Ga0500576_039266 | 3300053725 | Bacteria | 2135 |
| 654 | Ga0500645_001242 | 3300053730 | Bacteria | 13444 |
| 655 | Ga0500645_002350 | 3300053730 | Bacteria | 8520 |
| 656 | Ga0500645_005215 | 3300053730 | Bacteria | 4836 |
| 657 | Ga0500645_018801 | 3300053730 | Bacteria | 2153 |
| 658 | Ga0500645_049253 | 3300053730 | Bacteria | 1233 |
| 659 | Ga0500609_000278 | 3300053731 | Bacteria | 7501 |
| 660 | Ga0500552_000084 | 3300053733 | Bacteria | 7639 |
| 661 | Ga0500596_005428 | 3300053735 | Bacteria | 2244 |
| 662 | Ga0500601_003505 | 3300053737 | Bacteria | 1703 |
| 663 | Ga0501084_0044996 | 3300054114 | Bacteria | 3696 |
| 664 | Ga0501082_0287939 | 3300060353 | Bacteria | 1430 |
| 665 | 2511125608 | 2510917020 | Bacteria | 5657507 |
| 666 | 2585147804 | 2582581279 | Bacteria | 4980720 |
| 667 | 2585151448 | 2582581280 | Bacteria | 5994497 |
| 668 | 2585196162 | 2582581293 | Bacteria | 5907401 |
| 669 | 2587917379 | 2585428106 | Bacteria | 5179711 |
| 670 | 2600202623 | 2599185354 | Bacteria | 4398675 |
| 671 | 2643750132 | 2643221545 | Bacteria | 5083237 |
| 672 | 2643779000 | 2643221552 | Bacteria | 5708754 |
| 673 | 2643782267 | 2643221552 | Bacteria | 5708754 |
| 674 | 2643822937 | 2643221560 | Bacteria | 4801179 |
| 675 | 2643926037 | 2643221583 | Bacteria | 5218014 |
| 676 | 2643928944 | 2643221584 | Bacteria | 5511711 |
| 677 | 2644001631 | 2643221598 | Bacteria | 4578346 |
| 678 | 2644227100 | 2643221640 | Bacteria | 5258820 |
| 679 | 2644233432 | 2643221642 | Bacteria | 5357871 |
| 680 | 2644507021 | 2643221691 | Bacteria | 5093099 |
| 681 | 2753764418 | 2751185897 | Bacteria | 5322941 |
| 682 | 2819536960 | 2818991435 | Bacteria | 5433759 |
| 683 | 2819645372 | 2818991454 | Bacteria | 5563326 |
| 684 | 2857507815 | 2857504554 | Bacteria | 5369913 |
| 685 | 2884964854 | 2884960567 | Bacteria | 5437054 |
| 686 | 2928533402 | 2928531327 | Bacteria | 5101314 |
| 687 | Ga0495625_0000249 | |||
| 688 | SwRhRL2b_contig_2020771 | |||
| 689 | JGI24736J21556_1001507 | |||
| 690 | JGI24741J21665_1001754 | |||
| 691 | JGI24740J21852_10007012 | |||
| 692 | JGI24739J22299_10004886 | |||
| 693 | JGI24735J21928_10002223 | |||
| 694 | JGI24738J21930_10007622 | |||
| 695 | Ga0055526_1018641 | |||
| 696 | Ga0055524_1021542 | |||
| 697 | Ga0055536_1000868 | |||
| 698 | Ga0055536_1004191 | |||
| 699 | Ga0055536_1004367 | |||
| 700 | Ga0055536_1004704 | |||
| 701 | Ga0055528_1008845 | |||
| 702 | Ga0055530_10000222 | |||
| 703 | Ga0055530_10004612 | |||
| 704 | Ga0055531_10001853 | |||
| 705 | Ga0055531_10005504 | |||
| 706 | Ga0055531_10020929 | |||
| 707 | Ga0065165_1001578 | |||
| 708 | Ga0065704_10088305 | |||
| 709 | Ga0065704_10115627 | |||
| 710 | Ga0070658_10000102 | |||
| 711 | Ga0070658_10052742 | |||
| 712 | Ga0070658_10367660 | |||
| 713 | Ga0070690_100295670 | |||
| 714 | Ga0070670_100000020 | |||
| 715 | Ga0070670_100265936 | |||
| 716 | Ga0070666_10033542 | |||
| 717 | Ga0070666_10042194 | |||
| 718 | Ga0068868_100477159 | |||
| 719 | Ga0070660_100000847 | |||
| 720 | Ga0070660_100035676 | |||
| 721 | Ga0070660_100042317 | |||
| 722 | Ga0070660_100370368 | |||
| 723 | Ga0070668_100001335 | |||
| 724 | Ga0070668_100002029 | |||
| 725 | Ga0070668_100164847 | |||
| 726 | Ga0070669_100001287 | |||
| 727 | Ga0070671_100001778 | |||
| 728 | Ga0070671_100005770 | |||
| 729 | Ga0070671_100302711 | |||
| 730 | Ga0070671_100408929 | |||
| 731 | Ga0070659_100001070 | |||
| 732 | Ga0070659_100037730 | |||
| 733 | Ga0070659_100145258 | |||
| 734 | Ga0070659_100200959 | |||
| 735 | Ga0070659_100225477 | |||
| 736 | Ga0070667_100000016 | |||
| 737 | Ga0070667_100001248 | |||
| 738 | Ga0070667_100005535 | |||
| 739 | Ga0070667_100047716 | |||
| 740 | Ga0070667_100162507 | |||
| 741 | Ga0070714_100341518 | |||
| 742 | Ga0070714_100931577 | |||
| 743 | Ga0070663_100019776 | |||
| 744 | Ga0070663_100108889 | |||
| 745 | Ga0070662_100073258 | |||
| 746 | Ga0070681_10265426 | |||
| 747 | Ga0070685_10284450 | |||
| 748 | Ga0070697_100510805 | |||
| 749 | Ga0068853_100176182 | |||
| 750 | Ga0068853_100668854 | |||
| 751 | Ga0070686_100173512 | |||
| 752 | Ga0070695_100011009 | |||
| 753 | Ga0070696_100190849 | |||
| 754 | Ga0070665_100000145 | |||
| 755 | Ga0070665_100000505 | |||
| 756 | Ga0070665_100001851 | |||
| 757 | Ga0070665_100003414 | |||
| 758 | Ga0070665_100032439 | |||
| 759 | Ga0070665_100133153 | |||
| 760 | Ga0068855_100685772 | |||
| 761 | Ga0070664_100075743 | |||
| 762 | Ga0070664_100200587 | |||
| 763 | Ga0068857_100141555 | |||
| 764 | Ga0068854_100168745 | |||
| 765 | Ga0068856_100003533 | |||
| 766 | Ga0068856_100142151 | |||
| 767 | Ga0068856_100583161 | |||
| 768 | Ga0068859_100050592 | |||
| 769 | Ga0068859_100289983 | |||
| 770 | Ga0068859_101191107 | |||
| 771 | Ga0068864_100000060 | |||
| 772 | Ga0068864_100000228 | |||
| 773 | Ga0068864_100242995 | |||
| 774 | Ga0068851_10013664 | |||
| 775 | Ga0068863_100000023 | |||
| 776 | Ga0068863_100003621 | |||
| 777 | Ga0068863_100029334 | |||
| 778 | Ga0068863_100035538 | |||
| 779 | Ga0068863_100197994 | |||
| 780 | Ga0068863_100622325 | |||
| 781 | Ga0068858_100008595 | |||
| 782 | Ga0068858_100011301 | |||
| 783 | Ga0068858_100027403 | |||
| 784 | Ga0068858_100097249 | |||
| 785 | Ga0068858_100175867 | |||
| 786 | Ga0068860_100000196 | |||
| 787 | Ga0068860_100000310 | |||
| 788 | Ga0068860_100231238 | |||
| 789 | Ga0068862_100000032 | |||
| 790 | Ga0068862_100005889 | |||
| 791 | Ga0068862_100017249 | |||
| 792 | Ga0068862_100092771 | |||
| 793 | Ga0068862_100866371 | |||
| 794 | Ga0081540_1000179 | |||
| 795 | Ga0070717_10009962 | |||
| 796 | Ga0075363_100067429 | |||
| 797 | Ga0075363_100230362 | |||
| 798 | Ga0075364_10003820 | |||
| 799 | Ga0070712_100069766 | |||
| 800 | Ga0075362_10001011 | |||
| 801 | Ga0075367_10011982 | |||
| 802 | Ga0075367_10038072 | |||
| 803 | Ga0075369_10005460 | |||
| 804 | Ga0075369_10158321 | |||
| 805 | Ga0075366_10014535 | |||
| 806 | Ga0075366_10029738 | |||
| 807 | Ga0075366_10040817 | |||
| 808 | Ga0075366_10042707 | |||
| 809 | Ga0075366_10059723 | |||
| 810 | Ga0075366_10080296 | |||
| 811 | Ga0075366_10170738 | |||
| 812 | Ga0097621_100084684 | |||
| 813 | Ga0075370_10023096 | |||
| 814 | Ga0075370_10043685 | |||
| 815 | Ga0075434_100002162 | |||
| 816 | Ga0068865_100277269 | |||
| 817 | Ga0097620_100050592 | |||
| 818 | Ga0097620_100289997 | |||
| 819 | Ga0097620_101190995 | |||
| 820 | Ga0075435_100490402 | |||
| 821 | Ga0105250_10012457 | |||
| 822 | Ga0105240_10066331 | |||
| 823 | Ga0105240_10175669 | |||
| 824 | Ga0105240_10331835 | |||
| 825 | Ga0105247_10012174 | |||
| 826 | Ga0105247_10022771 | |||
| 827 | Ga0114129_10005640 | |||
| 828 | Ga0105241_10001537 | |||
| 829 | Ga0105248_10001464 | |||
| 830 | Ga0105248_10001756 | |||
| 831 | Ga0105248_10008233 | |||
| 832 | Ga0105248_10037485 | |||
| 833 | Ga0105248_10040905 | |||
| 834 | Ga0105248_10128248 | |||
| 835 | Ga0105248_10142284 | |||
| 836 | Ga0105248_10348979 | |||
| 837 | Ga0105237_10068201 | |||
| 838 | Ga0105238_10063781 | |||
| 839 | Ga0105238_10123025 | |||
| 840 | Ga0105238_10167776 | |||
| 841 | Ga0105238_10172073 | |||
| 842 | Ga0105249_10001654 | |||
| 843 | Ga0105249_10042449 | |||
| 844 | Ga0105249_10209530 | |||
| 845 | Ga0105249_10786893 | |||
| 846 | Ga0105239_10074094 | |||
| 847 | Ga0105239_10265706 | |||
| 848 | Ga0105239_10363631 | |||
| 849 | Ga0105239_10459069 | |||
| 850 | Ga0105239_10548570 | |||
| 851 | Ga0105239_10876771 | |||
| 852 | Ga0157373_10050188 | |||
| 853 | Ga0157373_10262425 | |||
| 854 | Ga0157374_10484675 | |||
| 855 | Ga0157378_10247825 | |||
| 856 | Ga0163162_10043873 | |||
| 857 | Ga0163162_10762570 | |||
| 858 | Ga0157372_10301414 | |||
| 859 | Ga0163163_10071930 | |||
| 860 | Ga0163163_10082334 | |||
| 861 | Ga0163163_10204287 | |||
| 862 | Ga0163163_10229698 | |||
| 863 | Ga0163163_10293911 | |||
| 864 | Ga0163163_10734921 | |||
| 865 | Ga0182008_10065988 | |||
| 866 | Ga0157379_10000848 | |||
| 867 | Ga0157379_10065925 | |||
| 868 | Ga0157379_10125336 | |||
| 869 | Ga0157379_10294411 | |||
| 870 | Ga0163161_10341393 | |||
| 871 | Ga0209437_105181 | |||
| 872 | Ga0209026_1012154 | |||
| 873 | Ga0209148_1000285 | |||
| 874 | Ga0209233_1000058 | |||
| 875 | Ga0209565_1000297 | |||
| 876 | Ga0209455_1006483 | |||
| 877 | Ga0209673_1001189 | |||
| 878 | Ga0209675_1000097 | |||
| 879 | Ga0209676_1000085 | |||
| 880 | Ga0209676_1000272 | |||
| 881 | Ga0209676_1000373 | |||
| 882 | Ga0209676_1000927 | |||
| 883 | Ga0209025_1026095 | |||
| 884 | Ga0209564_1007305 | |||
| 885 | Ga0209564_1034009 | |||
| 886 | Ga0209758_1000919 | |||
| 887 | Ga0209758_1000965 | |||
| 888 | Ga0209758_1059339 | |||
| 889 | Ga0209050_1000344 | |||
| 890 | Ga0209050_1000387 | |||
| 891 | Ga0209050_1000627 | |||
| 892 | Ga0209050_1007357 | |||
| 893 | Ga0209050_1017467 | |||
| 894 | Ga0209256_1000360 | |||
| 895 | Ga0209256_1008273 | |||
| 896 | Ga0209256_1008623 | |||
| 897 | Ga0209051_1055833 | |||
| 898 | Ga0209257_1000187 | |||
| 899 | Ga0209257_1000624 | |||
| 900 | Ga0209257_1000739 | |||
| 901 | Ga0209257_1007538 | |||
| 902 | Ga0209257_1009271 | |||
| 903 | Ga0207697_10022861 | |||
| 904 | Ga0207696_1013014 | |||
| 905 | Ga0207710_10021049 | |||
| 906 | Ga0207688_10098178 | |||
| 907 | Ga0207680_10045818 | |||
| 908 | Ga0207647_10162008 | |||
| 909 | Ga0207699_10166453 | |||
| 910 | Ga0207705_10000054 | |||
| 911 | Ga0207705_10000263 | |||
| 912 | Ga0207654_10326094 | |||
| 913 | Ga0207707_10109284 | |||
| 914 | Ga0207695_10068001 | |||
| 915 | Ga0207695_10128134 | |||
| 916 | Ga0207695_10141520 | |||
| 917 | Ga0207695_10224291 | |||
| 918 | Ga0207671_10007571 | |||
| 919 | Ga0207693_10058755 | |||
| 920 | Ga0207660_10039638 | |||
| 921 | Ga0207660_10096912 | |||
| 922 | Ga0207657_10000114 | |||
| 923 | Ga0207657_10000810 | |||
| 924 | Ga0207657_10005221 | |||
| 925 | Ga0207657_10006066 | |||
| 926 | Ga0207657_10148318 | |||
| 927 | Ga0207657_10279904 | |||
| 928 | Ga0207681_10001436 | |||
| 929 | Ga0207681_10161574 | |||
| 930 | Ga0207694_10003358 | |||
| 931 | Ga0207694_10335599 | |||
| 932 | Ga0207650_10000381 | |||
| 933 | Ga0207650_10428543 | |||
| 934 | Ga0207687_10001232 | |||
| 935 | Ga0207664_10123397 | |||
| 936 | Ga0207644_10000056 | |||
| 937 | Ga0207644_10001408 | |||
| 938 | Ga0207644_10002514 | |||
| 939 | Ga0207644_10216101 | |||
| 940 | Ga0207690_10000053 | |||
| 941 | Ga0207690_10031990 | |||
| 942 | Ga0207690_10057056 | |||
| 943 | Ga0207690_10220428 | |||
| 944 | Ga0207711_10000731 | |||
| 945 | Ga0207711_10001333 | |||
| 946 | Ga0207711_10001926 | |||
| 947 | Ga0207711_10044357 | |||
| 948 | Ga0207711_10087849 | |||
| 949 | Ga0207711_10437173 | |||
| 950 | Ga0207711_10443031 | |||
| 951 | Ga0207711_10482047 | |||
| 952 | Ga0207679_10048382 | |||
| 953 | Ga0207679_10060210 | |||
| 954 | Ga0207667_10050437 | |||
| 955 | Ga0207667_10091412 | |||
| 956 | Ga0207712_10002612 | |||
| 957 | Ga0207712_10018540 | |||
| 958 | Ga0207712_10089212 | |||
| 959 | Ga0207668_10000001 | |||
| 960 | Ga0207668_10012418 | |||
| 961 | Ga0207640_10002116 | |||
| 962 | Ga0207658_10000075 | |||
| 963 | Ga0207658_10000516 | |||
| 964 | Ga0207658_10022156 | |||
| 965 | Ga0207658_10241126 | |||
| 966 | Ga0207658_10544399 | |||
| 967 | Ga0207677_10518319 | |||
| 968 | Ga0207703_10000447 | |||
| 969 | Ga0207703_10000571 | |||
| 970 | Ga0207703_10011378 | |||
| 971 | Ga0207703_10018812 | |||
| 972 | Ga0207703_10148874 | |||
| 973 | Ga0207703_10372031 | |||
| 974 | Ga0207639_10000083 | |||
| 975 | Ga0207639_10112961 | |||
| 976 | Ga0207678_10000186 | |||
| 977 | Ga0207678_10115550 | |||
| 978 | Ga0207702_10010771 | |||
| 979 | Ga0207702_10324362 | |||
| 980 | Ga0207641_10000067 | |||
| 981 | Ga0207641_10001366 | |||
| 982 | Ga0207641_10001725 | |||
| 983 | Ga0207641_10003461 | |||
| 984 | Ga0207641_10009847 | |||
| 985 | Ga0207676_10000643 | |||
| 986 | Ga0207676_10001043 | |||
| 987 | Ga0207676_10001977 | |||
| 988 | Ga0207676_10101501 | |||
| 989 | Ga0207674_10003894 | |||
| 990 | Ga0207674_10007275 | |||
| 991 | Ga0209981_1017953 | |||
| 992 | Ga0209813_10049114 | |||
| 993 | Ga0207428_10165426 | |||
| 994 | Ga0268266_10000355 | |||
| 995 | Ga0268266_10000992 | |||
| 996 | Ga0268266_10001259 | |||
| 997 | Ga0268266_10002845 | |||
| 998 | Ga0268266_10022548 | |||
| 999 | Ga0268265_10000081 | |||
| 1000 | Ga0268265_10013766 | |||
| 1001 | Ga0268265_10055791 | |||
| 1002 | Ga0268265_10151236 | |||
| 1003 | Ga0268264_10000087 | |||
| 1004 | Ga0268264_10000431 | |||
| 1005 | Ga0268264_10959381 | |||
| 1006 | Ga0265318_10051332 | |||
| 1007 | Ga0307517_10001697 | |||
| 1008 | Ga0307515_10090948 | |||
| 1009 | Ga0307515_10293569 | |||
| 1010 | Ga0265338_10008048 | |||
| 1011 | Ga0265338_10062625 | |||
| 1012 | Ga0265338_10305876 | |||
| 1013 | Ga0265332_10058936 | |||
| 1014 | Ga0265328_10008706 | |||
| 1015 | Ga0265320_10001699 | |||
| 1016 | Ga0265320_10029828 | |||
| 1017 | Ga0265325_10074995 | |||
| 1018 | Ga0265340_10077188 | |||
| 1019 | Ga0265340_10157395 | |||
| 1020 | Ga0265331_10033333 | |||
| 1021 | Ga0265327_10000240 | |||
| 1022 | Ga0265327_10001145 | |||
| 1023 | Ga0265327_10131443 | |||
| 1024 | Ga0265316_10038457 | |||
| 1025 | Ga0265316_10080382 | |||
| 1026 | Ga0307513_10068482 | |||
| 1027 | Ga0307513_10148565 | |||
| 1028 | Ga0307408_100137040 | |||
| 1029 | Ga0265313_10099476 | |||
| 1030 | Ga0265313_10133945 | |||
| 1031 | Ga0307508_10171949 | |||
| 1032 | Ga0265314_10019498 | |||
| 1033 | Ga0265314_10104610 | |||
| 1034 | Ga0265342_10137553 | |||
| 1035 | Ga0265342_10163281 | |||
| 1036 | Ga0307516_10036465 | |||
| 1037 | Ga0307516_10532934 | |||
| 1038 | Ga0307405_10067926 | |||
| 1039 | Ga0307405_10997798 | |||
| 1040 | Ga0307413_10004947 | |||
| 1041 | Ga0307410_10181356 | |||
| 1042 | Ga0307410_10209390 | |||
| 1043 | Ga0307410_10282364 | |||
| 1044 | Ga0307406_10125680 | |||
| 1045 | Ga0307406_10262801 | |||
| 1046 | Ga0307412_10000892 | |||
| 1047 | Ga0307412_10005746 | |||
| 1048 | Ga0307412_10027478 | |||
| 1049 | Ga0307412_10073152 | |||
| 1050 | Ga0307412_10405379 | |||
| 1051 | Ga0307409_100037201 | |||
| 1052 | Ga0307416_100033072 | |||
| 1053 | Ga0307416_100756943 | |||
| 1054 | Ga0307416_100806442 | |||
| 1055 | Ga0307414_10039902 | |||
| 1056 | Ga0307414_10076175 | |||
| 1057 | Ga0307414_10199203 | |||
| 1058 | Ga0307414_10282165 | |||
| 1059 | Ga0307414_10528254 | |||
| 1060 | Ga0307414_10915764 | |||
| 1061 | Ga0307411_10016852 | |||
| 1062 | Ga0307411_10080186 | |||
| 1063 | Ga0307411_10348780 | |||
| 1064 | Ga0307415_100040517 | |||
| 1065 | Ga0307510_10004286 | |||
| 1066 | Ga0307510_10102844 | |||
| 1067 | Ga0307510_10184838 | |||
| 1068 | Ga0373944_0017399 | |||
| 1069 | Ga0373936_0004530 | |||
| 1070 | Ga0373956_0170476 | |||
| 1071 | Ga0373943_0257092 | |||
| 1072 | Ga0373946_0105171 | |||
| 1073 | Ga0373927_0000173 | |||
| 1074 | Ga0373933_0060069 | |||
| 1075 | Ga0373937_0045395 | |||
| 1076 | Ga0373937_0265600 | |||
| 1077 | Ga0373937_0748518 | |||
| 1078 | Ga0373925_0000049 | |||
| 1079 | Ga0395899_0040149 | |||
| 1080 | Ga0395899_0049886 | |||
| 1081 | Ga0395900_0022716 | |||
| 1082 | Ga0395900_0055440 | |||
| 1083 | Ga0395900_0216909 | |||
| 1084 | Ga0395900_0288510 | |||
| 1085 | Ga0395900_0449674 | |||
| 1086 | Ga0395898_0002186 | |||
| 1087 | Ga0395898_0091703 | |||
| 1088 | Ga0395898_0144230 | |||
| 1089 | Ga0395905_0005653 | |||
| 1090 | Ga0395905_0010395 | |||
| 1091 | Ga0395905_0013648 | |||
| 1092 | Ga0395905_0018130 | |||
| 1093 | Ga0395905_0021056 | |||
| 1094 | Ga0395905_0042184 | |||
| 1095 | Ga0395905_0191642 | |||
| 1096 | Ga0395905_0460204 | |||
| 1097 | Ga0395905_0569501 | |||
| 1098 | Ga0395905_0847324 | |||
| 1099 | Ga0395901_0012439 | |||
| 1100 | Ga0395901_0025491 | |||
| 1101 | Ga0395901_0307897 | |||
| 1102 | Ga0395901_0380984 | |||
| 1103 | Ga0395901_0507839 | |||
| 1104 | Ga0436365_0536452 | |||
| 1105 | Ga0436365_1556495 | |||
| 1106 | Ga0436365_1890662 | |||
| 1107 | Ga0436361_0125416 | |||
| 1108 | Ga0451795_0160777 | |||
| 1109 | Ga0451806_261415 | |||
| 1110 | Ga0439448_0003232 | |||
| 1111 | Ga0439459_0015016 | |||
| 1112 | Ga0466965_0087410 | |||
| 1113 | Ga0466965_0282314 | |||
| 1114 | Ga0466957_0563988 | |||
| 1115 | Ga0466958_0088031 | |||
| 1116 | Ga0466967_0389666 | |||
| 1117 | Ga0495617_020418 | |||
| 1118 | Ga0495627_000114 | |||
| 1119 | Ga0495627_000975 | |||
| 1120 | Ga0495590_0001381 | |||
| 1121 | Ga0495638_0000188 | |||
| 1122 | Ga0495638_0000292 | |||
| 1123 | Ga0495638_0000659 | |||
| 1124 | Ga0495638_0005797 | |||
| 1125 | Ga0495638_0006272 | |||
| 1126 | Ga0495638_0027187 | |||
| 1127 | Ga0495638_0036318 | |||
| 1128 | Ga0495638_0041030 | |||
| 1129 | Ga0495650_0000168 | |||
| 1130 | Ga0495650_0000470 | |||
| 1131 | Ga0495650_0012138 | |||
| 1132 | Ga0495650_0032618 | |||
| 1133 | Ga0495583_0000002 | |||
| 1134 | Ga0495583_0001366 | |||
| 1135 | Ga0495606_0003607 | |||
| 1136 | Ga0495606_0122835 | |||
| 1137 | Ga0495610_0000024 | |||
| 1138 | Ga0495610_0009572 | |||
| 1139 | Ga0495610_0016848 | |||
| 1140 | Ga0495616_0000206 | |||
| 1141 | Ga0495616_0073219 | |||
| 1142 | Ga0495631_0019031 | |||
| 1143 | Ga0495632_0000727 | |||
| 1144 | Ga0495632_0034763 | |||
| 1145 | Ga0495637_0020670 | |||
| 1146 | Ga0495637_0033331 | |||
| 1147 | Ga0495637_0050106 | |||
| 1148 | Ga0495643_0006441 | |||
| 1149 | Ga0495643_0216908 | |||
| 1150 | Ga0495663_0074676 | |||
| 1151 | Ga0495642_0009568 | |||
| 1152 | Ga0495654_0000085 | |||
| 1153 | Ga0495597_0004297 | |||
| 1154 | Ga0495597_0153548 | |||
| 1155 | Ga0495622_0001106 | |||
| 1156 | Ga0495622_0046688 | |||
| 1157 | Ga0495633_0119645 | |||
| 1158 | Ga0495668_0000019 | |||
| 1159 | Ga0495668_0013101 | |||
| 1160 | Ga0495668_0015148 | |||
| 1161 | Ga0495668_0033164 | |||
| 1162 | Ga0495668_0047397 | |||
| 1163 | Ga0495668_0151236 | |||
| 1164 | Ga0495668_0186134 | |||
| 1165 | Ga0495611_0108508 | |||
| 1166 | Ga0495625_0000255 | |||
| 1167 | Ga0495625_0000408 | |||
| 1168 | Ga0495625_0000505 | |||
| 1169 | Ga0495625_0012001 | |||
| 1170 | Ga0495625_0100011 | |||
| 1171 | Ga0495625_0112556 | |||
| 1172 | Ga0495625_0333652 | |||
| 1173 | Ga0495661_0048224 | |||
| 1174 | Ga0495669_0000147 | |||
| 1175 | Ga0495669_0011897 | |||
| 1176 | Ga0495669_0131824 | |||
| 1177 | Ga0495624_0215730 | |||
| 1178 | Ga0495670_0041176 | |||
| 1179 | Ga0495589_0000845 | |||
| 1180 | Ga0495600_0005075 | |||
| 1181 | Ga0495600_0111385 | |||
| 1182 | Ga0495660_0066348 | |||
| 1183 | Ga0495581_0053153 | |||
| 1184 | Ga0495672_0006003 | |||
| 1185 | Ga0495687_047451 | |||
| 1186 | Ga0495679_013732 | |||
| 1187 | Ga0495673_0000056 | |||
| 1188 | Ga0495673_0002738 | |||
| 1189 | Ga0495681_0120656 | |||
| 1190 | Ga0495686_0000293 | |||
| 1191 | Ga0495686_0003429 | |||
| 1192 | Ga0495686_0004600 | |||
| 1193 | Ga0495686_0027692 | |||
| 1194 | Ga0495593_0055835 | |||
| 1195 | Ga0495602_0279389 | |||
| 1196 | Ga0496100_0413705 | |||
| 1197 | Ga0496101_0012799 | |||
| 1198 | Ga0496101_0167967 | |||
| 1199 | Ga0496102_0000640 | |||
| 1200 | Ga0496102_0066468 | |||
| 1201 | Ga0496102_0095292 | |||
| 1202 | Ga0496102_0115112 | |||
| 1203 | Ga0496103_0000197 | |||
| 1204 | Ga0496103_0050779 | |||
| 1205 | Ga0496103_0217965 | |||
| 1206 | Ga0496104_0113320 | |||
| 1207 | Ga0496104_0139363 | |||
| 1208 | Ga0496104_0339146 | |||
| 1209 | Ga0496105_0094859 | |||
| 1210 | Ga0496106_0001585 | |||
| 1211 | Ga0496106_0017910 | |||
| 1212 | Ga0496107_0000132 | |||
| 1213 | Ga0496107_0024670 | |||
| 1214 | Ga0496108_0069521 | |||
| 1215 | Ga0496109_0275791 | |||
| 1216 | Ga0496110_0834664 | |||
| 1217 | Ga0496111_0004034 | |||
| 1218 | Ga0496111_0062633 | |||
| 1219 | Ga0496112_0140291 | |||
| 1220 | Ga0496113_0002148 | |||
| 1221 | Ga0496113_0160786 | |||
| 1222 | Ga0496114_0028745 | |||
| 1223 | Ga0496115_0000166 | |||
| 1224 | Ga0496115_0041744 | |||
| 1225 | Ga0496115_0560892 | |||
| 1226 | Ga0496116_0006381 | |||
| 1227 | Ga0496116_0053528 | |||
| 1228 | Ga0496117_0000467 | |||
| 1229 | Ga0496117_0002744 | |||
| 1230 | Ga0496117_0014560 | |||
| 1231 | Ga0496117_0038318 | |||
| 1232 | Ga0496117_0076485 | |||
| 1233 | Ga0496117_0301204 | |||
| 1234 | Ga0496118_0000310 | |||
| 1235 | Ga0496118_0000459 | |||
| 1236 | Ga0496118_0008784 | |||
| 1237 | Ga0496118_0061500 | |||
| 1238 | Ga0496118_0107468 | |||
| 1239 | Ga0496119_0043930 | |||
| 1240 | Ga0496119_0081527 | |||
| 1241 | Ga0496119_0096747 | |||
| 1242 | Ga0496119_0100417 | |||
| 1243 | Ga0496120_0017447 | |||
| 1244 | Ga0496120_0046822 | |||
| 1245 | Ga0496121_0000152 | |||
| 1246 | Ga0496121_0006484 | |||
| 1247 | Ga0496121_0006787 | |||
| 1248 | Ga0496121_0041140 | |||
| 1249 | Ga0496121_0052912 | |||
| 1250 | Ga0496121_0158609 | |||
| 1251 | Ga0496121_0295707 | |||
| 1252 | Ga0496122_0007934 | |||
| 1253 | Ga0496122_0043899 | |||
| 1254 | Ga0496122_0177352 | |||
| 1255 | Ga0496123_0097524 | |||
| 1256 | Ga0496123_0193839 | |||
| 1257 | Ga0496124_0000121 | |||
| 1258 | Ga0496124_0000499 | |||
| 1259 | Ga0496124_0011941 | |||
| 1260 | Ga0496124_0066695 | |||
| 1261 | Ga0496124_0075869 | |||
| 1262 | Ga0496124_0132604 | |||
| 1263 | Ga0496124_0132697 | |||
| 1264 | Ga0496124_0444729 | |||
| 1265 | Ga0496125_0008331 | |||
| 1266 | Ga0496125_0048089 | |||
| 1267 | Ga0496125_0086293 | |||
| 1268 | Ga0496126_0006453 | |||
| 1269 | Ga0496126_0014348 | |||
| 1270 | Ga0496126_0211850 | |||
| 1271 | Ga0496126_0227488 | |||
| 1272 | Ga0495678_002468 | |||
| 1273 | Ga0501036_0101171 | |||
| 1274 | Ga0501043_0296790 | |||
| 1275 | Ga0501047_0000266 | |||
| 1276 | Ga0501047_0000471 | |||
| 1277 | Ga0501047_0000893 | |||
| 1278 | Ga0501047_0396785 | |||
| 1279 | Ga0501070_0037037 | |||
| 1280 | Ga0501072_0001051 | |||
| 1281 | Ga0501080_0091915 | |||
| 1282 | Ga0501080_0349363 | |||
| 1283 | Ga0501083_0173642 | |||
| 1284 | Ga0501044_0053834 | |||
| 1285 | nmdc:mga03n38_158366_c1 | |||
| 1286 | nmdc:mga00v17_6139_c1 | |||
| 1287 | nmdc:mga0k408_21903_c1 | |||
| 1288 | nmdc:mga0k408_73870_c1 | |||
| 1289 | nmdc:mga0k408_87260_c1 | |||
| 1290 | nmdc:mga07m45_25958_c1 | |||
| 1291 | nmdc:mga07m45_46050_c1 | |||
| 1292 | nmdc:mga05p37_5458_c1 | |||
| 1293 | nmdc:mga08y16_111549_c1 | |||
| 1294 | nmdc:mga0rr50_82781_c1 | |||
| 1295 | nmdc:mga0a205_5883_c1 | |||
| 1296 | nmdc:mga0sz30_5449_c1 | |||
| 1297 | Ga0500635_0000208 | |||
| 1298 | Ga0500578_0000124 | |||
| 1299 | Ga0500643_005104 | |||
| 1300 | Ga0500643_023865 | |||
| 1301 | Ga0500643_049116 | |||
| 1302 | Ga0500644_0003731 | |||
| 1303 | Ga0500647_0063478 | |||
| 1304 | Ga0500651_0176347 | |||
| 1305 | Ga0500566_0033160 | |||
| 1306 | Ga0500641_0000924 | |||
| 1307 | Ga0500556_0101808 | |||
| 1308 | Ga0500562_000453 | |||
| 1309 | Ga0500562_000907 | |||
| 1310 | Ga0500569_000410 | |||
| 1311 | Ga0500592_015687 | |||
| 1312 | Ga0500594_0000184 | |||
| 1313 | Ga0500595_001453 | |||
| 1314 | Ga0500595_004634 | |||
| 1315 | Ga0500595_018235 | |||
| 1316 | Ga0500595_050724 | |||
| 1317 | Ga0500608_000004 | |||
| 1318 | Ga0500608_054398 | |||
| 1319 | Ga0500618_000022 | |||
| 1320 | Ga0500642_0091905 | |||
| 1321 | Ga0500642_0185545 | |||
| 1322 | Ga0500655_017611 | |||
| 1323 | Ga0500658_0010960 | |||
| 1324 | Ga0500559_0002236 | |||
| 1325 | Ga0500559_0004502 | |||
| 1326 | Ga0500559_0005625 | |||
| 1327 | Ga0500564_053379 | |||
| 1328 | Ga0500604_0034821 | |||
| 1329 | Ga0500616_0005230 | |||
| 1330 | Ga0500619_002204 | |||
| 1331 | Ga0500622_0002350 | |||
| 1332 | Ga0500622_0020115 | |||
| 1333 | Ga0500622_0203062 | |||
| 1334 | Ga0500627_0102408 | |||
| 1335 | Ga0500627_0190553 | |||
| 1336 | Ga0500636_0006613 | |||
| 1337 | Ga0500637_0000774 | |||
| 1338 | Ga0500637_0109424 | |||
| 1339 | Ga0500576_039266 | |||
| 1340 | Ga0500645_001242 | |||
| 1341 | Ga0500645_002350 | |||
| 1342 | Ga0500645_005215 | |||
| 1343 | Ga0500645_018801 | |||
| 1344 | Ga0500645_049253 | |||
| 1345 | Ga0500609_000278 | |||
| 1346 | Ga0500552_000084 | |||
| 1347 | Ga0500596_005428 | |||
| 1348 | Ga0500601_003505 | |||
| 1349 | Ga0501084_0044996 | |||
| 1350 | Ga0501082_0287939 | |||
| 1351 | 2511125608 | |||
| 1352 | 2585147804 | |||
| 1353 | 2585151448 | |||
| 1354 | 2585196162 | |||
| 1355 | 2587917379 | |||
| 1356 | 2600202623 | |||
| 1357 | 2643750132 | |||
| 1358 | 2643779000 | |||
| 1359 | 2643782267 | |||
| 1360 | 2643822937 | |||
| 1361 | 2643926037 | |||
| 1362 | 2643928944 | |||
| 1363 | 2644001631 | |||
| 1364 | 2644227100 | |||
| 1365 | 2644233432 | |||
| 1366 | 2644507021 | |||
| 1367 | 2753764418 | |||
| 1368 | 2819536960 | |||
| 1369 | 2819645372 | |||
| 1370 | 2857507815 | |||
| 1371 | 2884964854 | |||
| 1372 | 2928533402 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wje-assembly1.cif.gz_A | crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana | 0.8046 | 28 | 204 |
| 2a13-assembly1.cif.gz_A | x-ray structure of protein from arabidopsis thaliana at1g79260 | 0.779 | 28 | 204 |
| 7bbm-assembly1.cif.gz_A-2 | mutant nitrobindin m75l/h76l/q96c/m148l (nb4h) from arabidopsis thaliana with cofactor mnppix | 0.7786 | 28 | 204 |
| 3ia8-assembly1.cif.gz_A | the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens | 0.7722 | 17 | 204 |
| 3wje-assembly1.cif.gz_A | crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana | 0.771 | 28 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q22857_66_227_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.8157 | 28 | 204 | 2.40.128.20 |
| 3wjeB00 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.8124 | 28 | 204 | 2.40.128.20 |
| af_Q18793_24_191_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.8107 | 30 | 204 | 2.40.128.20 |
| af_Q556I7_1_158_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7967 | 27 | 204 | 2.40.128.20 |
| af_Q556I7_1_158_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.783 | 27 | 204 | 2.40.128.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8DVE9-F1-model_v4 | DUF1794 domain-containing protein | 0.9915 | 7 | 220 |
|
| AF-A0A1I5HHA4-F1-model_v4 | THAP4-like heme-binding beta-barrel domain-containing protein | 0.9907 | 8 | 222 |
|
| AF-A0A4R4DUM3-F1-model_v4 | DUF1794 domain-containing protein | 0.9907 | 11 | 211 |
|
| AF-Q98LK1-F1-model_v4 | Mll0991 protein | 0.9903 | 7 | 220 |
|
| AF-A0A0C5X2Z6-F1-model_v4 | THAP4-like heme-binding beta-barrel domain-containing protein | 0.9899 | 7 | 223 |
|