F475229

General Info

Members Datasets Scaffolds Average Seq Length
687 419 482 53

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10005850|JGI25153J46596_100058503
Length 54
Sequence MRLLRSFLADENAATAIEYGLIAAGIALAIVTIVNSTGGALLNNKFNSIDAATK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
12 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
13 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
14 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
15 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
16 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
17 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
18 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
19 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
20 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
21 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
22 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
23 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
24 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
25 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
26 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
27 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
28 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
29 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
30 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
31 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
32 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
33 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
34 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
35 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
36 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
37 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
38 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
39 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
40 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
41 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
42 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
43 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
44 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
45 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
46 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
47 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
48 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
49 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
50 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
51 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
52 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
53 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
54 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
55 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
56 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
57 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
58 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
59 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
60 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
61 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
62 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
63 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
64 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
65 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
66 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
67 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
68 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
69 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
70 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
71 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
72 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
73 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
74 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
75 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
76 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
77 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
78 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
79 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
80 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
81 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
82 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
83 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
84 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
85 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
86 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
87 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
88 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
89 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
90 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
91 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
92 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
93 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
94 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
95 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
96 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
97 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
98 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
99 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
100 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
101 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
102 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
103 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
104 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
105 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
106 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
107 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
108 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
109 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
110 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
111 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
112 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
114 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
115 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
116 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
117 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
118 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
119 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
120 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
121 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
122 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
123 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
124 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
125 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
126 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
127 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
128 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
129 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
130 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
131 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
132 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
133 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
134 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
135 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
136 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
137 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
138 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
139 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
140 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
141 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
142 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
143 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
144 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
145 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
146 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
147 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
148 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
149 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
150 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
151 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
152 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
153 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
154 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
155 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
156 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
159 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
160 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
161 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
162 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
163 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
164 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
165 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
166 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
167 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
168 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
169 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
170 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
171 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
172 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
173 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
174 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
175 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
176 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
177 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
178 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
179 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
180 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
181 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
182 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
183 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
184 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
185 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
187 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
189 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
190 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
191 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
192 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
193 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
194 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
195 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
196 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
197 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
198 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
199 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
200 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
203 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
204 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
205 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
206 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
207 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
208 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
209 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
210 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
211 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
212 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
213 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
214 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
215 3300022729 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 Metagenome Unclassified
216 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
217 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
218 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
220 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
222 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
270 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
271 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
272 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
277 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
278 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
279 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
280 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
281 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
282 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
283 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
284 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
285 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
286 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
287 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
288 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
289 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
290 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
291 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
292 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
293 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
294 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
295 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
296 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
298 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
299 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
300 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
306 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
310 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
311 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
312 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
313 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
314 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
315 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
316 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
317 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
318 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
319 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
320 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
321 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
324 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
325 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
326 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
327 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
328 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
329 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
330 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
331 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
332 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
338 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
350 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
351 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
376 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
377 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
378 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
383 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
387 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
388 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
389 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
390 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
393 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
395 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
396 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
397 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
398 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
399 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
400 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
401 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
402 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
403 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
404 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
405 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
406 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
407 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
408 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
409 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
410 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
411 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
412 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
413 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
414 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
415 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
416 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
417 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
418 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
419 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.97
Metatranscriptomes 0.29
Isolates 29.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.59
Nodule 20.82
Rhizoplane 2.91
Rhizosphere 53.13
Stem 0
Stem Tuber 0
Unclassified 14.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1030079 3300001904 Bacteria 840
2 JGI24737J22298_10215399 3300001990 Bacteria 567
3 JGI24735J21928_10064167 3300002067 Bacteria 1054
4 JGI24735J21928_10066827 3300002067 Bacteria 1031
5 JGI24033J26618_1065262 3300002155 Bacteria 541
6 JGI25406J46586_10000012 3300003203 Bacteria 102438
7 JGI25406J46586_10001492 3300003203 Bacteria 11045
8 JGI25406J46586_10118246 3300003203 Bacteria 781
9 JGI25153J46596_10000453 3300003215 Bacteria 26261
10 JGI25153J46596_10005850 3300003215 Bacteria 6374
11 rootH2_10123764 3300003320 Bacteria 1634
12 rootH1_10154882 3300003323 Bacteria 1273
13 Ga0055526_1026485 3300003771 Bacteria 1825
14 Ga0055524_1038196 3300003775 Bacteria 1260
15 Ga0055524_1048024 3300003775 Bacteria 1000
16 Ga0055531_10003002 3300003794 Bacteria 10954
17 Ga0055531_10023085 3300003794 Bacteria 2346
18 Ga0065165_1006344 3300005262 Bacteria 6242
19 Ga0065165_1007785 3300005262 Bacteria 5169
20 Ga0065165_1070233 3300005262 Bacteria 933
21 Ga0070658_10019362 3300005327 Bacteria 5451
22 Ga0070658_10230353 3300005327 Bacteria 1568
23 Ga0070658_10431512 3300005327 Bacteria 1134
24 Ga0070676_10520815 3300005328 Bacteria 847
25 Ga0070683_100005616 3300005329 Bacteria 10482
26 Ga0070683_101043574 3300005329 Bacteria 785
27 Ga0070690_101006546 3300005330 Bacteria 657
28 Ga0070670_100083921 3300005331 Bacteria 2737
29 Ga0070677_10214699 3300005333 Bacteria 936
30 Ga0070666_10611424 3300005335 Bacteria 796
31 Ga0070680_100097139 3300005336 Bacteria 2442
32 Ga0070680_100264096 3300005336 Bacteria 1457
33 Ga0070682_100529849 3300005337 Bacteria 918
34 Ga0070660_100161002 3300005339 Bacteria 1808
35 Ga0070660_100491310 3300005339 Bacteria 1021
36 Ga0070660_100924642 3300005339 Bacteria 736
37 Ga0070691_10439384 3300005341 Bacteria 743
38 Ga0070661_100065660 3300005344 Bacteria 2666
39 Ga0070661_101067822 3300005344 Bacteria 672
40 Ga0070692_10433025 3300005345 Bacteria 838
41 Ga0070669_101117654 3300005353 Bacteria 679
42 Ga0070675_100215875 3300005354 Bacteria 1669
43 Ga0070675_101410291 3300005354 Bacteria 642
44 Ga0070671_101730010 3300005355 Bacteria 555
45 Ga0070674_100691559 3300005356 Bacteria 871
46 Ga0070673_100057683 3300005364 Bacteria 3068
47 Ga0070673_100286293 3300005364 Bacteria 1447
48 Ga0070659_100392966 3300005366 Bacteria 1170
49 Ga0070659_100415159 3300005366 Bacteria 1138
50 Ga0070667_100152210 3300005367 Bacteria 2032
51 Ga0070709_10237946 3300005434 Bacteria 1306
52 Ga0070709_10283631 3300005434 Bacteria 1204
53 Ga0070714_100133409 3300005435 Bacteria 2221
54 Ga0070714_100353386 3300005435 Bacteria 1381
55 Ga0070714_100580984 3300005435 Bacteria 1075
56 Ga0070713_100017348 3300005436 Bacteria 5442
57 Ga0070713_100083086 3300005436 Bacteria 2737
58 Ga0070713_100138576 3300005436 Bacteria 2153
59 Ga0070713_100447587 3300005436 Bacteria 1213
60 Ga0070713_100911575 3300005436 Bacteria 846
61 Ga0070713_101111320 3300005436 Bacteria 764
62 Ga0070710_11329729 3300005437 Bacteria 535
63 Ga0070711_100554319 3300005439 Bacteria 954
64 Ga0070708_101593518 3300005445 Bacteria 608
65 Ga0070663_100327493 3300005455 Bacteria 1234
66 Ga0070663_100714504 3300005455 Bacteria 853
67 Ga0070663_100768806 3300005455 Bacteria 824
68 Ga0070663_102018590 3300005455 Bacteria 519
69 Ga0070662_100559373 3300005457 Bacteria 959
70 Ga0070681_10017592 3300005458 Bacteria 7143
71 Ga0070681_10318213 3300005458 Bacteria 1465
72 Ga0070681_10519587 3300005458 Bacteria 1104
73 Ga0068867_100883767 3300005459 Bacteria 803
74 Ga0070698_100478590 3300005471 Bacteria 1182
75 Ga0070679_100062309 3300005530 Bacteria 3718
76 Ga0070679_100484901 3300005530 Bacteria 1180
77 Ga0070684_100023098 3300005535 Bacteria 5194
78 Ga0070697_100140408 3300005536 Bacteria 2031
79 Ga0070697_100848342 3300005536 Bacteria 809
80 Ga0068853_100074050 3300005539 Bacteria 2971
81 Ga0068853_100218501 3300005539 Bacteria 1740
82 Ga0070672_100923058 3300005543 Bacteria 772
83 Ga0070672_100988899 3300005543 Bacteria 745
84 Ga0070693_100174018 3300005547 Bacteria 1381
85 Ga0070693_100584715 3300005547 Bacteria 804
86 Ga0070693_101411763 3300005547 Bacteria 542
87 Ga0070665_102029195 3300005548 Bacteria 580
88 Ga0068855_100042130 3300005563 Bacteria 5410
89 Ga0068855_100091543 3300005563 Bacteria 3508
90 Ga0068855_100697608 3300005563 Bacteria 1086
91 Ga0068855_102092934 3300005563 Bacteria 570
92 Ga0070664_100140429 3300005564 Bacteria 2127
93 Ga0070664_100430070 3300005564 Bacteria 1210
94 Ga0070664_101190127 3300005564 Bacteria 719
95 Ga0070664_102063726 3300005564 Bacteria 541
96 Ga0068857_100008314 3300005577 Bacteria 8968
97 Ga0068854_100073898 3300005578 Bacteria 2500
98 Ga0068854_101396445 3300005578 Bacteria 633
99 Ga0068856_100093682 3300005614 Bacteria 2989
100 Ga0068856_100260950 3300005614 Bacteria 1748
101 Ga0068856_100827960 3300005614 Bacteria 945
102 Ga0068856_102140325 3300005614 Bacteria 569
103 Ga0068852_100114322 3300005616 Bacteria 2459
104 Ga0068852_100338220 3300005616 Bacteria 1466
105 Ga0068852_100413853 3300005616 Bacteria 1329
106 Ga0068852_100633593 3300005616 Bacteria 1075
107 Ga0068859_101107794 3300005617 Bacteria 871
108 Ga0068861_100649892 3300005719 Bacteria 974
109 Ga0068851_10007628 3300005834 Bacteria 4975
110 Ga0068860_100577804 3300005843 Bacteria 1128
111 Ga0081540_1307989 3300005983 Bacteria 544
112 Ga0081539_10000040 3300005985 Bacteria 292753
113 Ga0081539_10000250 3300005985 Bacteria 125352
114 Ga0081539_10048041 3300005985 Bacteria 2431
115 Ga0070717_10000355 3300006028 Bacteria 29408
116 Ga0070717_10012461 3300006028 Bacteria 6485
117 Ga0070717_10046462 3300006028 Bacteria 3552
118 Ga0070717_10078841 3300006028 Bacteria 2761
119 Ga0070717_10345799 3300006028 Bacteria 1329
120 Ga0070717_10347901 3300006028 Bacteria 1325
121 Ga0075365_10052962 3300006038 Bacteria 2686
122 Ga0075365_10131145 3300006038 Bacteria 1735
123 Ga0075365_10900513 3300006038 Bacteria 624
124 Ga0075363_100033304 3300006048 Bacteria 2682
125 Ga0075364_10007861 3300006051 Bacteria 6347
126 Ga0075364_10031107 3300006051 Bacteria 3429
127 Ga0075364_10851317 3300006051 Bacteria 621
128 Ga0070715_10085512 3300006163 Bacteria 1441
129 Ga0070716_100323897 3300006173 Bacteria 1081
130 Ga0070716_101787873 3300006173 Bacteria 509
131 Ga0070712_100366486 3300006175 Bacteria 1183
132 Ga0070712_100718546 3300006175 Bacteria 853
133 Ga0070712_101716096 3300006175 Bacteria 550
134 Ga0075362_10453395 3300006177 Bacteria 652
135 Ga0075367_10071534 3300006178 Bacteria 2086
136 Ga0075369_10002297 3300006186 Bacteria 6796
137 Ga0075369_10035863 3300006186 Bacteria 2109
138 Ga0075369_10045900 3300006186 Bacteria 1880
139 Ga0075370_10348564 3300006353 Bacteria 884
140 Ga0068871_101231941 3300006358 Unclassified 702
141 Ga0075434_100179857 3300006871 Bacteria 2135
142 Ga0075434_100579343 3300006871 Bacteria 1141
143 Ga0097620_101107866 3300006931 Bacteria 871
144 Ga0099794_10036362 3300007265 Bacteria 2327
145 Ga0099795_10049461 3300007788 Bacteria 1526
146 Ga0099795_10386968 3300007788 Bacteria 633
147 Ga0099795_10578501 3300007788 Bacteria 532
148 Ga0105240_10004694 3300009093 Bacteria 20654
149 Ga0105240_10014338 3300009093 Bacteria 10824
150 Ga0105240_10084297 3300009093 Bacteria 3897
151 Ga0105240_10492881 3300009093 Bacteria 1364
152 Ga0105240_10756968 3300009093 Bacteria 1056
153 Ga0105240_11357128 3300009093 Bacteria 748
154 Ga0111539_12132211 3300009094 Bacteria 650
155 Ga0105245_10375755 3300009098 Bacteria 1414
156 Ga0105245_12516233 3300009098 Bacteria 568
157 Ga0114129_12984967 3300009147 Bacteria 557
158 Ga0105243_10480226 3300009148 Bacteria 1173
159 Ga0105243_10946623 3300009148 Bacteria 860
160 Ga0105241_10093623 3300009174 Bacteria 2375
161 Ga0105241_10894490 3300009174 Bacteria 824
162 Ga0105241_11906604 3300009174 Bacteria 583
163 Ga0105242_10218695 3300009176 Bacteria 1701
164 Ga0105242_10449777 3300009176 Bacteria 1214
165 Ga0105242_12811762 3300009176 Bacteria 537
166 Ga0105248_10049430 3300009177 Bacteria 4717
167 Ga0105237_10030752 3300009545 Bacteria 5450
168 Ga0105237_10048491 3300009545 Bacteria 4270
169 Ga0105237_10231071 3300009545 Bacteria 1851
170 Ga0105237_10235957 3300009545 Bacteria 1830
171 Ga0105237_11583211 3300009545 Bacteria 662
172 Ga0105238_10007397 3300009551 Bacteria 11003
173 Ga0105238_10023868 3300009551 Bacteria 6233
174 Ga0105238_10215451 3300009551 Bacteria 1897
175 Ga0105238_10606305 3300009551 Bacteria 1103
176 Ga0105249_10166729 3300009553 Bacteria 2133
177 Ga0105249_11301134 3300009553 Bacteria 798
178 Ga0099796_10042515 3300010159 Bacteria 1544
179 Ga0099796_10146099 3300010159 Bacteria 928
180 Ga0105239_10018859 3300010375 Bacteria 7622
181 Ga0105239_10238970 3300010375 Bacteria 2039
182 Ga0105246_10058087 3300011119 Bacteria 2679
183 Ga0105246_10415609 3300011119 Bacteria 1121
184 Ga0157318_1038894 3300012482 Bacteria 500
185 Ga0157373_10758972 3300013100 Bacteria 713
186 Ga0157370_10064213 3300013104 Bacteria 3476
187 Ga0157369_10072277 3300013105 Bacteria 3702
188 Ga0157369_10512265 3300013105 Bacteria 1241
189 Ga0157369_11342317 3300013105 Bacteria 728
190 Ga0157374_10515844 3300013296 Bacteria 1201
191 Ga0157374_11822376 3300013296 Bacteria 634
192 Ga0157374_12888311 3300013296 Bacteria 508
193 Ga0157378_10290428 3300013297 Bacteria 1579
194 Ga0157378_11002433 3300013297 Bacteria 869
195 Ga0157378_11229727 3300013297 Bacteria 789
196 Ga0163162_10907408 3300013306 Bacteria 994
197 Ga0163162_13081175 3300013306 Bacteria 535
198 Ga0157372_10412520 3300013307 Bacteria 1574
199 Ga0157372_11812983 3300013307 Bacteria 702
200 Ga0157375_10437390 3300013308 Bacteria 1474
201 Ga0157375_11228492 3300013308 Bacteria 880
202 Ga0157375_12684788 3300013308 Bacteria 595
203 Ga0163163_10693498 3300014325 Bacteria 1082
204 Ga0182008_10718014 3300014497 Bacteria 572
205 Ga0157379_11017902 3300014968 Bacteria 790
206 Ga0163161_10305982 3300017792 Bacteria 1253
207 Ga0206353_11182322 3300020082 Bacteria 1077
208 Ga0213876_10173952 3300021384 Bacteria 1146
209 Ga0228599_109105 3300022729 Bacteria 530
210 Ga0224572_1024785 3300024225 Bacteria 1152
211 Ga0207425_1011029 3300025245 Bacteria 2176
212 Ga0207425_1026204 3300025245 Bacteria 1198
213 Ga0209564_1008984 3300025295 Bacteria 4833
214 Ga0209564_1015801 3300025295 Bacteria 3049
215 Ga0209564_1027871 3300025295 Bacteria 1822
216 Ga0209758_1000011 3300025297 Bacteria 1049685
217 Ga0209758_1000021 3300025297 Bacteria 697691
218 Ga0209758_1000209 3300025297 Bacteria 128038
219 Ga0209256_1002188 3300025299 Bacteria 16757
220 Ga0209256_1003782 3300025299 Bacteria 10194
221 Ga0209256_1094889 3300025299 Bacteria 628
222 Ga0207426_1004534 3300025302 Bacteria 6721
223 Ga0207426_1018923 3300025302 Bacteria 2417
224 Ga0207426_1070356 3300025302 Bacteria 978
225 Ga0209257_1000620 3300025304 Bacteria 57327
226 Ga0209257_1001645 3300025304 Bacteria 25504
227 Ga0207697_10028208 3300025315 Bacteria 2296
228 Ga0207656_10004840 3300025321 Bacteria 4729
229 Ga0207688_11074974 3300025901 Bacteria 508
230 Ga0207680_10590998 3300025903 Bacteria 794
231 Ga0207647_10024774 3300025904 Bacteria 3953
232 Ga0207647_10510502 3300025904 Bacteria 669
233 Ga0207647_10638556 3300025904 Bacteria 585
234 Ga0207685_10209634 3300025905 Bacteria 920
235 Ga0207699_10242404 3300025906 Bacteria 1239
236 Ga0207643_11104940 3300025908 Bacteria 511
237 Ga0207705_10033639 3300025909 Bacteria 3663
238 Ga0207705_10046081 3300025909 Bacteria 3133
239 Ga0207705_10884677 3300025909 Unclassified 692
240 Ga0207707_10000706 3300025912 Bacteria 33199
241 Ga0207707_10113336 3300025912 Bacteria 2370
242 Ga0207707_10676321 3300025912 Bacteria 868
243 Ga0207707_10720220 3300025912 Bacteria 836
244 Ga0207695_10096049 3300025913 Bacteria 2966
245 Ga0207695_10100277 3300025913 Bacteria 2892
246 Ga0207695_10558583 3300025913 Bacteria 1026
247 Ga0207671_10019453 3300025914 Bacteria 5190
248 Ga0207671_10085932 3300025914 Bacteria 2364
249 Ga0207671_10398364 3300025914 Bacteria 1095
250 Ga0207671_10992075 3300025914 Bacteria 662
251 Ga0207693_10299821 3300025915 Bacteria 1259
252 Ga0207693_10609962 3300025915 Bacteria 849
253 Ga0207663_10542876 3300025916 Bacteria 908
254 Ga0207660_10012021 3300025917 Bacteria 5655
255 Ga0207660_10314918 3300025917 Bacteria 1248
256 Ga0207660_10663157 3300025917 Bacteria 851
257 Ga0207657_10004672 3300025919 Bacteria 14460
258 Ga0207657_10673933 3300025919 Bacteria 804
259 Ga0207649_11400722 3300025920 Bacteria 553
260 Ga0207652_10001458 3300025921 Bacteria 20929
261 Ga0207652_10652805 3300025921 Bacteria 941
262 Ga0207681_10594033 3300025923 Bacteria 914
263 Ga0207681_11011066 3300025923 Bacteria 698
264 Ga0207694_10009977 3300025924 Bacteria 7159
265 Ga0207694_10143082 3300025924 Bacteria 1924
266 Ga0207694_10461679 3300025924 Bacteria 1061
267 Ga0207650_10334423 3300025925 Bacteria 1243
268 Ga0207659_10274629 3300025926 Bacteria 1376
269 Ga0207700_10004801 3300025928 Bacteria 8020
270 Ga0207700_10236735 3300025928 Bacteria 1555
271 Ga0207700_10360259 3300025928 Bacteria 1268
272 Ga0207664_10174682 3300025929 Bacteria 1841
273 Ga0207664_10355352 3300025929 Bacteria 1297
274 Ga0207644_11643067 3300025931 Bacteria 539
275 Ga0207690_10292599 3300025932 Bacteria 1272
276 Ga0207690_10318288 3300025932 Bacteria 1222
277 Ga0207706_10149265 3300025933 Bacteria 2056
278 Ga0207704_11933135 3300025938 Bacteria 507
279 Ga0207691_10411954 3300025940 Bacteria 1152
280 Ga0207691_11621650 3300025940 Bacteria 526
281 Ga0207711_10239515 3300025941 Bacteria 1663
282 Ga0207661_10055049 3300025944 Bacteria 3189
283 Ga0207679_11304427 3300025945 Bacteria 666
284 Ga0207679_12157524 3300025945 Bacteria 506
285 Ga0207667_10006413 3300025949 Bacteria 14251
286 Ga0207667_10605435 3300025949 Bacteria 1105
287 Ga0207667_12252186 3300025949 Bacteria 501
288 Ga0207651_10215394 3300025960 Bacteria 1549
289 Ga0207651_10700957 3300025960 Bacteria 892
290 Ga0207712_10813815 3300025961 Bacteria 822
291 Ga0207668_12042859 3300025972 Bacteria 516
292 Ga0207640_10228810 3300025981 Bacteria 1429
293 Ga0207640_10708628 3300025981 Bacteria 864
294 Ga0207640_10830019 3300025981 Bacteria 803
295 Ga0207640_11688245 3300025981 Bacteria 572
296 Ga0207658_10116748 3300025986 Bacteria 2120
297 Ga0207677_10427979 3300026023 Bacteria 1129
298 Ga0207639_10176988 3300026041 Bacteria 1811
299 Ga0207639_10468728 3300026041 Bacteria 1146
300 Ga0207639_12062591 3300026041 Bacteria 531
301 Ga0207678_10073518 3300026067 Bacteria 2930
302 Ga0207678_10552613 3300026067 Bacteria 1007
303 Ga0207678_10654004 3300026067 Bacteria 923
304 Ga0207678_10658684 3300026067 Bacteria 920
305 Ga0207678_11151668 3300026067 Unclassified 687
306 Ga0207678_11789197 3300026067 Bacteria 538
307 Ga0207702_10224002 3300026078 Bacteria 1754
308 Ga0207702_12055886 3300026078 Bacteria 561
309 Ga0207674_10025123 3300026116 Bacteria 6357
310 Ga0207674_10089393 3300026116 Bacteria 3073
311 Ga0207675_101331309 3300026118 Bacteria 739
312 Ga0207683_10387368 3300026121 Bacteria 1285
313 Ga0207698_10028257 3300026142 Bacteria 3997
314 Ga0207698_11093214 3300026142 Bacteria 810
315 Ga0207698_12141644 3300026142 Bacteria 572
316 Ga0209389_1000412 3300027296 Bacteria 25422
317 Ga0209589_1004063 3300027357 Bacteria 25422
318 Ga0209489_100090 3300027361 Bacteria 123931
319 Ga0209588_1079520 3300027671 Bacteria 1059
320 Ga0209813_10174571 3300027866 Bacteria 783
321 Ga0268266_12229898 3300028379 Bacteria 519
322 Ga0268264_10210877 3300028381 Bacteria 1783
323 Ga0268264_12086081 3300028381 Bacteria 576
324 Ga0265334_10156826 3300028573 Bacteria 801
325 Ga0307515_10145873 3300028794 Bacteria 2507
326 Ga0265330_10008738 3300031235 Bacteria 4856
327 Ga0265330_10048506 3300031235 Bacteria 1867
328 Ga0265330_10156047 3300031235 Bacteria 969
329 Ga0265332_10043894 3300031238 Bacteria 1929
330 Ga0265328_10053588 3300031239 Bacteria 1480
331 Ga0265325_10047163 3300031241 Bacteria 2231
332 Ga0265340_10109609 3300031247 Bacteria 1277
333 Ga0265339_10075924 3300031249 Bacteria 1783
334 Ga0265339_10404020 3300031249 Bacteria 638
335 Ga0265339_10503851 3300031249 Bacteria 559
336 Ga0265331_10121242 3300031250 Bacteria 1196
337 Ga0265316_10550171 3300031344 Bacteria 821
338 Ga0265316_10962008 3300031344 Bacteria 595
339 Ga0307509_10367591 3300031507 Bacteria 1156
340 Ga0265313_10027902 3300031595 Bacteria 2947
341 Ga0307508_10009028 3300031616 Bacteria 9185
342 Ga0265314_10720745 3300031711 Bacteria 503
343 Ga0265342_10052401 3300031712 Bacteria 2432
344 Ga0265342_10061317 3300031712 Bacteria 2216
345 Ga0265342_10087530 3300031712 Bacteria 1790
346 Ga0307516_10143486 3300031730 Bacteria 2155
347 Ga0316044_120212 3300031810 Bacteria 692
348 Ga0316215_1004213 3300033544 Bacteria 1376
349 Ga0316213_1006616 3300033546 Bacteria 775
350 Ga0373934_0002445 3300035086 Bacteria 6829
351 Ga0373923_0000271 3300035111 Bacteria 11341
352 Ga0373953_0000155 3300035117 Bacteria 17696
353 Ga0373954_0000450 3300035118 Bacteria 15397
354 Ga0373956_0354398 3300035119 Bacteria 699
355 Ga0373957_0000533 3300035120 Bacteria 9602
356 Ga0373955_0001317 3300035172 Bacteria 10523
357 Ga0373924_0002189 3300035410 Bacteria 6547
358 Ga0373933_0010648 3300035724 Bacteria 5043
359 Ga0373937_0008674 3300036401 Bacteria 8833
360 Ga0373937_0060546 3300036401 Bacteria 3479
361 Ga0395900_0152094 3300037418 Bacteria 2364
362 Ga0395898_0072855 3300037466 Bacteria 3318
363 Ga0395901_0442780 3300038443 Bacteria 1330
364 Ga0436365_0429661 3300039437 Bacteria 1269
365 Ga0436365_0606176 3300039437 Bacteria 1694
366 Ga0436365_1199722 3300039437 Bacteria 646
367 Ga0436363_0478130 3300039450 Bacteria 669
368 Ga0436363_0537045 3300039450 Bacteria 617
369 Ga0451807_2513845 3300041486 Bacteria 611
370 Ga0451837_1823684 3300041494 Bacteria 1044
371 Ga0451849_0768268 3300041505 Bacteria 514
372 Ga0451843_0195165 3300041509 Bacteria 687
373 Ga0451855_1969055 3300041511 Bacteria 564
374 Ga0439448_0318543 3300042005 Bacteria 553
375 Ga0439455_0226718 3300042012 Bacteria 544
376 Ga0439464_0291602 3300042439 Bacteria 532
377 Ga0466972_0012408 3300044658 Bacteria 4281
378 Ga0466972_0213342 3300044658 Bacteria 903
379 Ga0466968_0009585 3300044735 Bacteria 3728
380 Ga0466960_0038044 3300044901 Bacteria 2260
381 Ga0466960_0620221 3300044901 Bacteria 643
382 Ga0495592_0008383 3300046454 Bacteria 7751
383 Ga0495629_0000816 3300046459 Bacteria 25236
384 Ga0495651_0004762 3300046462 Bacteria 10383
385 Ga0495653_0013624 3300046463 Bacteria 6626
386 Ga0495662_0340839 3300046476 Bacteria 737
387 Ga0495606_0007723 3300046507 Bacteria 9526
388 Ga0495608_0002302 3300046511 Bacteria 13786
389 Ga0495618_0144227 3300046514 Bacteria 1523
390 Ga0495628_0041829 3300046516 Bacteria 3657
391 Ga0495631_0166715 3300046518 Bacteria 945
392 Ga0495648_0001509 3300046524 Bacteria 22791
393 Ga0495652_0004898 3300046529 Bacteria 12707
394 Ga0495640_0003100 3300046533 Bacteria 13411
395 Ga0495587_0002199 3300046536 Bacteria 13040
396 Ga0495587_0159307 3300046536 Bacteria 1285
397 Ga0495587_0182439 3300046536 Bacteria 1190
398 Ga0495597_0122749 3300046542 Bacteria 1082
399 Ga0495645_0012964 3300046543 Bacteria 5883
400 Ga0495667_0000496 3300046559 Bacteria 25130
401 Ga0495668_0023647 3300046616 Bacteria 3502
402 Ga0495634_0024070 3300046642 Bacteria 4276
403 Ga0495635_0000962 3300046663 Bacteria 19021
404 Ga0495657_0013532 3300046675 Bacteria 6015
405 Ga0495657_0867065 3300046675 Bacteria 514
406 Ga0495599_0004531 3300046678 Bacteria 8239
407 Ga0495623_0004417 3300046679 Bacteria 9241
408 Ga0495623_0470858 3300046679 Bacteria 666
409 Ga0495613_0100570 3300046689 Bacteria 2088
410 Ga0495600_0023717 3300046809 Bacteria 3947
411 Ga0495600_0024832 3300046809 Bacteria 3858
412 Ga0495604_0002548 3300047317 Bacteria 14556
413 Ga0495674_0040029 3300047319 Bacteria 4196
414 Ga0495680_0004880 3300047322 Bacteria 12700
415 Ga0495687_010132 3300047443 Bacteria 5193
416 Ga0495675_0001715 3300047444 Bacteria 13111
417 Ga0495675_0365258 3300047444 Bacteria 847
418 Ga0495684_0000695 3300047471 Bacteria 27007
419 Ga0495593_0001764 3300047673 Bacteria 12813
420 Ga0495602_0005179 3300048088 Bacteria 13659
421 Ga0495602_0392303 3300048088 Bacteria 992
422 Ga0496102_0154285 3300048905 Bacteria 2158
423 Ga0496102_1271943 3300048905 Bacteria 655
424 Ga0496103_0003807 3300048906 Bacteria 9179
425 Ga0496103_0484519 3300048906 Bacteria 792
426 Ga0496104_0174135 3300048907 Bacteria 2062
427 Ga0496106_0515356 3300048909 Bacteria 960
428 Ga0496107_0035717 3300048910 Bacteria 3564
429 Ga0496108_0032425 3300048911 Bacteria 4339
430 Ga0496109_0036560 3300048912 Bacteria 4433
431 Ga0496110_0142828 3300048913 Bacteria 2164
432 Ga0496110_1053294 3300048913 Bacteria 721
433 Ga0496111_0240247 3300048914 Bacteria 1345
434 Ga0496111_0566498 3300048914 Bacteria 833
435 Ga0496112_0000029 3300048915 Bacteria 122291
436 Ga0496112_0040806 3300048915 Bacteria 4538
437 Ga0496112_1531303 3300048915 Bacteria 580
438 Ga0496113_0129816 3300048916 Bacteria 1976
439 Ga0496115_0024573 3300048918 Bacteria 4685
440 Ga0496115_0094488 3300048918 Bacteria 2446
441 Ga0496116_0004251 3300048919 Bacteria 13742
442 Ga0496117_0012698 3300048920 Bacteria 7397
443 Ga0496117_0202496 3300048920 Bacteria 1120
444 Ga0496118_0027495 3300048921 Bacteria 4812
445 Ga0496119_0214815 3300048922 Bacteria 987
446 Ga0496121_0100896 3300048924 Bacteria 2227
447 Ga0496123_0086666 3300048926 Bacteria 1877
448 Ga0496124_0058363 3300048927 Bacteria 3246
449 Ga0496124_0135441 3300048927 Bacteria 1951
450 Ga0496124_0358662 3300048927 Bacteria 1028
451 Ga0496125_0001204 3300048928 Bacteria 38897
452 Ga0496125_0015991 3300048928 Bacteria 7225
453 Ga0496125_0048428 3300048928 Bacteria 3544
454 Ga0496126_0029913 3300048929 Bacteria 5169
455 Ga0496126_0148059 3300048929 Bacteria 2014
456 nmdc:mga03683_469450_c1 3300050489 Bacteria 607
457 nmdc:mga00v17_4195_c1 3300050491 Bacteria 6144
458 nmdc:mga0yw44_478371_c1 3300050492 Bacteria 845
459 nmdc:mga0yw44_60293_c1 3300050492 Bacteria 2324
460 nmdc:mga0k408_828135_c1 3300050493 Bacteria 539
461 nmdc:mga07m45_164970_c1 3300050496 Bacteria 1287
462 nmdc:mga0sz30_1155_c1 3300050516 Bacteria 9461
463 nmdc:mga0sz30_232354_c1 3300050516 Bacteria 821
464 Ga0495601_0002394 3300053077 Bacteria 10645
465 Ga0495601_0501526 3300053077 Bacteria 783
466 Ga0495601_0674139 3300053077 Bacteria 661
467 Ga0495612_0007364 3300053078 Bacteria 4498
468 Ga0495655_0071001 3300053083 Bacteria 974
469 Ga0495595_0000887 3300053084 Bacteria 11505
470 Ga0495619_0002038 3300053085 Bacteria 13427
471 Ga0495619_0211024 3300053085 Bacteria 1345
472 Ga0500651_0355522 3300053093 Bacteria 830
473 Ga0500566_0004519 3300053094 Bacteria 8307
474 Ga0500607_131099 3300053121 Bacteria 1195
475 Ga0500608_000229 3300053122 Bacteria 22140
476 Ga0500618_084854 3300053125 Bacteria 711
477 Ga0500559_0000105 3300053136 Bacteria 65809
478 Ga0500586_028805 3300053145 Bacteria 1816
479 Ga0500589_130580 3300053147 Bacteria 1050
480 Ga0500638_317312 3300053162 Bacteria 593
481 Ga0500636_0002483 3300053177 Bacteria 10235
482 Ga0500637_0104449 3300053178 Bacteria 1643

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005455 Ga0070663_100327493 Ga0070663_1003274931 47
2 3300006038 Ga0075365_10131145 Ga0075365_101311451 47
3 3300026116 Ga0207674_10089393 Ga0207674_100893934 48
4 3300005564 Ga0070664_100430070 Ga0070664_1004300703 49
5 3300005616 Ga0068852_100413853 Ga0068852_1004138533 49
6 3300009093 Ga0105240_11357128 Ga0105240_113571281 49
7 3300009148 Ga0105243_10946623 Ga0105243_109466232 49
8 3300013105 Ga0157369_11342317 Ga0157369_113423172 49
9 3300013307 Ga0157372_11812983 Ga0157372_118129832 49
10 3300048915 Ga0496112_1531303 Ga0496112_1531303_389_538 49
11 3300048918 Ga0496115_0094488 Ga0496115_0094488_1622_1771 49
12 iso_pu_bacteria 2524023205 2524436422 49
13 iso_pu_bacteria 2617270735 2617346623 49
14 iso_pu_bacteria 2744054633 2745080624 49
15 iso_pu_bacteria 2791355196 2793064522 49
16 iso_pu_bacteria 2824679649 2824681450 49
17 iso_pu_bacteria 2824704595 2824713147 49
18 iso_pu_bacteria 2824753945 2824763401 49
19 iso_pu_bacteria 2824763712 2824773121 49
20 iso_pu_bacteria 2874612657 2874614757 49
21 iso_pu_bacteria 2904711408 2904714774 49
22 iso_pu_bacteria 2922393267 2922397247 49
23 iso_pu_bacteria 3005506211 3005508589 49
24 3300005614 Ga0068856_100827960 Ga0068856_1008279602 50
25 3300007788 Ga0099795_10049461 Ga0099795_100494612 50
26 iso_pu_bacteria 2507262055 2507505957 50
27 iso_pu_bacteria 2507262055 2507511452 50
28 iso_pu_bacteria 2513237092 2513624061 50
29 iso_pu_bacteria 2513237092 2513624865 50
30 iso_pu_bacteria 2513237095 2513648439 50
31 iso_pu_bacteria 2513237095 2513649137 50
32 iso_pu_bacteria 2513237102 2513700203 50
33 iso_pu_bacteria 2513237102 2513704261 50
34 iso_pu_bacteria 2513237104 2513717239 50
35 iso_pu_bacteria 2513237139 2513875050 50
36 iso_pu_bacteria 2513237139 2513876583 50
37 iso_pu_bacteria 2513237161 2514010919 50
38 iso_pu_bacteria 2513237161 2514013878 50
39 iso_pu_bacteria 2517093001 2517103143 50
40 iso_pu_bacteria 2528768022 2528850725 50
41 iso_pu_bacteria 2617270735 2617352853 50
42 iso_pu_bacteria 2617270741 2617374927 50
43 iso_pu_bacteria 2791355196 2793061343 50
44 iso_pu_bacteria 2791355196 2793061509 50
45 iso_pu_bacteria 2791355196 2793063951 50
46 iso_pu_bacteria 2791355196 2793064647 50
47 iso_pu_bacteria 2802429603 2805916360 50
48 iso_pu_bacteria 2802429603 2805919838 50
49 iso_pu_bacteria 2816332527 2818240021 50
50 iso_pu_bacteria 2816332527 2818240528 50
51 iso_pu_bacteria 2824600985 2824603661 50
52 iso_pu_bacteria 2824609381 2824610753 50
53 iso_pu_bacteria 2824617872 2824626062 50
54 iso_pu_bacteria 2824617872 2824626199 50
55 iso_pu_bacteria 2824626560 2824632171 50
56 iso_pu_bacteria 2824626560 2824634789 50
57 iso_pu_bacteria 2824635225 2824642867 50
58 iso_pu_bacteria 2824635225 2824643426 50
59 iso_pu_bacteria 2824644064 2824650808 50
60 iso_pu_bacteria 2824644064 2824651401 50
61 iso_pu_bacteria 2824653114 2824660514 50
62 iso_pu_bacteria 2824661429 2824666866 50
63 iso_pu_bacteria 2824671348 2824676146 50
64 iso_pu_bacteria 2824671348 2824677246 50
65 iso_pu_bacteria 2824671348 2824678606 50
66 iso_pu_bacteria 2824679649 2824685987 50
67 iso_pu_bacteria 2824687955 2824691837 50
68 iso_pu_bacteria 2824687955 2824694519 50
69 iso_pu_bacteria 2824696289 2824699434 50
70 iso_pu_bacteria 2824696289 2824702233 50
71 iso_pu_bacteria 2824696289 2824703731 50
72 iso_pu_bacteria 2824704595 2824712788 50
73 iso_pu_bacteria 2824714736 2824720653 50
74 iso_pu_bacteria 2824714736 2824721911 50
75 iso_pu_bacteria 2824723954 2824730906 50
76 iso_pu_bacteria 2824723954 2824731730 50
77 iso_pu_bacteria 2824732956 2824738509 50
78 iso_pu_bacteria 2824746037 2824752511 50
79 iso_pu_bacteria 2824753945 2824763300 50
80 iso_pu_bacteria 2824763712 2824773173 50
81 iso_pu_bacteria 2824773399 2824779343 50
82 iso_pu_bacteria 2824773399 2824781187 50
83 iso_pu_bacteria 2838122688 2838126420 50
84 iso_pu_bacteria 2838122688 2838129975 50
85 iso_pu_bacteria 2841941048 2841943173 50
86 iso_pu_bacteria 2841941048 2841943506 50
87 iso_pu_bacteria 2841941048 2841947014 50
88 iso_pu_bacteria 2841949485 2841950547 50
89 iso_pu_bacteria 2841949485 2841955055 50
90 iso_pu_bacteria 2841949485 2841956194 50
91 iso_pu_bacteria 2841957949 2841960235 50
92 iso_pu_bacteria 2841957949 2841963986 50
93 iso_pu_bacteria 2841966195 2841966861 50
94 iso_pu_bacteria 2841966195 2841968186 50
95 iso_pu_bacteria 2841966195 2841970012 50
96 iso_pu_bacteria 2841974524 2841975611 50
97 iso_pu_bacteria 2841974524 2841976604 50
98 iso_pu_bacteria 2841974524 2841977346 50
99 iso_pu_bacteria 2841983080 2841987977 50
100 iso_pu_bacteria 2841983080 2841988182 50
101 iso_pu_bacteria 2841983080 2841990240 50
102 iso_pu_bacteria 2844315083 2844316296 50
103 iso_pu_bacteria 2847930680 2847939401 50
104 iso_pu_bacteria 2847939898 2847943798 50
105 iso_pu_bacteria 2847939898 2847944253 50
106 iso_pu_bacteria 2847939898 2847945965 50
107 iso_pu_bacteria 2849076700 2849081514 50
108 iso_pu_bacteria 2849076700 2849081967 50
109 iso_pu_bacteria 2857509624 2857513376 50
110 iso_pu_bacteria 2857524615 2857525565 50
111 iso_pu_bacteria 2874612657 2874615274 50
112 iso_pu_bacteria 2874612657 2874616492 50
113 iso_pu_bacteria 2874628541 2874633418 50
114 iso_pu_bacteria 2876761206 2876763703 50
115 iso_pu_bacteria 2876761206 2876765444 50
116 iso_pu_bacteria 2879083081 2879087074 50
117 iso_pu_bacteria 2879099564 2879104404 50
118 iso_pu_bacteria 2888378607 2888387027 50
119 iso_pu_bacteria 2888378607 2888387205 50
120 iso_pu_bacteria 2888388044 2888394507 50
121 iso_pu_bacteria 2888419890 2888421213 50
122 iso_pu_bacteria 2903727486 2903728369 50
123 iso_pu_bacteria 2904711408 2904719779 50
124 iso_pu_bacteria 2906602504 2906606509 50
125 iso_pu_bacteria 2906626472 2906629287 50
126 iso_pu_bacteria 2906626472 2906631399 50
127 iso_pu_bacteria 2906643746 2906646746 50
128 iso_pu_bacteria 2908775508 2908777412 50
129 iso_pu_bacteria 2919073203 2919074627 50
130 iso_pu_bacteria 2919073203 2919079442 50
131 iso_pu_bacteria 2922368715 2922377386 50
132 iso_pu_bacteria 2922393267 2922398311 50
133 iso_pu_bacteria 2929615660 2929619593 50
134 iso_pu_bacteria 2929615660 2929622174 50
135 iso_pu_bacteria 2929624759 2929627937 50
136 iso_pu_bacteria 2929624759 2929630179 50
137 iso_pu_bacteria 2932784394 2932787893 50
138 iso_pu_bacteria 2932809354 2932817618 50
139 iso_pu_bacteria 2932818245 2932826222 50
140 iso_pu_bacteria 2932828146 2932835079 50
141 iso_pu_bacteria 2933577622 2933584211 50
142 iso_pu_bacteria 2935616580 2935620456 50
143 iso_pu_bacteria 2935638405 2935640779 50
144 iso_pu_bacteria 2935665750 2935670282 50
145 iso_pu_bacteria 2935675223 2935679712 50
146 iso_pu_bacteria 2935684952 2935687281 50
147 iso_pu_bacteria 2935694250 2935696748 50
148 iso_pu_bacteria 2935703347 2935709160 50
149 iso_pu_bacteria 2935713505 2935718740 50
150 iso_pu_bacteria 2935722832 2935728392 50
151 iso_pu_bacteria 2935732158 2935737011 50
152 iso_pu_bacteria 2935741537 2935745986 50
153 iso_pu_bacteria 2935750917 2935753247 50
154 iso_pu_bacteria 2935760218 2935766361 50
155 iso_pu_bacteria 2935769743 2935770247 50
156 iso_pu_bacteria 2935769743 2935770411 50
157 iso_pu_bacteria 2935777560 2935777725 50
158 iso_pu_bacteria 2935777560 2935782560 50
159 iso_pu_bacteria 2935785616 2935786536 50
160 iso_pu_bacteria 2935785616 2935786700 50
161 iso_pu_bacteria 2935793552 2935794591 50
162 iso_pu_bacteria 2935793552 2935794754 50
163 iso_pu_bacteria 2935801545 2935809042 50
164 iso_pu_bacteria 2935810662 2935813778 50
165 iso_pu_bacteria 2935827899 2935832286 50
166 iso_pu_bacteria 2935837841 2935843991 50
167 iso_pu_bacteria 2935855204 2935862782 50
168 iso_pu_bacteria 2935864058 2935864525 50
169 iso_pu_bacteria 2935873716 2935875123 50
170 iso_pu_bacteria 2935959822 2935961426 50
171 iso_pu_bacteria 2935992306 2935999259 50
172 iso_pu_bacteria 2936002035 2936005814 50
173 iso_pu_bacteria 2936037263 2936039334 50
174 iso_pu_bacteria 2940556831 2940559160 50
175 iso_pu_bacteria 2941538514 2941541854 50
176 iso_pu_bacteria 3005483717 3005487754 50
177 iso_pu_bacteria 3005506211 3005511104 50
178 iso_pu_bacteria 3005594810 3005595908 50
179 iso_pu_bacteria 3005710791 3005711845 50
180 iso_pu_bacteria 3005718088 3005719102 50
181 iso_pu_bacteria 8016511872 8016517228 50
182 iso_pu_bacteria 8016522445 8016524579 50
183 iso_pu_bacteria 8016522445 8016527016 50
184 iso_pu_bacteria 8016530956 8016532093 50
185 iso_pu_bacteria 8016530956 8016538140 50
186 iso_pu_bacteria 8016539877 8016542419 50
187 iso_pu_bacteria 8016539877 8016545307 50
188 iso_pu_bacteria 8016548790 8016550856 50
189 iso_pu_bacteria 8016548790 8016556782 50
190 iso_pu_bacteria 8016557553 8016559268 50
191 iso_pu_bacteria 8016557553 8016565136 50
192 iso_pu_bacteria 8016566248 8016567807 50
193 iso_pu_bacteria 8016566248 8016570390 50
194 iso_pu_bacteria 8016575299 8016580497 50
195 iso_pu_bacteria 8016575299 8016582928 50
196 iso_pu_bacteria 8016583857 8016585372 50
197 iso_pu_bacteria 8016583857 8016588536 50
198 iso_pu_bacteria 8016595262 8016597217 50
199 iso_pu_bacteria 8016595262 8016602783 50
200 iso_pu_bacteria 8016603502 8016605050 50
201 iso_pu_bacteria 8016603502 8016605645 50
202 iso_pu_bacteria 8016613128 8016617558 50
203 iso_pu_bacteria 8016613128 8016619968 50
204 iso_pu_bacteria 8016622563 8016624012 50
205 iso_pu_bacteria 8016622563 8016624186 50
206 iso_pu_bacteria 8017057580 8017059366 50
207 iso_pu_bacteria 8019530166 8019531913 50
208 iso_pu_bacteria 8019530166 8019537812 50
209 iso_pu_bacteria 8019538911 8019539435 50
210 iso_pu_bacteria 8019538911 8019539621 50
211 iso_pu_bacteria 8019547302 8019551037 50
212 iso_pu_bacteria 8019547302 8019551204 50
213 iso_pu_bacteria 8019576017 8019576253 50
214 iso_pu_bacteria 8019586578 8019594133 50
215 iso_pu_bacteria 8019597564 8019607433 50
216 iso_pu_bacteria 8019608314 8019611078 50
217 iso_pu_bacteria 8055742211 8055743576 50
218 iso_pu_bacteria 8056967851 8056974119 50
219 3300005262 Ga0065165_1070233 Ga0065165_10702331 51
220 3300006038 Ga0075365_10052962 Ga0075365_100529625 51
221 3300006051 Ga0075364_10007861 Ga0075364_100078619 51
222 3300006178 Ga0075367_10071534 Ga0075367_100715342 51
223 3300006186 Ga0075369_10002297 Ga0075369_100022979 51
224 3300006353 Ga0075370_10348564 Ga0075370_103485642 51
225 3300025295 Ga0209564_1027871 Ga0209564_10278712 51
226 3300025302 Ga0207426_1018923 Ga0207426_10189232 51
227 3300048909 Ga0496106_0515356 Ga0496106_0515356_499_654 51
228 3300048919 Ga0496116_0004251 Ga0496116_0004251_12284_12439 51
229 3300048920 Ga0496117_0012698 Ga0496117_0012698_5102_5257 51
230 3300048921 Ga0496118_0027495 Ga0496118_0027495_1045_1200 51
231 3300048926 Ga0496123_0086666 Ga0496123_0086666_1487_1642 51
232 3300048927 Ga0496124_0058363 Ga0496124_0058363_1805_1960 51
233 3300048928 Ga0496125_0015991 Ga0496125_0015991_1122_1277 51
234 3300050491 nmdc:mga00v17_4195_c1 nmdc:mga00v17_4195_c1_67_222 51
235 3300050492 nmdc:mga0yw44_60293_c1 nmdc:mga0yw44_60293_c1_281_436 51
236 3300050516 nmdc:mga0sz30_1155_c1 nmdc:mga0sz30_1155_c1_3320_3475 51
237 3300025908 Ga0207643_11104940 Ga0207643_111049402 52
238 3300041494 Ga0451837_1823684 Ga0451837_1823684_104_262 52
239 3300003203 JGI25406J46586_10001492 JGI25406J46586_100014922 53
240 3300003203 JGI25406J46586_10118246 JGI25406J46586_101182462 53
241 3300003215 JGI25153J46596_10005850 JGI25153J46596_100058503 53
242 3300003320 rootH2_10123764 rootH2_101237644 53
243 3300003323 rootH1_10154882 rootH1_101548822 53
244 3300003775 Ga0055524_1038196 Ga0055524_10381962 53
245 3300003794 Ga0055531_10023085 Ga0055531_100230852 53
246 3300005262 Ga0065165_1006344 Ga0065165_10063443 53
247 3300005327 Ga0070658_10019362 Ga0070658_100193623 53
248 3300005339 Ga0070660_100924642 Ga0070660_1009246422 53
249 3300005366 Ga0070659_100415159 Ga0070659_1004151592 53
250 3300005455 Ga0070663_102018590 Ga0070663_1020185902 53
251 3300005457 Ga0070662_100559373 Ga0070662_1005593732 53
252 3300005543 Ga0070672_100988899 Ga0070672_1009888992 53
253 3300005548 Ga0070665_102029195 Ga0070665_1020291952 53
254 3300005563 Ga0068855_102092934 Ga0068855_1020929341 53
255 3300005564 Ga0070664_102063726 Ga0070664_1020637261 53
256 3300005985 Ga0081539_10000250 Ga0081539_100002504 53
257 3300005985 Ga0081539_10048041 Ga0081539_100480414 53
258 3300006051 Ga0075364_10851317 Ga0075364_108513171 53
259 3300006358 Ga0068871_101231941 Ga0068871_1012319411 53
260 3300006871 Ga0075434_100179857 Ga0075434_1001798573 53
261 3300013296 Ga0157374_11822376 Ga0157374_118223762 53
262 3300025245 Ga0207425_1026204 Ga0207425_10262042 53
263 3300025295 Ga0209564_1015801 Ga0209564_10158013 53
264 3300025297 Ga0209758_1000011 Ga0209758_1000011127 53
265 3300025297 Ga0209758_1000209 Ga0209758_1000209108 53
266 3300025299 Ga0209256_1002188 Ga0209256_10021883 53
267 3300025302 Ga0207426_1004534 Ga0207426_10045347 53
268 3300025304 Ga0209257_1000620 Ga0209257_10006204 53
269 3300025904 Ga0207647_10638556 Ga0207647_106385561 53
270 3300025909 Ga0207705_10884677 Ga0207705_108846772 53
271 3300025919 Ga0207657_10673933 Ga0207657_106739332 53
272 3300025932 Ga0207690_10318288 Ga0207690_103182882 53
273 3300025933 Ga0207706_10149265 Ga0207706_101492652 53
274 3300025940 Ga0207691_11621650 Ga0207691_116216501 53
275 3300026041 Ga0207639_12062591 Ga0207639_120625911 53
276 3300026067 Ga0207678_10654004 Ga0207678_106540042 53
277 3300026067 Ga0207678_11151668 Ga0207678_111516682 53
278 3300027296 Ga0209389_1000412 Ga0209389_100041215 53
279 3300027357 Ga0209589_1004063 Ga0209589_100406315 53
280 3300027361 Ga0209489_100090 Ga0209489_10009011 53
281 3300028379 Ga0268266_12229898 Ga0268266_122298981 53
282 3300031235 Ga0265330_10008738 Ga0265330_100087382 53
283 3300031249 Ga0265339_10404020 Ga0265339_104040202 53
284 3300031507 Ga0307509_10367591 Ga0307509_103675912 53
285 3300039437 Ga0436365_1199722 Ga0436365_1199722_344_505 53
286 3300039450 Ga0436363_0537045 Ga0436363_0537045_350_511 53
287 3300041505 Ga0451849_0768268 Ga0451849_0768268_330_491 53
288 3300042005 Ga0439448_0318543 Ga0439448_0318543_220_381 53
289 3300044658 Ga0466972_0012408 Ga0466972_0012408_1145_1309 53
290 3300044658 Ga0466972_0213342 Ga0466972_0213342_457_621 53
291 3300044735 Ga0466968_0009585 Ga0466968_0009585_371_535 53
292 3300044901 Ga0466960_0038044 Ga0466960_0038044_1527_1691 53
293 3300044901 Ga0466960_0620221 Ga0466960_0620221_314_475 53
294 3300048924 Ga0496121_0100896 Ga0496121_0100896_1299_1460 53
295 3300048929 Ga0496126_0029913 Ga0496126_0029913_1414_1575 53
296 3300001904 JGI24736J21556_1030079 JGI24736J21556_10300793 54
297 3300001990 JGI24737J22298_10215399 JGI24737J22298_102153992 54
298 3300002067 JGI24735J21928_10064167 JGI24735J21928_100641672 54
299 3300002067 JGI24735J21928_10066827 JGI24735J21928_100668272 54
300 3300002155 JGI24033J26618_1065262 JGI24033J26618_10652621 54
301 3300003203 JGI25406J46586_10000012 JGI25406J46586_1000001271 54
302 3300003215 JGI25153J46596_10000453 JGI25153J46596_100004535 54
303 3300003771 Ga0055526_1026485 Ga0055526_10264852 54
304 3300003775 Ga0055524_1048024 Ga0055524_10480242 54
305 3300003794 Ga0055531_10003002 Ga0055531_100030029 54
306 3300005262 Ga0065165_1007785 Ga0065165_10077854 54
307 3300005327 Ga0070658_10230353 Ga0070658_102303531 54
308 3300005327 Ga0070658_10431512 Ga0070658_104315122 54
309 3300005328 Ga0070676_10520815 Ga0070676_105208152 54
310 3300005329 Ga0070683_100005616 Ga0070683_10000561610 54
311 3300005329 Ga0070683_101043574 Ga0070683_1010435741 54
312 3300005330 Ga0070690_101006546 Ga0070690_1010065462 54
313 3300005331 Ga0070670_100083921 Ga0070670_1000839212 54
314 3300005333 Ga0070677_10214699 Ga0070677_102146992 54
315 3300005335 Ga0070666_10611424 Ga0070666_106114242 54
316 3300005336 Ga0070680_100097139 Ga0070680_1000971393 54
317 3300005336 Ga0070680_100264096 Ga0070680_1002640963 54
318 3300005337 Ga0070682_100529849 Ga0070682_1005298492 54
319 3300005339 Ga0070660_100161002 Ga0070660_1001610023 54
320 3300005339 Ga0070660_100491310 Ga0070660_1004913102 54
321 3300005341 Ga0070691_10439384 Ga0070691_104393841 54
322 3300005344 Ga0070661_100065660 Ga0070661_1000656605 54
323 3300005344 Ga0070661_101067822 Ga0070661_1010678221 54
324 3300005345 Ga0070692_10433025 Ga0070692_104330251 54
325 3300005353 Ga0070669_101117654 Ga0070669_1011176541 54
326 3300005354 Ga0070675_100215875 Ga0070675_1002158751 54
327 3300005354 Ga0070675_101410291 Ga0070675_1014102911 54
328 3300005355 Ga0070671_101730010 Ga0070671_1017300101 54
329 3300005356 Ga0070674_100691559 Ga0070674_1006915592 54
330 3300005364 Ga0070673_100057683 Ga0070673_1000576832 54
331 3300005364 Ga0070673_100286293 Ga0070673_1002862932 54
332 3300005366 Ga0070659_100392966 Ga0070659_1003929662 54
333 3300005367 Ga0070667_100152210 Ga0070667_1001522102 54
334 3300005434 Ga0070709_10237946 Ga0070709_102379462 54
335 3300005434 Ga0070709_10283631 Ga0070709_102836311 54
336 3300005435 Ga0070714_100133409 Ga0070714_1001334093 54
337 3300005435 Ga0070714_100353386 Ga0070714_1003533862 54
338 3300005435 Ga0070714_100580984 Ga0070714_1005809843 54
339 3300005436 Ga0070713_100017348 Ga0070713_1000173488 54
340 3300005436 Ga0070713_100083086 Ga0070713_1000830862 54
341 3300005436 Ga0070713_100138576 Ga0070713_1001385763 54
342 3300005436 Ga0070713_100447587 Ga0070713_1004475872 54
343 3300005436 Ga0070713_100911575 Ga0070713_1009115752 54
344 3300005436 Ga0070713_101111320 Ga0070713_1011113201 54
345 3300005437 Ga0070710_11329729 Ga0070710_113297292 54
346 3300005439 Ga0070711_100554319 Ga0070711_1005543193 54
347 3300005445 Ga0070708_101593518 Ga0070708_1015935181 54
348 3300005455 Ga0070663_100714504 Ga0070663_1007145041 54
349 3300005455 Ga0070663_100768806 Ga0070663_1007688061 54
350 3300005458 Ga0070681_10017592 Ga0070681_100175923 54
351 3300005458 Ga0070681_10318213 Ga0070681_103182132 54
352 3300005458 Ga0070681_10519587 Ga0070681_105195872 54
353 3300005459 Ga0068867_100883767 Ga0068867_1008837671 54
354 3300005471 Ga0070698_100478590 Ga0070698_1004785902 54
355 3300005530 Ga0070679_100062309 Ga0070679_1000623096 54
356 3300005530 Ga0070679_100484901 Ga0070679_1004849012 54
357 3300005535 Ga0070684_100023098 Ga0070684_1000230984 54
358 3300005536 Ga0070697_100140408 Ga0070697_1001404083 54
359 3300005536 Ga0070697_100848342 Ga0070697_1008483422 54
360 3300005539 Ga0068853_100074050 Ga0068853_1000740504 54
361 3300005539 Ga0068853_100218501 Ga0068853_1002185012 54
362 3300005543 Ga0070672_100923058 Ga0070672_1009230583 54
363 3300005547 Ga0070693_100174018 Ga0070693_1001740183 54
364 3300005547 Ga0070693_100584715 Ga0070693_1005847152 54
365 3300005547 Ga0070693_101411763 Ga0070693_1014117631 54
366 3300005563 Ga0068855_100042130 Ga0068855_1000421303 54
367 3300005563 Ga0068855_100091543 Ga0068855_1000915435 54
368 3300005563 Ga0068855_100697608 Ga0068855_1006976083 54
369 3300005564 Ga0070664_100140429 Ga0070664_1001404295 54
370 3300005564 Ga0070664_101190127 Ga0070664_1011901272 54
371 3300005577 Ga0068857_100008314 Ga0068857_1000083143 54
372 3300005578 Ga0068854_100073898 Ga0068854_1000738984 54
373 3300005578 Ga0068854_101396445 Ga0068854_1013964452 54
374 3300005614 Ga0068856_100093682 Ga0068856_1000936822 54
375 3300005614 Ga0068856_100260950 Ga0068856_1002609501 54
376 3300005614 Ga0068856_102140325 Ga0068856_1021403252 54
377 3300005616 Ga0068852_100114322 Ga0068852_1001143222 54
378 3300005616 Ga0068852_100338220 Ga0068852_1003382202 54
379 3300005616 Ga0068852_100633593 Ga0068852_1006335932 54
380 3300005617 Ga0068859_101107794 Ga0068859_1011077943 54
381 3300005719 Ga0068861_100649892 Ga0068861_1006498922 54
382 3300005834 Ga0068851_10007628 Ga0068851_100076282 54
383 3300005843 Ga0068860_100577804 Ga0068860_1005778042 54
384 3300005983 Ga0081540_1307989 Ga0081540_13079891 54
385 3300005985 Ga0081539_10000040 Ga0081539_10000040236 54
386 3300006028 Ga0070717_10000355 Ga0070717_1000035517 54
387 3300006028 Ga0070717_10012461 Ga0070717_100124618 54
388 3300006028 Ga0070717_10046462 Ga0070717_100464622 54
389 3300006028 Ga0070717_10078841 Ga0070717_100788414 54
390 3300006028 Ga0070717_10345799 Ga0070717_103457993 54
391 3300006028 Ga0070717_10347901 Ga0070717_103479012 54
392 3300006038 Ga0075365_10900513 Ga0075365_109005132 54
393 3300006048 Ga0075363_100033304 Ga0075363_1000333042 54
394 3300006051 Ga0075364_10031107 Ga0075364_100311074 54
395 3300006163 Ga0070715_10085512 Ga0070715_100855124 54
396 3300006173 Ga0070716_100323897 Ga0070716_1003238971 54
397 3300006173 Ga0070716_101787873 Ga0070716_1017878733 54
398 3300006175 Ga0070712_100366486 Ga0070712_1003664863 54
399 3300006175 Ga0070712_100718546 Ga0070712_1007185462 54
400 3300006175 Ga0070712_101716096 Ga0070712_1017160963 54
401 3300006177 Ga0075362_10453395 Ga0075362_104533952 54
402 3300006186 Ga0075369_10035863 Ga0075369_100358633 54
403 3300006186 Ga0075369_10045900 Ga0075369_100459002 54
404 3300006871 Ga0075434_100579343 Ga0075434_1005793432 54
405 3300006931 Ga0097620_101107866 Ga0097620_1011078663 54
406 3300007265 Ga0099794_10036362 Ga0099794_100363623 54
407 3300007788 Ga0099795_10386968 Ga0099795_103869681 54
408 3300007788 Ga0099795_10578501 Ga0099795_105785011 54
409 3300009093 Ga0105240_10004694 Ga0105240_1000469419 54
410 3300009093 Ga0105240_10014338 Ga0105240_100143388 54
411 3300009093 Ga0105240_10084297 Ga0105240_100842974 54
412 3300009093 Ga0105240_10492881 Ga0105240_104928813 54
413 3300009093 Ga0105240_10756968 Ga0105240_107569682 54
414 3300009094 Ga0111539_12132211 Ga0111539_121322112 54
415 3300009098 Ga0105245_10375755 Ga0105245_103757551 54
416 3300009098 Ga0105245_12516233 Ga0105245_125162331 54
417 3300009147 Ga0114129_12984967 Ga0114129_129849671 54
418 3300009148 Ga0105243_10480226 Ga0105243_104802262 54
419 3300009174 Ga0105241_10093623 Ga0105241_100936232 54
420 3300009174 Ga0105241_10894490 Ga0105241_108944902 54
421 3300009174 Ga0105241_11906604 Ga0105241_119066041 54
422 3300009176 Ga0105242_10218695 Ga0105242_102186952 54
423 3300009176 Ga0105242_10449777 Ga0105242_104497772 54
424 3300009176 Ga0105242_12811762 Ga0105242_128117621 54
425 3300009177 Ga0105248_10049430 Ga0105248_100494304 54
426 3300009545 Ga0105237_10030752 Ga0105237_100307525 54
427 3300009545 Ga0105237_10048491 Ga0105237_100484915 54
428 3300009545 Ga0105237_10231071 Ga0105237_102310713 54
429 3300009545 Ga0105237_10235957 Ga0105237_102359572 54
430 3300009545 Ga0105237_11583211 Ga0105237_115832112 54
431 3300009551 Ga0105238_10007397 Ga0105238_100073978 54
432 3300009551 Ga0105238_10023868 Ga0105238_100238682 54
433 3300009551 Ga0105238_10215451 Ga0105238_102154512 54
434 3300009551 Ga0105238_10606305 Ga0105238_106063053 54
435 3300009553 Ga0105249_10166729 Ga0105249_101667293 54
436 3300009553 Ga0105249_11301134 Ga0105249_113011341 54
437 3300010159 Ga0099796_10042515 Ga0099796_100425151 54
438 3300010159 Ga0099796_10146099 Ga0099796_101460992 54
439 3300010375 Ga0105239_10018859 Ga0105239_100188596 54
440 3300010375 Ga0105239_10238970 Ga0105239_102389702 54
441 3300011119 Ga0105246_10058087 Ga0105246_100580873 54
442 3300011119 Ga0105246_10415609 Ga0105246_104156091 54
443 3300012482 Ga0157318_1038894 Ga0157318_10388941 54
444 3300013100 Ga0157373_10758972 Ga0157373_107589723 54
445 3300013104 Ga0157370_10064213 Ga0157370_100642135 54
446 3300013105 Ga0157369_10072277 Ga0157369_100722775 54
447 3300013105 Ga0157369_10512265 Ga0157369_105122651 54
448 3300013296 Ga0157374_10515844 Ga0157374_105158442 54
449 3300013296 Ga0157374_12888311 Ga0157374_128883111 54
450 3300013297 Ga0157378_10290428 Ga0157378_102904282 54
451 3300013297 Ga0157378_11002433 Ga0157378_110024332 54
452 3300013297 Ga0157378_11229727 Ga0157378_112297272 54
453 3300013306 Ga0163162_10907408 Ga0163162_109074082 54
454 3300013306 Ga0163162_13081175 Ga0163162_130811752 54
455 3300013307 Ga0157372_10412520 Ga0157372_104125202 54
456 3300013308 Ga0157375_10437390 Ga0157375_104373901 54
457 3300013308 Ga0157375_11228492 Ga0157375_112284922 54
458 3300013308 Ga0157375_12684788 Ga0157375_126847882 54
459 3300014325 Ga0163163_10693498 Ga0163163_106934983 54
460 3300014497 Ga0182008_10718014 Ga0182008_107180141 54
461 3300014968 Ga0157379_11017902 Ga0157379_110179021 54
462 3300017792 Ga0163161_10305982 Ga0163161_103059821 54
463 3300020082 Ga0206353_11182322 Ga0206353_111823221 54
464 3300021384 Ga0213876_10173952 Ga0213876_101739522 54
465 3300022729 Ga0228599_109105 Ga0228599_1091051 54
466 3300024225 Ga0224572_1024785 Ga0224572_10247852 54
467 3300025245 Ga0207425_1011029 Ga0207425_10110292 54
468 3300025295 Ga0209564_1008984 Ga0209564_10089845 54
469 3300025297 Ga0209758_1000021 Ga0209758_1000021129 54
470 3300025299 Ga0209256_1003782 Ga0209256_10037822 54
471 3300025299 Ga0209256_1094889 Ga0209256_10948891 54
472 3300025302 Ga0207426_1070356 Ga0207426_10703562 54
473 3300025304 Ga0209257_1001645 Ga0209257_100164525 54
474 3300025315 Ga0207697_10028208 Ga0207697_100282081 54
475 3300025321 Ga0207656_10004840 Ga0207656_100048402 54
476 3300025901 Ga0207688_11074974 Ga0207688_110749741 54
477 3300025903 Ga0207680_10590998 Ga0207680_105909982 54
478 3300025904 Ga0207647_10024774 Ga0207647_100247744 54
479 3300025904 Ga0207647_10510502 Ga0207647_105105021 54
480 3300025905 Ga0207685_10209634 Ga0207685_102096342 54
481 3300025906 Ga0207699_10242404 Ga0207699_102424042 54
482 3300025909 Ga0207705_10033639 Ga0207705_100336394 54
483 3300025909 Ga0207705_10046081 Ga0207705_100460813 54
484 3300025912 Ga0207707_10000706 Ga0207707_1000070626 54
485 3300025912 Ga0207707_10113336 Ga0207707_101133361 54
486 3300025912 Ga0207707_10676321 Ga0207707_106763212 54
487 3300025912 Ga0207707_10720220 Ga0207707_107202202 54
488 3300025913 Ga0207695_10096049 Ga0207695_100960494 54
489 3300025913 Ga0207695_10100277 Ga0207695_101002775 54
490 3300025913 Ga0207695_10558583 Ga0207695_105585833 54
491 3300025914 Ga0207671_10019453 Ga0207671_100194536 54
492 3300025914 Ga0207671_10085932 Ga0207671_100859322 54
493 3300025914 Ga0207671_10398364 Ga0207671_103983642 54
494 3300025914 Ga0207671_10992075 Ga0207671_109920752 54
495 3300025915 Ga0207693_10299821 Ga0207693_102998213 54
496 3300025915 Ga0207693_10609962 Ga0207693_106099622 54
497 3300025916 Ga0207663_10542876 Ga0207663_105428761 54
498 3300025917 Ga0207660_10012021 Ga0207660_100120216 54
499 3300025917 Ga0207660_10314918 Ga0207660_103149183 54
500 3300025917 Ga0207660_10663157 Ga0207660_106631572 54
501 3300025919 Ga0207657_10004672 Ga0207657_100046723 54
502 3300025920 Ga0207649_11400722 Ga0207649_114007222 54
503 3300025921 Ga0207652_10001458 Ga0207652_1000145811 54
504 3300025921 Ga0207652_10652805 Ga0207652_106528051 54
505 3300025923 Ga0207681_10594033 Ga0207681_105940331 54
506 3300025923 Ga0207681_11011066 Ga0207681_110110661 54
507 3300025924 Ga0207694_10009977 Ga0207694_100099775 54
508 3300025924 Ga0207694_10143082 Ga0207694_101430822 54
509 3300025924 Ga0207694_10461679 Ga0207694_104616793 54
510 3300025925 Ga0207650_10334423 Ga0207650_103344232 54
511 3300025926 Ga0207659_10274629 Ga0207659_102746291 54
512 3300025928 Ga0207700_10004801 Ga0207700_100048018 54
513 3300025928 Ga0207700_10236735 Ga0207700_102367352 54
514 3300025928 Ga0207700_10360259 Ga0207700_103602591 54
515 3300025929 Ga0207664_10174682 Ga0207664_101746822 54
516 3300025929 Ga0207664_10355352 Ga0207664_103553522 54
517 3300025931 Ga0207644_11643067 Ga0207644_116430671 54
518 3300025932 Ga0207690_10292599 Ga0207690_102925993 54
519 3300025938 Ga0207704_11933135 Ga0207704_119331351 54
520 3300025940 Ga0207691_10411954 Ga0207691_104119541 54
521 3300025941 Ga0207711_10239515 Ga0207711_102395152 54
522 3300025944 Ga0207661_10055049 Ga0207661_100550495 54
523 3300025945 Ga0207679_11304427 Ga0207679_113044271 54
524 3300025945 Ga0207679_12157524 Ga0207679_121575242 54
525 3300025949 Ga0207667_10006413 Ga0207667_1000641314 54
526 3300025949 Ga0207667_10605435 Ga0207667_106054353 54
527 3300025949 Ga0207667_12252186 Ga0207667_122521862 54
528 3300025960 Ga0207651_10215394 Ga0207651_102153942 54
529 3300025960 Ga0207651_10700957 Ga0207651_107009573 54
530 3300025961 Ga0207712_10813815 Ga0207712_108138152 54
531 3300025972 Ga0207668_12042859 Ga0207668_120428592 54
532 3300025981 Ga0207640_10228810 Ga0207640_102288102 54
533 3300025981 Ga0207640_10708628 Ga0207640_107086282 54
534 3300025981 Ga0207640_10830019 Ga0207640_108300192 54
535 3300025981 Ga0207640_11688245 Ga0207640_116882451 54
536 3300025986 Ga0207658_10116748 Ga0207658_101167482 54
537 3300026023 Ga0207677_10427979 Ga0207677_104279791 54
538 3300026041 Ga0207639_10176988 Ga0207639_101769883 54
539 3300026041 Ga0207639_10468728 Ga0207639_104687282 54
540 3300026067 Ga0207678_10073518 Ga0207678_100735183 54
541 3300026067 Ga0207678_10552613 Ga0207678_105526132 54
542 3300026067 Ga0207678_10658684 Ga0207678_106586841 54
543 3300026067 Ga0207678_11789197 Ga0207678_117891971 54
544 3300026078 Ga0207702_10224002 Ga0207702_102240022 54
545 3300026078 Ga0207702_12055886 Ga0207702_120558861 54
546 3300026116 Ga0207674_10025123 Ga0207674_100251238 54
547 3300026118 Ga0207675_101331309 Ga0207675_1013313092 54
548 3300026121 Ga0207683_10387368 Ga0207683_103873682 54
549 3300026142 Ga0207698_10028257 Ga0207698_100282576 54
550 3300026142 Ga0207698_11093214 Ga0207698_110932142 54
551 3300026142 Ga0207698_12141644 Ga0207698_121416442 54
552 3300027671 Ga0209588_1079520 Ga0209588_10795202 54
553 3300027866 Ga0209813_10174571 Ga0209813_101745712 54
554 3300028381 Ga0268264_10210877 Ga0268264_102108772 54
555 3300028381 Ga0268264_12086081 Ga0268264_120860811 54
556 3300028573 Ga0265334_10156826 Ga0265334_101568262 54
557 3300028794 Ga0307515_10145873 Ga0307515_101458733 54
558 3300031235 Ga0265330_10048506 Ga0265330_100485064 54
559 3300031235 Ga0265330_10156047 Ga0265330_101560471 54
560 3300031238 Ga0265332_10043894 Ga0265332_100438944 54
561 3300031239 Ga0265328_10053588 Ga0265328_100535882 54
562 3300031241 Ga0265325_10047163 Ga0265325_100471632 54
563 3300031247 Ga0265340_10109609 Ga0265340_101096091 54
564 3300031249 Ga0265339_10075924 Ga0265339_100759244 54
565 3300031249 Ga0265339_10503851 Ga0265339_105038511 54
566 3300031250 Ga0265331_10121242 Ga0265331_101212423 54
567 3300031344 Ga0265316_10550171 Ga0265316_105501711 54
568 3300031344 Ga0265316_10962008 Ga0265316_109620081 54
569 3300031595 Ga0265313_10027902 Ga0265313_100279024 54
570 3300031616 Ga0307508_10009028 Ga0307508_100090283 54
571 3300031711 Ga0265314_10720745 Ga0265314_107207451 54
572 3300031712 Ga0265342_10052401 Ga0265342_100524011 54
573 3300031712 Ga0265342_10061317 Ga0265342_100613172 54
574 3300031712 Ga0265342_10087530 Ga0265342_100875302 54
575 3300031730 Ga0307516_10143486 Ga0307516_101434862 54
576 3300031810 Ga0316044_120212 Ga0316044_1202122 54
577 3300033544 Ga0316215_1004213 Ga0316215_10042131 54
578 3300033546 Ga0316213_1006616 Ga0316213_10066161 54
579 3300035086 Ga0373934_0002445 Ga0373934_0002445_6635_6799 54
580 3300035111 Ga0373923_0000271 Ga0373923_0000271_8659_8823 54
581 3300035117 Ga0373953_0000155 Ga0373953_0000155_12490_12654 54
582 3300035118 Ga0373954_0000450 Ga0373954_0000450_8641_8805 54
583 3300035119 Ga0373956_0354398 Ga0373956_0354398_519_683 54
584 3300035120 Ga0373957_0000533 Ga0373957_0000533_215_379 54
585 3300035172 Ga0373955_0001317 Ga0373955_0001317_6586_6750 54
586 3300035410 Ga0373924_0002189 Ga0373924_0002189_405_569 54
587 3300035724 Ga0373933_0010648 Ga0373933_0010648_1380_1544 54
588 3300036401 Ga0373937_0008674 Ga0373937_0008674_1564_1728 54
589 3300036401 Ga0373937_0060546 Ga0373937_0060546_2502_2666 54
590 3300037418 Ga0395900_0152094 Ga0395900_0152094_217_381 54
591 3300037466 Ga0395898_0072855 Ga0395898_0072855_454_618 54
592 3300038443 Ga0395901_0442780 Ga0395901_0442780_631_795 54
593 3300039437 Ga0436365_0429661 Ga0436365_0429661_487_651 54
594 3300039437 Ga0436365_0606176 Ga0436365_0606176_182_346 54
595 3300039450 Ga0436363_0478130 Ga0436363_0478130_249_413 54
596 3300041486 Ga0451807_2513845 Ga0451807_2513845_303_467 54
597 3300041509 Ga0451843_0195165 Ga0451843_0195165_446_610 54
598 3300041511 Ga0451855_1969055 Ga0451855_1969055_300_464 54
599 3300042012 Ga0439455_0226718 Ga0439455_0226718_81_245 54
600 3300042439 Ga0439464_0291602 Ga0439464_0291602_40_204 54
601 3300046454 Ga0495592_0008383 Ga0495592_0008383_2544_2708 54
602 3300046459 Ga0495629_0000816 Ga0495629_0000816_8349_8513 54
603 3300046462 Ga0495651_0004762 Ga0495651_0004762_1787_1951 54
604 3300046463 Ga0495653_0013624 Ga0495653_0013624_1488_1652 54
605 3300046476 Ga0495662_0340839 Ga0495662_0340839_215_379 54
606 3300046507 Ga0495606_0007723 Ga0495606_0007723_3745_3909 54
607 3300046511 Ga0495608_0002302 Ga0495608_0002302_9259_9423 54
608 3300046514 Ga0495618_0144227 Ga0495618_0144227_466_630 54
609 3300046516 Ga0495628_0041829 Ga0495628_0041829_3103_3267 54
610 3300046518 Ga0495631_0166715 Ga0495631_0166715_412_576 54
611 3300046524 Ga0495648_0001509 Ga0495648_0001509_9592_9756 54
612 3300046529 Ga0495652_0004898 Ga0495652_0004898_5360_5524 54
613 3300046533 Ga0495640_0003100 Ga0495640_0003100_9854_10018 54
614 3300046536 Ga0495587_0002199 Ga0495587_0002199_4236_4400 54
615 3300046536 Ga0495587_0159307 Ga0495587_0159307_140_304 54
616 3300046536 Ga0495587_0182439 Ga0495587_0182439_641_805 54
617 3300046542 Ga0495597_0122749 Ga0495597_0122749_631_801 54
618 3300046543 Ga0495645_0012964 Ga0495645_0012964_3308_3472 54
619 3300046559 Ga0495667_0000496 Ga0495667_0000496_16326_16490 54
620 3300046616 Ga0495668_0023647 Ga0495668_0023647_3320_3490 54
621 3300046642 Ga0495634_0024070 Ga0495634_0024070_3755_3919 54
622 3300046663 Ga0495635_0000962 Ga0495635_0000962_6529_6693 54
623 3300046675 Ga0495657_0013532 Ga0495657_0013532_4236_4400 54
624 3300046675 Ga0495657_0867065 Ga0495657_0867065_278_442 54
625 3300046678 Ga0495599_0004531 Ga0495599_0004531_1616_1780 54
626 3300046679 Ga0495623_0004417 Ga0495623_0004417_7713_7877 54
627 3300046679 Ga0495623_0470858 Ga0495623_0470858_263_427 54
628 3300046689 Ga0495613_0100570 Ga0495613_0100570_1706_1870 54
629 3300046809 Ga0495600_0023717 Ga0495600_0023717_2162_2326 54
630 3300046809 Ga0495600_0024832 Ga0495600_0024832_2207_2371 54
631 3300047317 Ga0495604_0002548 Ga0495604_0002548_10029_10193 54
632 3300047319 Ga0495674_0040029 Ga0495674_0040029_3324_3488 54
633 3300047322 Ga0495680_0004880 Ga0495680_0004880_7621_7785 54
634 3300047443 Ga0495687_010132 Ga0495687_010132_862_1032 54
635 3300047444 Ga0495675_0001715 Ga0495675_0001715_6130_6294 54
636 3300047444 Ga0495675_0365258 Ga0495675_0365258_289_453 54
637 3300047471 Ga0495684_0000695 Ga0495684_0000695_12617_12781 54
638 3300047673 Ga0495593_0001764 Ga0495593_0001764_6359_6523 54
639 3300048088 Ga0495602_0005179 Ga0495602_0005179_6678_6842 54
640 3300048088 Ga0495602_0392303 Ga0495602_0392303_675_839 54
641 3300048905 Ga0496102_0154285 Ga0496102_0154285_139_309 54
642 3300048905 Ga0496102_1271943 Ga0496102_1271943_59_223 54
643 3300048906 Ga0496103_0003807 Ga0496103_0003807_1469_1639 54
644 3300048906 Ga0496103_0484519 Ga0496103_0484519_379_543 54
645 3300048907 Ga0496104_0174135 Ga0496104_0174135_838_1008 54
646 3300048910 Ga0496107_0035717 Ga0496107_0035717_3295_3465 54
647 3300048911 Ga0496108_0032425 Ga0496108_0032425_2910_3080 54
648 3300048912 Ga0496109_0036560 Ga0496109_0036560_3056_3226 54
649 3300048913 Ga0496110_0142828 Ga0496110_0142828_377_547 54
650 3300048913 Ga0496110_1053294 Ga0496110_1053294_214_378 54
651 3300048914 Ga0496111_0240247 Ga0496111_0240247_973_1143 54
652 3300048914 Ga0496111_0566498 Ga0496111_0566498_530_694 54
653 3300048915 Ga0496112_0000029 Ga0496112_0000029_39072_39236 54
654 3300048915 Ga0496112_0040806 Ga0496112_0040806_3190_3360 54
655 3300048916 Ga0496113_0129816 Ga0496113_0129816_1061_1231 54
656 3300048918 Ga0496115_0024573 Ga0496115_0024573_4335_4499 54
657 3300048920 Ga0496117_0202496 Ga0496117_0202496_119_289 54
658 3300048922 Ga0496119_0214815 Ga0496119_0214815_122_292 54
659 3300048927 Ga0496124_0135441 Ga0496124_0135441_920_1084 54
660 3300048927 Ga0496124_0358662 Ga0496124_0358662_742_912 54
661 3300048928 Ga0496125_0001204 Ga0496125_0001204_10876_11040 54
662 3300048928 Ga0496125_0048428 Ga0496125_0048428_2956_3126 54
663 3300048929 Ga0496126_0148059 Ga0496126_0148059_1323_1487 54
664 3300050489 nmdc:mga03683_469450_c1 nmdc:mga03683_469450_c1_163_333 54
665 3300050492 nmdc:mga0yw44_478371_c1 nmdc:mga0yw44_478371_c1_287_457 54
666 3300050493 nmdc:mga0k408_828135_c1 nmdc:mga0k408_828135_c1_278_448 54
667 3300050496 nmdc:mga07m45_164970_c1 nmdc:mga07m45_164970_c1_948_1118 54
668 3300050516 nmdc:mga0sz30_232354_c1 nmdc:mga0sz30_232354_c1_182_352 54
669 3300053077 Ga0495601_0002394 Ga0495601_0002394_8927_9091 54
670 3300053077 Ga0495601_0501526 Ga0495601_0501526_58_234 54
671 3300053077 Ga0495601_0674139 Ga0495601_0674139_473_637 54
672 3300053078 Ga0495612_0007364 Ga0495612_0007364_1182_1358 54
673 3300053083 Ga0495655_0071001 Ga0495655_0071001_602_772 54
674 3300053084 Ga0495595_0000887 Ga0495595_0000887_9428_9592 54
675 3300053085 Ga0495619_0002038 Ga0495619_0002038_6446_6610 54
676 3300053085 Ga0495619_0211024 Ga0495619_0211024_142_306 54
677 3300053093 Ga0500651_0355522 Ga0500651_0355522_208_372 54
678 3300053094 Ga0500566_0004519 Ga0500566_0004519_4474_4638 54
679 3300053121 Ga0500607_131099 Ga0500607_131099_503_667 54
680 3300053122 Ga0500608_000229 Ga0500608_000229_1276_1440 54
681 3300053125 Ga0500618_084854 Ga0500618_084854_379_543 54
682 3300053136 Ga0500559_0000105 Ga0500559_0000105_4068_4232 54
683 3300053145 Ga0500586_028805 Ga0500586_028805_1275_1439 54
684 3300053147 Ga0500589_130580 Ga0500589_130580_834_998 54
685 3300053162 Ga0500638_317312 Ga0500638_317312_212_376 54
686 3300053177 Ga0500636_0002483 Ga0500636_0002483_681_845 54
687 3300053178 Ga0500637_0104449 Ga0500637_0104449_1340_1504 54

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04964

Flp_Fap

Flp/Fap pilin component

7

53

0.89

Feature Viewer

pLDDT pTM Quality
90.13 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map