F475229
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 687 | 419 | 482 | 53 |
Family's Representative Sequence
| Representative Sequence | 3300003215|JGI25153J46596_10005850|JGI25153J46596_100058503 |
| Length | 54 |
| Sequence | MRLLRSFLADENAATAIEYGLIAAGIALAIVTIVNSTGGALLNNKFNSIDAATK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 5 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 6 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 7 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 10 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 11 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 12 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 13 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 14 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 15 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 16 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 17 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 18 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 19 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 20 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 21 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 22 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 23 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 24 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 25 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 26 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 27 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 28 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 29 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 30 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 31 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 32 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 33 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 34 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 35 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 36 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 37 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 38 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 39 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 40 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 41 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 42 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 43 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 44 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 45 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 46 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 47 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 48 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 49 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 50 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 51 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 52 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 53 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 54 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 55 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 56 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 57 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 58 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 59 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 60 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 61 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 62 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 63 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 64 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 65 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 66 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 67 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 68 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 69 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 70 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 71 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 72 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 73 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 74 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 75 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 76 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 77 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 78 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 79 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 80 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 81 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 82 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 83 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 84 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 85 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 86 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 87 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 88 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 89 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 90 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 91 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 92 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 93 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 94 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 95 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 96 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 97 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 98 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 99 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 100 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 101 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 102 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 103 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 104 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 105 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 106 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 107 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 108 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 109 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 110 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 111 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 112 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 113 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 114 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 115 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 116 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 117 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 118 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 119 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 120 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 123 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 124 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 144 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 149 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 150 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 151 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 152 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 154 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 155 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 159 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 161 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 162 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 163 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 164 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 165 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 166 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 167 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 168 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 169 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 170 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 172 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 173 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 174 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 175 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 176 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 177 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 178 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 179 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 180 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 181 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 182 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 183 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 185 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 186 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 198 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 201 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 211 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 214 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 215 | 3300022729 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 | Metagenome | Unclassified |
| 216 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 217 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 218 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 219 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 270 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 271 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 278 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 279 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 280 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 281 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 282 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 283 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 284 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 285 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 286 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 287 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 288 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 289 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 290 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 291 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 292 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 293 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 294 | 3300033546 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 | Metagenome | Unclassified |
| 295 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 298 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 299 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 301 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 303 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 304 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 306 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 309 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 310 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 312 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 313 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 314 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 315 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 316 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 317 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 318 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 319 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 320 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 321 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 358 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 359 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 363 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 364 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 365 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 366 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 367 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 368 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 369 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 379 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 387 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 389 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 390 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 393 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 394 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 397 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 398 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 399 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 400 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 401 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 402 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 403 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 404 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 405 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 406 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 407 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 408 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 409 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 410 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 411 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 412 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 413 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 414 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 415 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 416 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 417 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 418 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 419 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.97 |
| Metatranscriptomes | 0.29 |
| Isolates | 29.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.59 |
| Nodule | 20.82 |
| Rhizoplane | 2.91 |
| Rhizosphere | 53.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1030079 | 3300001904 | Bacteria | 840 |
| 2 | JGI24737J22298_10215399 | 3300001990 | Bacteria | 567 |
| 3 | JGI24735J21928_10064167 | 3300002067 | Bacteria | 1054 |
| 4 | JGI24735J21928_10066827 | 3300002067 | Bacteria | 1031 |
| 5 | JGI24033J26618_1065262 | 3300002155 | Bacteria | 541 |
| 6 | JGI25406J46586_10000012 | 3300003203 | Bacteria | 102438 |
| 7 | JGI25406J46586_10001492 | 3300003203 | Bacteria | 11045 |
| 8 | JGI25406J46586_10118246 | 3300003203 | Bacteria | 781 |
| 9 | JGI25153J46596_10000453 | 3300003215 | Bacteria | 26261 |
| 10 | JGI25153J46596_10005850 | 3300003215 | Bacteria | 6374 |
| 11 | rootH2_10123764 | 3300003320 | Bacteria | 1634 |
| 12 | rootH1_10154882 | 3300003323 | Bacteria | 1273 |
| 13 | Ga0055526_1026485 | 3300003771 | Bacteria | 1825 |
| 14 | Ga0055524_1038196 | 3300003775 | Bacteria | 1260 |
| 15 | Ga0055524_1048024 | 3300003775 | Bacteria | 1000 |
| 16 | Ga0055531_10003002 | 3300003794 | Bacteria | 10954 |
| 17 | Ga0055531_10023085 | 3300003794 | Bacteria | 2346 |
| 18 | Ga0065165_1006344 | 3300005262 | Bacteria | 6242 |
| 19 | Ga0065165_1007785 | 3300005262 | Bacteria | 5169 |
| 20 | Ga0065165_1070233 | 3300005262 | Bacteria | 933 |
| 21 | Ga0070658_10019362 | 3300005327 | Bacteria | 5451 |
| 22 | Ga0070658_10230353 | 3300005327 | Bacteria | 1568 |
| 23 | Ga0070658_10431512 | 3300005327 | Bacteria | 1134 |
| 24 | Ga0070676_10520815 | 3300005328 | Bacteria | 847 |
| 25 | Ga0070683_100005616 | 3300005329 | Bacteria | 10482 |
| 26 | Ga0070683_101043574 | 3300005329 | Bacteria | 785 |
| 27 | Ga0070690_101006546 | 3300005330 | Bacteria | 657 |
| 28 | Ga0070670_100083921 | 3300005331 | Bacteria | 2737 |
| 29 | Ga0070677_10214699 | 3300005333 | Bacteria | 936 |
| 30 | Ga0070666_10611424 | 3300005335 | Bacteria | 796 |
| 31 | Ga0070680_100097139 | 3300005336 | Bacteria | 2442 |
| 32 | Ga0070680_100264096 | 3300005336 | Bacteria | 1457 |
| 33 | Ga0070682_100529849 | 3300005337 | Bacteria | 918 |
| 34 | Ga0070660_100161002 | 3300005339 | Bacteria | 1808 |
| 35 | Ga0070660_100491310 | 3300005339 | Bacteria | 1021 |
| 36 | Ga0070660_100924642 | 3300005339 | Bacteria | 736 |
| 37 | Ga0070691_10439384 | 3300005341 | Bacteria | 743 |
| 38 | Ga0070661_100065660 | 3300005344 | Bacteria | 2666 |
| 39 | Ga0070661_101067822 | 3300005344 | Bacteria | 672 |
| 40 | Ga0070692_10433025 | 3300005345 | Bacteria | 838 |
| 41 | Ga0070669_101117654 | 3300005353 | Bacteria | 679 |
| 42 | Ga0070675_100215875 | 3300005354 | Bacteria | 1669 |
| 43 | Ga0070675_101410291 | 3300005354 | Bacteria | 642 |
| 44 | Ga0070671_101730010 | 3300005355 | Bacteria | 555 |
| 45 | Ga0070674_100691559 | 3300005356 | Bacteria | 871 |
| 46 | Ga0070673_100057683 | 3300005364 | Bacteria | 3068 |
| 47 | Ga0070673_100286293 | 3300005364 | Bacteria | 1447 |
| 48 | Ga0070659_100392966 | 3300005366 | Bacteria | 1170 |
| 49 | Ga0070659_100415159 | 3300005366 | Bacteria | 1138 |
| 50 | Ga0070667_100152210 | 3300005367 | Bacteria | 2032 |
| 51 | Ga0070709_10237946 | 3300005434 | Bacteria | 1306 |
| 52 | Ga0070709_10283631 | 3300005434 | Bacteria | 1204 |
| 53 | Ga0070714_100133409 | 3300005435 | Bacteria | 2221 |
| 54 | Ga0070714_100353386 | 3300005435 | Bacteria | 1381 |
| 55 | Ga0070714_100580984 | 3300005435 | Bacteria | 1075 |
| 56 | Ga0070713_100017348 | 3300005436 | Bacteria | 5442 |
| 57 | Ga0070713_100083086 | 3300005436 | Bacteria | 2737 |
| 58 | Ga0070713_100138576 | 3300005436 | Bacteria | 2153 |
| 59 | Ga0070713_100447587 | 3300005436 | Bacteria | 1213 |
| 60 | Ga0070713_100911575 | 3300005436 | Bacteria | 846 |
| 61 | Ga0070713_101111320 | 3300005436 | Bacteria | 764 |
| 62 | Ga0070710_11329729 | 3300005437 | Bacteria | 535 |
| 63 | Ga0070711_100554319 | 3300005439 | Bacteria | 954 |
| 64 | Ga0070708_101593518 | 3300005445 | Bacteria | 608 |
| 65 | Ga0070663_100327493 | 3300005455 | Bacteria | 1234 |
| 66 | Ga0070663_100714504 | 3300005455 | Bacteria | 853 |
| 67 | Ga0070663_100768806 | 3300005455 | Bacteria | 824 |
| 68 | Ga0070663_102018590 | 3300005455 | Bacteria | 519 |
| 69 | Ga0070662_100559373 | 3300005457 | Bacteria | 959 |
| 70 | Ga0070681_10017592 | 3300005458 | Bacteria | 7143 |
| 71 | Ga0070681_10318213 | 3300005458 | Bacteria | 1465 |
| 72 | Ga0070681_10519587 | 3300005458 | Bacteria | 1104 |
| 73 | Ga0068867_100883767 | 3300005459 | Bacteria | 803 |
| 74 | Ga0070698_100478590 | 3300005471 | Bacteria | 1182 |
| 75 | Ga0070679_100062309 | 3300005530 | Bacteria | 3718 |
| 76 | Ga0070679_100484901 | 3300005530 | Bacteria | 1180 |
| 77 | Ga0070684_100023098 | 3300005535 | Bacteria | 5194 |
| 78 | Ga0070697_100140408 | 3300005536 | Bacteria | 2031 |
| 79 | Ga0070697_100848342 | 3300005536 | Bacteria | 809 |
| 80 | Ga0068853_100074050 | 3300005539 | Bacteria | 2971 |
| 81 | Ga0068853_100218501 | 3300005539 | Bacteria | 1740 |
| 82 | Ga0070672_100923058 | 3300005543 | Bacteria | 772 |
| 83 | Ga0070672_100988899 | 3300005543 | Bacteria | 745 |
| 84 | Ga0070693_100174018 | 3300005547 | Bacteria | 1381 |
| 85 | Ga0070693_100584715 | 3300005547 | Bacteria | 804 |
| 86 | Ga0070693_101411763 | 3300005547 | Bacteria | 542 |
| 87 | Ga0070665_102029195 | 3300005548 | Bacteria | 580 |
| 88 | Ga0068855_100042130 | 3300005563 | Bacteria | 5410 |
| 89 | Ga0068855_100091543 | 3300005563 | Bacteria | 3508 |
| 90 | Ga0068855_100697608 | 3300005563 | Bacteria | 1086 |
| 91 | Ga0068855_102092934 | 3300005563 | Bacteria | 570 |
| 92 | Ga0070664_100140429 | 3300005564 | Bacteria | 2127 |
| 93 | Ga0070664_100430070 | 3300005564 | Bacteria | 1210 |
| 94 | Ga0070664_101190127 | 3300005564 | Bacteria | 719 |
| 95 | Ga0070664_102063726 | 3300005564 | Bacteria | 541 |
| 96 | Ga0068857_100008314 | 3300005577 | Bacteria | 8968 |
| 97 | Ga0068854_100073898 | 3300005578 | Bacteria | 2500 |
| 98 | Ga0068854_101396445 | 3300005578 | Bacteria | 633 |
| 99 | Ga0068856_100093682 | 3300005614 | Bacteria | 2989 |
| 100 | Ga0068856_100260950 | 3300005614 | Bacteria | 1748 |
| 101 | Ga0068856_100827960 | 3300005614 | Bacteria | 945 |
| 102 | Ga0068856_102140325 | 3300005614 | Bacteria | 569 |
| 103 | Ga0068852_100114322 | 3300005616 | Bacteria | 2459 |
| 104 | Ga0068852_100338220 | 3300005616 | Bacteria | 1466 |
| 105 | Ga0068852_100413853 | 3300005616 | Bacteria | 1329 |
| 106 | Ga0068852_100633593 | 3300005616 | Bacteria | 1075 |
| 107 | Ga0068859_101107794 | 3300005617 | Bacteria | 871 |
| 108 | Ga0068861_100649892 | 3300005719 | Bacteria | 974 |
| 109 | Ga0068851_10007628 | 3300005834 | Bacteria | 4975 |
| 110 | Ga0068860_100577804 | 3300005843 | Bacteria | 1128 |
| 111 | Ga0081540_1307989 | 3300005983 | Bacteria | 544 |
| 112 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 113 | Ga0081539_10000250 | 3300005985 | Bacteria | 125352 |
| 114 | Ga0081539_10048041 | 3300005985 | Bacteria | 2431 |
| 115 | Ga0070717_10000355 | 3300006028 | Bacteria | 29408 |
| 116 | Ga0070717_10012461 | 3300006028 | Bacteria | 6485 |
| 117 | Ga0070717_10046462 | 3300006028 | Bacteria | 3552 |
| 118 | Ga0070717_10078841 | 3300006028 | Bacteria | 2761 |
| 119 | Ga0070717_10345799 | 3300006028 | Bacteria | 1329 |
| 120 | Ga0070717_10347901 | 3300006028 | Bacteria | 1325 |
| 121 | Ga0075365_10052962 | 3300006038 | Bacteria | 2686 |
| 122 | Ga0075365_10131145 | 3300006038 | Bacteria | 1735 |
| 123 | Ga0075365_10900513 | 3300006038 | Bacteria | 624 |
| 124 | Ga0075363_100033304 | 3300006048 | Bacteria | 2682 |
| 125 | Ga0075364_10007861 | 3300006051 | Bacteria | 6347 |
| 126 | Ga0075364_10031107 | 3300006051 | Bacteria | 3429 |
| 127 | Ga0075364_10851317 | 3300006051 | Bacteria | 621 |
| 128 | Ga0070715_10085512 | 3300006163 | Bacteria | 1441 |
| 129 | Ga0070716_100323897 | 3300006173 | Bacteria | 1081 |
| 130 | Ga0070716_101787873 | 3300006173 | Bacteria | 509 |
| 131 | Ga0070712_100366486 | 3300006175 | Bacteria | 1183 |
| 132 | Ga0070712_100718546 | 3300006175 | Bacteria | 853 |
| 133 | Ga0070712_101716096 | 3300006175 | Bacteria | 550 |
| 134 | Ga0075362_10453395 | 3300006177 | Bacteria | 652 |
| 135 | Ga0075367_10071534 | 3300006178 | Bacteria | 2086 |
| 136 | Ga0075369_10002297 | 3300006186 | Bacteria | 6796 |
| 137 | Ga0075369_10035863 | 3300006186 | Bacteria | 2109 |
| 138 | Ga0075369_10045900 | 3300006186 | Bacteria | 1880 |
| 139 | Ga0075370_10348564 | 3300006353 | Bacteria | 884 |
| 140 | Ga0068871_101231941 | 3300006358 | Unclassified | 702 |
| 141 | Ga0075434_100179857 | 3300006871 | Bacteria | 2135 |
| 142 | Ga0075434_100579343 | 3300006871 | Bacteria | 1141 |
| 143 | Ga0097620_101107866 | 3300006931 | Bacteria | 871 |
| 144 | Ga0099794_10036362 | 3300007265 | Bacteria | 2327 |
| 145 | Ga0099795_10049461 | 3300007788 | Bacteria | 1526 |
| 146 | Ga0099795_10386968 | 3300007788 | Bacteria | 633 |
| 147 | Ga0099795_10578501 | 3300007788 | Bacteria | 532 |
| 148 | Ga0105240_10004694 | 3300009093 | Bacteria | 20654 |
| 149 | Ga0105240_10014338 | 3300009093 | Bacteria | 10824 |
| 150 | Ga0105240_10084297 | 3300009093 | Bacteria | 3897 |
| 151 | Ga0105240_10492881 | 3300009093 | Bacteria | 1364 |
| 152 | Ga0105240_10756968 | 3300009093 | Bacteria | 1056 |
| 153 | Ga0105240_11357128 | 3300009093 | Bacteria | 748 |
| 154 | Ga0111539_12132211 | 3300009094 | Bacteria | 650 |
| 155 | Ga0105245_10375755 | 3300009098 | Bacteria | 1414 |
| 156 | Ga0105245_12516233 | 3300009098 | Bacteria | 568 |
| 157 | Ga0114129_12984967 | 3300009147 | Bacteria | 557 |
| 158 | Ga0105243_10480226 | 3300009148 | Bacteria | 1173 |
| 159 | Ga0105243_10946623 | 3300009148 | Bacteria | 860 |
| 160 | Ga0105241_10093623 | 3300009174 | Bacteria | 2375 |
| 161 | Ga0105241_10894490 | 3300009174 | Bacteria | 824 |
| 162 | Ga0105241_11906604 | 3300009174 | Bacteria | 583 |
| 163 | Ga0105242_10218695 | 3300009176 | Bacteria | 1701 |
| 164 | Ga0105242_10449777 | 3300009176 | Bacteria | 1214 |
| 165 | Ga0105242_12811762 | 3300009176 | Bacteria | 537 |
| 166 | Ga0105248_10049430 | 3300009177 | Bacteria | 4717 |
| 167 | Ga0105237_10030752 | 3300009545 | Bacteria | 5450 |
| 168 | Ga0105237_10048491 | 3300009545 | Bacteria | 4270 |
| 169 | Ga0105237_10231071 | 3300009545 | Bacteria | 1851 |
| 170 | Ga0105237_10235957 | 3300009545 | Bacteria | 1830 |
| 171 | Ga0105237_11583211 | 3300009545 | Bacteria | 662 |
| 172 | Ga0105238_10007397 | 3300009551 | Bacteria | 11003 |
| 173 | Ga0105238_10023868 | 3300009551 | Bacteria | 6233 |
| 174 | Ga0105238_10215451 | 3300009551 | Bacteria | 1897 |
| 175 | Ga0105238_10606305 | 3300009551 | Bacteria | 1103 |
| 176 | Ga0105249_10166729 | 3300009553 | Bacteria | 2133 |
| 177 | Ga0105249_11301134 | 3300009553 | Bacteria | 798 |
| 178 | Ga0099796_10042515 | 3300010159 | Bacteria | 1544 |
| 179 | Ga0099796_10146099 | 3300010159 | Bacteria | 928 |
| 180 | Ga0105239_10018859 | 3300010375 | Bacteria | 7622 |
| 181 | Ga0105239_10238970 | 3300010375 | Bacteria | 2039 |
| 182 | Ga0105246_10058087 | 3300011119 | Bacteria | 2679 |
| 183 | Ga0105246_10415609 | 3300011119 | Bacteria | 1121 |
| 184 | Ga0157318_1038894 | 3300012482 | Bacteria | 500 |
| 185 | Ga0157373_10758972 | 3300013100 | Bacteria | 713 |
| 186 | Ga0157370_10064213 | 3300013104 | Bacteria | 3476 |
| 187 | Ga0157369_10072277 | 3300013105 | Bacteria | 3702 |
| 188 | Ga0157369_10512265 | 3300013105 | Bacteria | 1241 |
| 189 | Ga0157369_11342317 | 3300013105 | Bacteria | 728 |
| 190 | Ga0157374_10515844 | 3300013296 | Bacteria | 1201 |
| 191 | Ga0157374_11822376 | 3300013296 | Bacteria | 634 |
| 192 | Ga0157374_12888311 | 3300013296 | Bacteria | 508 |
| 193 | Ga0157378_10290428 | 3300013297 | Bacteria | 1579 |
| 194 | Ga0157378_11002433 | 3300013297 | Bacteria | 869 |
| 195 | Ga0157378_11229727 | 3300013297 | Bacteria | 789 |
| 196 | Ga0163162_10907408 | 3300013306 | Bacteria | 994 |
| 197 | Ga0163162_13081175 | 3300013306 | Bacteria | 535 |
| 198 | Ga0157372_10412520 | 3300013307 | Bacteria | 1574 |
| 199 | Ga0157372_11812983 | 3300013307 | Bacteria | 702 |
| 200 | Ga0157375_10437390 | 3300013308 | Bacteria | 1474 |
| 201 | Ga0157375_11228492 | 3300013308 | Bacteria | 880 |
| 202 | Ga0157375_12684788 | 3300013308 | Bacteria | 595 |
| 203 | Ga0163163_10693498 | 3300014325 | Bacteria | 1082 |
| 204 | Ga0182008_10718014 | 3300014497 | Bacteria | 572 |
| 205 | Ga0157379_11017902 | 3300014968 | Bacteria | 790 |
| 206 | Ga0163161_10305982 | 3300017792 | Bacteria | 1253 |
| 207 | Ga0206353_11182322 | 3300020082 | Bacteria | 1077 |
| 208 | Ga0213876_10173952 | 3300021384 | Bacteria | 1146 |
| 209 | Ga0228599_109105 | 3300022729 | Bacteria | 530 |
| 210 | Ga0224572_1024785 | 3300024225 | Bacteria | 1152 |
| 211 | Ga0207425_1011029 | 3300025245 | Bacteria | 2176 |
| 212 | Ga0207425_1026204 | 3300025245 | Bacteria | 1198 |
| 213 | Ga0209564_1008984 | 3300025295 | Bacteria | 4833 |
| 214 | Ga0209564_1015801 | 3300025295 | Bacteria | 3049 |
| 215 | Ga0209564_1027871 | 3300025295 | Bacteria | 1822 |
| 216 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 217 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 218 | Ga0209758_1000209 | 3300025297 | Bacteria | 128038 |
| 219 | Ga0209256_1002188 | 3300025299 | Bacteria | 16757 |
| 220 | Ga0209256_1003782 | 3300025299 | Bacteria | 10194 |
| 221 | Ga0209256_1094889 | 3300025299 | Bacteria | 628 |
| 222 | Ga0207426_1004534 | 3300025302 | Bacteria | 6721 |
| 223 | Ga0207426_1018923 | 3300025302 | Bacteria | 2417 |
| 224 | Ga0207426_1070356 | 3300025302 | Bacteria | 978 |
| 225 | Ga0209257_1000620 | 3300025304 | Bacteria | 57327 |
| 226 | Ga0209257_1001645 | 3300025304 | Bacteria | 25504 |
| 227 | Ga0207697_10028208 | 3300025315 | Bacteria | 2296 |
| 228 | Ga0207656_10004840 | 3300025321 | Bacteria | 4729 |
| 229 | Ga0207688_11074974 | 3300025901 | Bacteria | 508 |
| 230 | Ga0207680_10590998 | 3300025903 | Bacteria | 794 |
| 231 | Ga0207647_10024774 | 3300025904 | Bacteria | 3953 |
| 232 | Ga0207647_10510502 | 3300025904 | Bacteria | 669 |
| 233 | Ga0207647_10638556 | 3300025904 | Bacteria | 585 |
| 234 | Ga0207685_10209634 | 3300025905 | Bacteria | 920 |
| 235 | Ga0207699_10242404 | 3300025906 | Bacteria | 1239 |
| 236 | Ga0207643_11104940 | 3300025908 | Bacteria | 511 |
| 237 | Ga0207705_10033639 | 3300025909 | Bacteria | 3663 |
| 238 | Ga0207705_10046081 | 3300025909 | Bacteria | 3133 |
| 239 | Ga0207705_10884677 | 3300025909 | Unclassified | 692 |
| 240 | Ga0207707_10000706 | 3300025912 | Bacteria | 33199 |
| 241 | Ga0207707_10113336 | 3300025912 | Bacteria | 2370 |
| 242 | Ga0207707_10676321 | 3300025912 | Bacteria | 868 |
| 243 | Ga0207707_10720220 | 3300025912 | Bacteria | 836 |
| 244 | Ga0207695_10096049 | 3300025913 | Bacteria | 2966 |
| 245 | Ga0207695_10100277 | 3300025913 | Bacteria | 2892 |
| 246 | Ga0207695_10558583 | 3300025913 | Bacteria | 1026 |
| 247 | Ga0207671_10019453 | 3300025914 | Bacteria | 5190 |
| 248 | Ga0207671_10085932 | 3300025914 | Bacteria | 2364 |
| 249 | Ga0207671_10398364 | 3300025914 | Bacteria | 1095 |
| 250 | Ga0207671_10992075 | 3300025914 | Bacteria | 662 |
| 251 | Ga0207693_10299821 | 3300025915 | Bacteria | 1259 |
| 252 | Ga0207693_10609962 | 3300025915 | Bacteria | 849 |
| 253 | Ga0207663_10542876 | 3300025916 | Bacteria | 908 |
| 254 | Ga0207660_10012021 | 3300025917 | Bacteria | 5655 |
| 255 | Ga0207660_10314918 | 3300025917 | Bacteria | 1248 |
| 256 | Ga0207660_10663157 | 3300025917 | Bacteria | 851 |
| 257 | Ga0207657_10004672 | 3300025919 | Bacteria | 14460 |
| 258 | Ga0207657_10673933 | 3300025919 | Bacteria | 804 |
| 259 | Ga0207649_11400722 | 3300025920 | Bacteria | 553 |
| 260 | Ga0207652_10001458 | 3300025921 | Bacteria | 20929 |
| 261 | Ga0207652_10652805 | 3300025921 | Bacteria | 941 |
| 262 | Ga0207681_10594033 | 3300025923 | Bacteria | 914 |
| 263 | Ga0207681_11011066 | 3300025923 | Bacteria | 698 |
| 264 | Ga0207694_10009977 | 3300025924 | Bacteria | 7159 |
| 265 | Ga0207694_10143082 | 3300025924 | Bacteria | 1924 |
| 266 | Ga0207694_10461679 | 3300025924 | Bacteria | 1061 |
| 267 | Ga0207650_10334423 | 3300025925 | Bacteria | 1243 |
| 268 | Ga0207659_10274629 | 3300025926 | Bacteria | 1376 |
| 269 | Ga0207700_10004801 | 3300025928 | Bacteria | 8020 |
| 270 | Ga0207700_10236735 | 3300025928 | Bacteria | 1555 |
| 271 | Ga0207700_10360259 | 3300025928 | Bacteria | 1268 |
| 272 | Ga0207664_10174682 | 3300025929 | Bacteria | 1841 |
| 273 | Ga0207664_10355352 | 3300025929 | Bacteria | 1297 |
| 274 | Ga0207644_11643067 | 3300025931 | Bacteria | 539 |
| 275 | Ga0207690_10292599 | 3300025932 | Bacteria | 1272 |
| 276 | Ga0207690_10318288 | 3300025932 | Bacteria | 1222 |
| 277 | Ga0207706_10149265 | 3300025933 | Bacteria | 2056 |
| 278 | Ga0207704_11933135 | 3300025938 | Bacteria | 507 |
| 279 | Ga0207691_10411954 | 3300025940 | Bacteria | 1152 |
| 280 | Ga0207691_11621650 | 3300025940 | Bacteria | 526 |
| 281 | Ga0207711_10239515 | 3300025941 | Bacteria | 1663 |
| 282 | Ga0207661_10055049 | 3300025944 | Bacteria | 3189 |
| 283 | Ga0207679_11304427 | 3300025945 | Bacteria | 666 |
| 284 | Ga0207679_12157524 | 3300025945 | Bacteria | 506 |
| 285 | Ga0207667_10006413 | 3300025949 | Bacteria | 14251 |
| 286 | Ga0207667_10605435 | 3300025949 | Bacteria | 1105 |
| 287 | Ga0207667_12252186 | 3300025949 | Bacteria | 501 |
| 288 | Ga0207651_10215394 | 3300025960 | Bacteria | 1549 |
| 289 | Ga0207651_10700957 | 3300025960 | Bacteria | 892 |
| 290 | Ga0207712_10813815 | 3300025961 | Bacteria | 822 |
| 291 | Ga0207668_12042859 | 3300025972 | Bacteria | 516 |
| 292 | Ga0207640_10228810 | 3300025981 | Bacteria | 1429 |
| 293 | Ga0207640_10708628 | 3300025981 | Bacteria | 864 |
| 294 | Ga0207640_10830019 | 3300025981 | Bacteria | 803 |
| 295 | Ga0207640_11688245 | 3300025981 | Bacteria | 572 |
| 296 | Ga0207658_10116748 | 3300025986 | Bacteria | 2120 |
| 297 | Ga0207677_10427979 | 3300026023 | Bacteria | 1129 |
| 298 | Ga0207639_10176988 | 3300026041 | Bacteria | 1811 |
| 299 | Ga0207639_10468728 | 3300026041 | Bacteria | 1146 |
| 300 | Ga0207639_12062591 | 3300026041 | Bacteria | 531 |
| 301 | Ga0207678_10073518 | 3300026067 | Bacteria | 2930 |
| 302 | Ga0207678_10552613 | 3300026067 | Bacteria | 1007 |
| 303 | Ga0207678_10654004 | 3300026067 | Bacteria | 923 |
| 304 | Ga0207678_10658684 | 3300026067 | Bacteria | 920 |
| 305 | Ga0207678_11151668 | 3300026067 | Unclassified | 687 |
| 306 | Ga0207678_11789197 | 3300026067 | Bacteria | 538 |
| 307 | Ga0207702_10224002 | 3300026078 | Bacteria | 1754 |
| 308 | Ga0207702_12055886 | 3300026078 | Bacteria | 561 |
| 309 | Ga0207674_10025123 | 3300026116 | Bacteria | 6357 |
| 310 | Ga0207674_10089393 | 3300026116 | Bacteria | 3073 |
| 311 | Ga0207675_101331309 | 3300026118 | Bacteria | 739 |
| 312 | Ga0207683_10387368 | 3300026121 | Bacteria | 1285 |
| 313 | Ga0207698_10028257 | 3300026142 | Bacteria | 3997 |
| 314 | Ga0207698_11093214 | 3300026142 | Bacteria | 810 |
| 315 | Ga0207698_12141644 | 3300026142 | Bacteria | 572 |
| 316 | Ga0209389_1000412 | 3300027296 | Bacteria | 25422 |
| 317 | Ga0209589_1004063 | 3300027357 | Bacteria | 25422 |
| 318 | Ga0209489_100090 | 3300027361 | Bacteria | 123931 |
| 319 | Ga0209588_1079520 | 3300027671 | Bacteria | 1059 |
| 320 | Ga0209813_10174571 | 3300027866 | Bacteria | 783 |
| 321 | Ga0268266_12229898 | 3300028379 | Bacteria | 519 |
| 322 | Ga0268264_10210877 | 3300028381 | Bacteria | 1783 |
| 323 | Ga0268264_12086081 | 3300028381 | Bacteria | 576 |
| 324 | Ga0265334_10156826 | 3300028573 | Bacteria | 801 |
| 325 | Ga0307515_10145873 | 3300028794 | Bacteria | 2507 |
| 326 | Ga0265330_10008738 | 3300031235 | Bacteria | 4856 |
| 327 | Ga0265330_10048506 | 3300031235 | Bacteria | 1867 |
| 328 | Ga0265330_10156047 | 3300031235 | Bacteria | 969 |
| 329 | Ga0265332_10043894 | 3300031238 | Bacteria | 1929 |
| 330 | Ga0265328_10053588 | 3300031239 | Bacteria | 1480 |
| 331 | Ga0265325_10047163 | 3300031241 | Bacteria | 2231 |
| 332 | Ga0265340_10109609 | 3300031247 | Bacteria | 1277 |
| 333 | Ga0265339_10075924 | 3300031249 | Bacteria | 1783 |
| 334 | Ga0265339_10404020 | 3300031249 | Bacteria | 638 |
| 335 | Ga0265339_10503851 | 3300031249 | Bacteria | 559 |
| 336 | Ga0265331_10121242 | 3300031250 | Bacteria | 1196 |
| 337 | Ga0265316_10550171 | 3300031344 | Bacteria | 821 |
| 338 | Ga0265316_10962008 | 3300031344 | Bacteria | 595 |
| 339 | Ga0307509_10367591 | 3300031507 | Bacteria | 1156 |
| 340 | Ga0265313_10027902 | 3300031595 | Bacteria | 2947 |
| 341 | Ga0307508_10009028 | 3300031616 | Bacteria | 9185 |
| 342 | Ga0265314_10720745 | 3300031711 | Bacteria | 503 |
| 343 | Ga0265342_10052401 | 3300031712 | Bacteria | 2432 |
| 344 | Ga0265342_10061317 | 3300031712 | Bacteria | 2216 |
| 345 | Ga0265342_10087530 | 3300031712 | Bacteria | 1790 |
| 346 | Ga0307516_10143486 | 3300031730 | Bacteria | 2155 |
| 347 | Ga0316044_120212 | 3300031810 | Bacteria | 692 |
| 348 | Ga0316215_1004213 | 3300033544 | Bacteria | 1376 |
| 349 | Ga0316213_1006616 | 3300033546 | Bacteria | 775 |
| 350 | Ga0373934_0002445 | 3300035086 | Bacteria | 6829 |
| 351 | Ga0373923_0000271 | 3300035111 | Bacteria | 11341 |
| 352 | Ga0373953_0000155 | 3300035117 | Bacteria | 17696 |
| 353 | Ga0373954_0000450 | 3300035118 | Bacteria | 15397 |
| 354 | Ga0373956_0354398 | 3300035119 | Bacteria | 699 |
| 355 | Ga0373957_0000533 | 3300035120 | Bacteria | 9602 |
| 356 | Ga0373955_0001317 | 3300035172 | Bacteria | 10523 |
| 357 | Ga0373924_0002189 | 3300035410 | Bacteria | 6547 |
| 358 | Ga0373933_0010648 | 3300035724 | Bacteria | 5043 |
| 359 | Ga0373937_0008674 | 3300036401 | Bacteria | 8833 |
| 360 | Ga0373937_0060546 | 3300036401 | Bacteria | 3479 |
| 361 | Ga0395900_0152094 | 3300037418 | Bacteria | 2364 |
| 362 | Ga0395898_0072855 | 3300037466 | Bacteria | 3318 |
| 363 | Ga0395901_0442780 | 3300038443 | Bacteria | 1330 |
| 364 | Ga0436365_0429661 | 3300039437 | Bacteria | 1269 |
| 365 | Ga0436365_0606176 | 3300039437 | Bacteria | 1694 |
| 366 | Ga0436365_1199722 | 3300039437 | Bacteria | 646 |
| 367 | Ga0436363_0478130 | 3300039450 | Bacteria | 669 |
| 368 | Ga0436363_0537045 | 3300039450 | Bacteria | 617 |
| 369 | Ga0451807_2513845 | 3300041486 | Bacteria | 611 |
| 370 | Ga0451837_1823684 | 3300041494 | Bacteria | 1044 |
| 371 | Ga0451849_0768268 | 3300041505 | Bacteria | 514 |
| 372 | Ga0451843_0195165 | 3300041509 | Bacteria | 687 |
| 373 | Ga0451855_1969055 | 3300041511 | Bacteria | 564 |
| 374 | Ga0439448_0318543 | 3300042005 | Bacteria | 553 |
| 375 | Ga0439455_0226718 | 3300042012 | Bacteria | 544 |
| 376 | Ga0439464_0291602 | 3300042439 | Bacteria | 532 |
| 377 | Ga0466972_0012408 | 3300044658 | Bacteria | 4281 |
| 378 | Ga0466972_0213342 | 3300044658 | Bacteria | 903 |
| 379 | Ga0466968_0009585 | 3300044735 | Bacteria | 3728 |
| 380 | Ga0466960_0038044 | 3300044901 | Bacteria | 2260 |
| 381 | Ga0466960_0620221 | 3300044901 | Bacteria | 643 |
| 382 | Ga0495592_0008383 | 3300046454 | Bacteria | 7751 |
| 383 | Ga0495629_0000816 | 3300046459 | Bacteria | 25236 |
| 384 | Ga0495651_0004762 | 3300046462 | Bacteria | 10383 |
| 385 | Ga0495653_0013624 | 3300046463 | Bacteria | 6626 |
| 386 | Ga0495662_0340839 | 3300046476 | Bacteria | 737 |
| 387 | Ga0495606_0007723 | 3300046507 | Bacteria | 9526 |
| 388 | Ga0495608_0002302 | 3300046511 | Bacteria | 13786 |
| 389 | Ga0495618_0144227 | 3300046514 | Bacteria | 1523 |
| 390 | Ga0495628_0041829 | 3300046516 | Bacteria | 3657 |
| 391 | Ga0495631_0166715 | 3300046518 | Bacteria | 945 |
| 392 | Ga0495648_0001509 | 3300046524 | Bacteria | 22791 |
| 393 | Ga0495652_0004898 | 3300046529 | Bacteria | 12707 |
| 394 | Ga0495640_0003100 | 3300046533 | Bacteria | 13411 |
| 395 | Ga0495587_0002199 | 3300046536 | Bacteria | 13040 |
| 396 | Ga0495587_0159307 | 3300046536 | Bacteria | 1285 |
| 397 | Ga0495587_0182439 | 3300046536 | Bacteria | 1190 |
| 398 | Ga0495597_0122749 | 3300046542 | Bacteria | 1082 |
| 399 | Ga0495645_0012964 | 3300046543 | Bacteria | 5883 |
| 400 | Ga0495667_0000496 | 3300046559 | Bacteria | 25130 |
| 401 | Ga0495668_0023647 | 3300046616 | Bacteria | 3502 |
| 402 | Ga0495634_0024070 | 3300046642 | Bacteria | 4276 |
| 403 | Ga0495635_0000962 | 3300046663 | Bacteria | 19021 |
| 404 | Ga0495657_0013532 | 3300046675 | Bacteria | 6015 |
| 405 | Ga0495657_0867065 | 3300046675 | Bacteria | 514 |
| 406 | Ga0495599_0004531 | 3300046678 | Bacteria | 8239 |
| 407 | Ga0495623_0004417 | 3300046679 | Bacteria | 9241 |
| 408 | Ga0495623_0470858 | 3300046679 | Bacteria | 666 |
| 409 | Ga0495613_0100570 | 3300046689 | Bacteria | 2088 |
| 410 | Ga0495600_0023717 | 3300046809 | Bacteria | 3947 |
| 411 | Ga0495600_0024832 | 3300046809 | Bacteria | 3858 |
| 412 | Ga0495604_0002548 | 3300047317 | Bacteria | 14556 |
| 413 | Ga0495674_0040029 | 3300047319 | Bacteria | 4196 |
| 414 | Ga0495680_0004880 | 3300047322 | Bacteria | 12700 |
| 415 | Ga0495687_010132 | 3300047443 | Bacteria | 5193 |
| 416 | Ga0495675_0001715 | 3300047444 | Bacteria | 13111 |
| 417 | Ga0495675_0365258 | 3300047444 | Bacteria | 847 |
| 418 | Ga0495684_0000695 | 3300047471 | Bacteria | 27007 |
| 419 | Ga0495593_0001764 | 3300047673 | Bacteria | 12813 |
| 420 | Ga0495602_0005179 | 3300048088 | Bacteria | 13659 |
| 421 | Ga0495602_0392303 | 3300048088 | Bacteria | 992 |
| 422 | Ga0496102_0154285 | 3300048905 | Bacteria | 2158 |
| 423 | Ga0496102_1271943 | 3300048905 | Bacteria | 655 |
| 424 | Ga0496103_0003807 | 3300048906 | Bacteria | 9179 |
| 425 | Ga0496103_0484519 | 3300048906 | Bacteria | 792 |
| 426 | Ga0496104_0174135 | 3300048907 | Bacteria | 2062 |
| 427 | Ga0496106_0515356 | 3300048909 | Bacteria | 960 |
| 428 | Ga0496107_0035717 | 3300048910 | Bacteria | 3564 |
| 429 | Ga0496108_0032425 | 3300048911 | Bacteria | 4339 |
| 430 | Ga0496109_0036560 | 3300048912 | Bacteria | 4433 |
| 431 | Ga0496110_0142828 | 3300048913 | Bacteria | 2164 |
| 432 | Ga0496110_1053294 | 3300048913 | Bacteria | 721 |
| 433 | Ga0496111_0240247 | 3300048914 | Bacteria | 1345 |
| 434 | Ga0496111_0566498 | 3300048914 | Bacteria | 833 |
| 435 | Ga0496112_0000029 | 3300048915 | Bacteria | 122291 |
| 436 | Ga0496112_0040806 | 3300048915 | Bacteria | 4538 |
| 437 | Ga0496112_1531303 | 3300048915 | Bacteria | 580 |
| 438 | Ga0496113_0129816 | 3300048916 | Bacteria | 1976 |
| 439 | Ga0496115_0024573 | 3300048918 | Bacteria | 4685 |
| 440 | Ga0496115_0094488 | 3300048918 | Bacteria | 2446 |
| 441 | Ga0496116_0004251 | 3300048919 | Bacteria | 13742 |
| 442 | Ga0496117_0012698 | 3300048920 | Bacteria | 7397 |
| 443 | Ga0496117_0202496 | 3300048920 | Bacteria | 1120 |
| 444 | Ga0496118_0027495 | 3300048921 | Bacteria | 4812 |
| 445 | Ga0496119_0214815 | 3300048922 | Bacteria | 987 |
| 446 | Ga0496121_0100896 | 3300048924 | Bacteria | 2227 |
| 447 | Ga0496123_0086666 | 3300048926 | Bacteria | 1877 |
| 448 | Ga0496124_0058363 | 3300048927 | Bacteria | 3246 |
| 449 | Ga0496124_0135441 | 3300048927 | Bacteria | 1951 |
| 450 | Ga0496124_0358662 | 3300048927 | Bacteria | 1028 |
| 451 | Ga0496125_0001204 | 3300048928 | Bacteria | 38897 |
| 452 | Ga0496125_0015991 | 3300048928 | Bacteria | 7225 |
| 453 | Ga0496125_0048428 | 3300048928 | Bacteria | 3544 |
| 454 | Ga0496126_0029913 | 3300048929 | Bacteria | 5169 |
| 455 | Ga0496126_0148059 | 3300048929 | Bacteria | 2014 |
| 456 | nmdc:mga03683_469450_c1 | 3300050489 | Bacteria | 607 |
| 457 | nmdc:mga00v17_4195_c1 | 3300050491 | Bacteria | 6144 |
| 458 | nmdc:mga0yw44_478371_c1 | 3300050492 | Bacteria | 845 |
| 459 | nmdc:mga0yw44_60293_c1 | 3300050492 | Bacteria | 2324 |
| 460 | nmdc:mga0k408_828135_c1 | 3300050493 | Bacteria | 539 |
| 461 | nmdc:mga07m45_164970_c1 | 3300050496 | Bacteria | 1287 |
| 462 | nmdc:mga0sz30_1155_c1 | 3300050516 | Bacteria | 9461 |
| 463 | nmdc:mga0sz30_232354_c1 | 3300050516 | Bacteria | 821 |
| 464 | Ga0495601_0002394 | 3300053077 | Bacteria | 10645 |
| 465 | Ga0495601_0501526 | 3300053077 | Bacteria | 783 |
| 466 | Ga0495601_0674139 | 3300053077 | Bacteria | 661 |
| 467 | Ga0495612_0007364 | 3300053078 | Bacteria | 4498 |
| 468 | Ga0495655_0071001 | 3300053083 | Bacteria | 974 |
| 469 | Ga0495595_0000887 | 3300053084 | Bacteria | 11505 |
| 470 | Ga0495619_0002038 | 3300053085 | Bacteria | 13427 |
| 471 | Ga0495619_0211024 | 3300053085 | Bacteria | 1345 |
| 472 | Ga0500651_0355522 | 3300053093 | Bacteria | 830 |
| 473 | Ga0500566_0004519 | 3300053094 | Bacteria | 8307 |
| 474 | Ga0500607_131099 | 3300053121 | Bacteria | 1195 |
| 475 | Ga0500608_000229 | 3300053122 | Bacteria | 22140 |
| 476 | Ga0500618_084854 | 3300053125 | Bacteria | 711 |
| 477 | Ga0500559_0000105 | 3300053136 | Bacteria | 65809 |
| 478 | Ga0500586_028805 | 3300053145 | Bacteria | 1816 |
| 479 | Ga0500589_130580 | 3300053147 | Bacteria | 1050 |
| 480 | Ga0500638_317312 | 3300053162 | Bacteria | 593 |
| 481 | Ga0500636_0002483 | 3300053177 | Bacteria | 10235 |
| 482 | Ga0500637_0104449 | 3300053178 | Bacteria | 1643 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005455 | Ga0070663_100327493 | Ga0070663_1003274931 | 47 |
| 2 | 3300006038 | Ga0075365_10131145 | Ga0075365_101311451 | 47 |
| 3 | 3300026116 | Ga0207674_10089393 | Ga0207674_100893934 | 48 |
| 4 | 3300005564 | Ga0070664_100430070 | Ga0070664_1004300703 | 49 |
| 5 | 3300005616 | Ga0068852_100413853 | Ga0068852_1004138533 | 49 |
| 6 | 3300009093 | Ga0105240_11357128 | Ga0105240_113571281 | 49 |
| 7 | 3300009148 | Ga0105243_10946623 | Ga0105243_109466232 | 49 |
| 8 | 3300013105 | Ga0157369_11342317 | Ga0157369_113423172 | 49 |
| 9 | 3300013307 | Ga0157372_11812983 | Ga0157372_118129832 | 49 |
| 10 | 3300048915 | Ga0496112_1531303 | Ga0496112_1531303_389_538 | 49 |
| 11 | 3300048918 | Ga0496115_0094488 | Ga0496115_0094488_1622_1771 | 49 |
| 12 | iso_pu_bacteria | 2524023205 | 2524436422 | 49 |
| 13 | iso_pu_bacteria | 2617270735 | 2617346623 | 49 |
| 14 | iso_pu_bacteria | 2744054633 | 2745080624 | 49 |
| 15 | iso_pu_bacteria | 2791355196 | 2793064522 | 49 |
| 16 | iso_pu_bacteria | 2824679649 | 2824681450 | 49 |
| 17 | iso_pu_bacteria | 2824704595 | 2824713147 | 49 |
| 18 | iso_pu_bacteria | 2824753945 | 2824763401 | 49 |
| 19 | iso_pu_bacteria | 2824763712 | 2824773121 | 49 |
| 20 | iso_pu_bacteria | 2874612657 | 2874614757 | 49 |
| 21 | iso_pu_bacteria | 2904711408 | 2904714774 | 49 |
| 22 | iso_pu_bacteria | 2922393267 | 2922397247 | 49 |
| 23 | iso_pu_bacteria | 3005506211 | 3005508589 | 49 |
| 24 | 3300005614 | Ga0068856_100827960 | Ga0068856_1008279602 | 50 |
| 25 | 3300007788 | Ga0099795_10049461 | Ga0099795_100494612 | 50 |
| 26 | iso_pu_bacteria | 2507262055 | 2507505957 | 50 |
| 27 | iso_pu_bacteria | 2507262055 | 2507511452 | 50 |
| 28 | iso_pu_bacteria | 2513237092 | 2513624061 | 50 |
| 29 | iso_pu_bacteria | 2513237092 | 2513624865 | 50 |
| 30 | iso_pu_bacteria | 2513237095 | 2513648439 | 50 |
| 31 | iso_pu_bacteria | 2513237095 | 2513649137 | 50 |
| 32 | iso_pu_bacteria | 2513237102 | 2513700203 | 50 |
| 33 | iso_pu_bacteria | 2513237102 | 2513704261 | 50 |
| 34 | iso_pu_bacteria | 2513237104 | 2513717239 | 50 |
| 35 | iso_pu_bacteria | 2513237139 | 2513875050 | 50 |
| 36 | iso_pu_bacteria | 2513237139 | 2513876583 | 50 |
| 37 | iso_pu_bacteria | 2513237161 | 2514010919 | 50 |
| 38 | iso_pu_bacteria | 2513237161 | 2514013878 | 50 |
| 39 | iso_pu_bacteria | 2517093001 | 2517103143 | 50 |
| 40 | iso_pu_bacteria | 2528768022 | 2528850725 | 50 |
| 41 | iso_pu_bacteria | 2617270735 | 2617352853 | 50 |
| 42 | iso_pu_bacteria | 2617270741 | 2617374927 | 50 |
| 43 | iso_pu_bacteria | 2791355196 | 2793061343 | 50 |
| 44 | iso_pu_bacteria | 2791355196 | 2793061509 | 50 |
| 45 | iso_pu_bacteria | 2791355196 | 2793063951 | 50 |
| 46 | iso_pu_bacteria | 2791355196 | 2793064647 | 50 |
| 47 | iso_pu_bacteria | 2802429603 | 2805916360 | 50 |
| 48 | iso_pu_bacteria | 2802429603 | 2805919838 | 50 |
| 49 | iso_pu_bacteria | 2816332527 | 2818240021 | 50 |
| 50 | iso_pu_bacteria | 2816332527 | 2818240528 | 50 |
| 51 | iso_pu_bacteria | 2824600985 | 2824603661 | 50 |
| 52 | iso_pu_bacteria | 2824609381 | 2824610753 | 50 |
| 53 | iso_pu_bacteria | 2824617872 | 2824626062 | 50 |
| 54 | iso_pu_bacteria | 2824617872 | 2824626199 | 50 |
| 55 | iso_pu_bacteria | 2824626560 | 2824632171 | 50 |
| 56 | iso_pu_bacteria | 2824626560 | 2824634789 | 50 |
| 57 | iso_pu_bacteria | 2824635225 | 2824642867 | 50 |
| 58 | iso_pu_bacteria | 2824635225 | 2824643426 | 50 |
| 59 | iso_pu_bacteria | 2824644064 | 2824650808 | 50 |
| 60 | iso_pu_bacteria | 2824644064 | 2824651401 | 50 |
| 61 | iso_pu_bacteria | 2824653114 | 2824660514 | 50 |
| 62 | iso_pu_bacteria | 2824661429 | 2824666866 | 50 |
| 63 | iso_pu_bacteria | 2824671348 | 2824676146 | 50 |
| 64 | iso_pu_bacteria | 2824671348 | 2824677246 | 50 |
| 65 | iso_pu_bacteria | 2824671348 | 2824678606 | 50 |
| 66 | iso_pu_bacteria | 2824679649 | 2824685987 | 50 |
| 67 | iso_pu_bacteria | 2824687955 | 2824691837 | 50 |
| 68 | iso_pu_bacteria | 2824687955 | 2824694519 | 50 |
| 69 | iso_pu_bacteria | 2824696289 | 2824699434 | 50 |
| 70 | iso_pu_bacteria | 2824696289 | 2824702233 | 50 |
| 71 | iso_pu_bacteria | 2824696289 | 2824703731 | 50 |
| 72 | iso_pu_bacteria | 2824704595 | 2824712788 | 50 |
| 73 | iso_pu_bacteria | 2824714736 | 2824720653 | 50 |
| 74 | iso_pu_bacteria | 2824714736 | 2824721911 | 50 |
| 75 | iso_pu_bacteria | 2824723954 | 2824730906 | 50 |
| 76 | iso_pu_bacteria | 2824723954 | 2824731730 | 50 |
| 77 | iso_pu_bacteria | 2824732956 | 2824738509 | 50 |
| 78 | iso_pu_bacteria | 2824746037 | 2824752511 | 50 |
| 79 | iso_pu_bacteria | 2824753945 | 2824763300 | 50 |
| 80 | iso_pu_bacteria | 2824763712 | 2824773173 | 50 |
| 81 | iso_pu_bacteria | 2824773399 | 2824779343 | 50 |
| 82 | iso_pu_bacteria | 2824773399 | 2824781187 | 50 |
| 83 | iso_pu_bacteria | 2838122688 | 2838126420 | 50 |
| 84 | iso_pu_bacteria | 2838122688 | 2838129975 | 50 |
| 85 | iso_pu_bacteria | 2841941048 | 2841943173 | 50 |
| 86 | iso_pu_bacteria | 2841941048 | 2841943506 | 50 |
| 87 | iso_pu_bacteria | 2841941048 | 2841947014 | 50 |
| 88 | iso_pu_bacteria | 2841949485 | 2841950547 | 50 |
| 89 | iso_pu_bacteria | 2841949485 | 2841955055 | 50 |
| 90 | iso_pu_bacteria | 2841949485 | 2841956194 | 50 |
| 91 | iso_pu_bacteria | 2841957949 | 2841960235 | 50 |
| 92 | iso_pu_bacteria | 2841957949 | 2841963986 | 50 |
| 93 | iso_pu_bacteria | 2841966195 | 2841966861 | 50 |
| 94 | iso_pu_bacteria | 2841966195 | 2841968186 | 50 |
| 95 | iso_pu_bacteria | 2841966195 | 2841970012 | 50 |
| 96 | iso_pu_bacteria | 2841974524 | 2841975611 | 50 |
| 97 | iso_pu_bacteria | 2841974524 | 2841976604 | 50 |
| 98 | iso_pu_bacteria | 2841974524 | 2841977346 | 50 |
| 99 | iso_pu_bacteria | 2841983080 | 2841987977 | 50 |
| 100 | iso_pu_bacteria | 2841983080 | 2841988182 | 50 |
| 101 | iso_pu_bacteria | 2841983080 | 2841990240 | 50 |
| 102 | iso_pu_bacteria | 2844315083 | 2844316296 | 50 |
| 103 | iso_pu_bacteria | 2847930680 | 2847939401 | 50 |
| 104 | iso_pu_bacteria | 2847939898 | 2847943798 | 50 |
| 105 | iso_pu_bacteria | 2847939898 | 2847944253 | 50 |
| 106 | iso_pu_bacteria | 2847939898 | 2847945965 | 50 |
| 107 | iso_pu_bacteria | 2849076700 | 2849081514 | 50 |
| 108 | iso_pu_bacteria | 2849076700 | 2849081967 | 50 |
| 109 | iso_pu_bacteria | 2857509624 | 2857513376 | 50 |
| 110 | iso_pu_bacteria | 2857524615 | 2857525565 | 50 |
| 111 | iso_pu_bacteria | 2874612657 | 2874615274 | 50 |
| 112 | iso_pu_bacteria | 2874612657 | 2874616492 | 50 |
| 113 | iso_pu_bacteria | 2874628541 | 2874633418 | 50 |
| 114 | iso_pu_bacteria | 2876761206 | 2876763703 | 50 |
| 115 | iso_pu_bacteria | 2876761206 | 2876765444 | 50 |
| 116 | iso_pu_bacteria | 2879083081 | 2879087074 | 50 |
| 117 | iso_pu_bacteria | 2879099564 | 2879104404 | 50 |
| 118 | iso_pu_bacteria | 2888378607 | 2888387027 | 50 |
| 119 | iso_pu_bacteria | 2888378607 | 2888387205 | 50 |
| 120 | iso_pu_bacteria | 2888388044 | 2888394507 | 50 |
| 121 | iso_pu_bacteria | 2888419890 | 2888421213 | 50 |
| 122 | iso_pu_bacteria | 2903727486 | 2903728369 | 50 |
| 123 | iso_pu_bacteria | 2904711408 | 2904719779 | 50 |
| 124 | iso_pu_bacteria | 2906602504 | 2906606509 | 50 |
| 125 | iso_pu_bacteria | 2906626472 | 2906629287 | 50 |
| 126 | iso_pu_bacteria | 2906626472 | 2906631399 | 50 |
| 127 | iso_pu_bacteria | 2906643746 | 2906646746 | 50 |
| 128 | iso_pu_bacteria | 2908775508 | 2908777412 | 50 |
| 129 | iso_pu_bacteria | 2919073203 | 2919074627 | 50 |
| 130 | iso_pu_bacteria | 2919073203 | 2919079442 | 50 |
| 131 | iso_pu_bacteria | 2922368715 | 2922377386 | 50 |
| 132 | iso_pu_bacteria | 2922393267 | 2922398311 | 50 |
| 133 | iso_pu_bacteria | 2929615660 | 2929619593 | 50 |
| 134 | iso_pu_bacteria | 2929615660 | 2929622174 | 50 |
| 135 | iso_pu_bacteria | 2929624759 | 2929627937 | 50 |
| 136 | iso_pu_bacteria | 2929624759 | 2929630179 | 50 |
| 137 | iso_pu_bacteria | 2932784394 | 2932787893 | 50 |
| 138 | iso_pu_bacteria | 2932809354 | 2932817618 | 50 |
| 139 | iso_pu_bacteria | 2932818245 | 2932826222 | 50 |
| 140 | iso_pu_bacteria | 2932828146 | 2932835079 | 50 |
| 141 | iso_pu_bacteria | 2933577622 | 2933584211 | 50 |
| 142 | iso_pu_bacteria | 2935616580 | 2935620456 | 50 |
| 143 | iso_pu_bacteria | 2935638405 | 2935640779 | 50 |
| 144 | iso_pu_bacteria | 2935665750 | 2935670282 | 50 |
| 145 | iso_pu_bacteria | 2935675223 | 2935679712 | 50 |
| 146 | iso_pu_bacteria | 2935684952 | 2935687281 | 50 |
| 147 | iso_pu_bacteria | 2935694250 | 2935696748 | 50 |
| 148 | iso_pu_bacteria | 2935703347 | 2935709160 | 50 |
| 149 | iso_pu_bacteria | 2935713505 | 2935718740 | 50 |
| 150 | iso_pu_bacteria | 2935722832 | 2935728392 | 50 |
| 151 | iso_pu_bacteria | 2935732158 | 2935737011 | 50 |
| 152 | iso_pu_bacteria | 2935741537 | 2935745986 | 50 |
| 153 | iso_pu_bacteria | 2935750917 | 2935753247 | 50 |
| 154 | iso_pu_bacteria | 2935760218 | 2935766361 | 50 |
| 155 | iso_pu_bacteria | 2935769743 | 2935770247 | 50 |
| 156 | iso_pu_bacteria | 2935769743 | 2935770411 | 50 |
| 157 | iso_pu_bacteria | 2935777560 | 2935777725 | 50 |
| 158 | iso_pu_bacteria | 2935777560 | 2935782560 | 50 |
| 159 | iso_pu_bacteria | 2935785616 | 2935786536 | 50 |
| 160 | iso_pu_bacteria | 2935785616 | 2935786700 | 50 |
| 161 | iso_pu_bacteria | 2935793552 | 2935794591 | 50 |
| 162 | iso_pu_bacteria | 2935793552 | 2935794754 | 50 |
| 163 | iso_pu_bacteria | 2935801545 | 2935809042 | 50 |
| 164 | iso_pu_bacteria | 2935810662 | 2935813778 | 50 |
| 165 | iso_pu_bacteria | 2935827899 | 2935832286 | 50 |
| 166 | iso_pu_bacteria | 2935837841 | 2935843991 | 50 |
| 167 | iso_pu_bacteria | 2935855204 | 2935862782 | 50 |
| 168 | iso_pu_bacteria | 2935864058 | 2935864525 | 50 |
| 169 | iso_pu_bacteria | 2935873716 | 2935875123 | 50 |
| 170 | iso_pu_bacteria | 2935959822 | 2935961426 | 50 |
| 171 | iso_pu_bacteria | 2935992306 | 2935999259 | 50 |
| 172 | iso_pu_bacteria | 2936002035 | 2936005814 | 50 |
| 173 | iso_pu_bacteria | 2936037263 | 2936039334 | 50 |
| 174 | iso_pu_bacteria | 2940556831 | 2940559160 | 50 |
| 175 | iso_pu_bacteria | 2941538514 | 2941541854 | 50 |
| 176 | iso_pu_bacteria | 3005483717 | 3005487754 | 50 |
| 177 | iso_pu_bacteria | 3005506211 | 3005511104 | 50 |
| 178 | iso_pu_bacteria | 3005594810 | 3005595908 | 50 |
| 179 | iso_pu_bacteria | 3005710791 | 3005711845 | 50 |
| 180 | iso_pu_bacteria | 3005718088 | 3005719102 | 50 |
| 181 | iso_pu_bacteria | 8016511872 | 8016517228 | 50 |
| 182 | iso_pu_bacteria | 8016522445 | 8016524579 | 50 |
| 183 | iso_pu_bacteria | 8016522445 | 8016527016 | 50 |
| 184 | iso_pu_bacteria | 8016530956 | 8016532093 | 50 |
| 185 | iso_pu_bacteria | 8016530956 | 8016538140 | 50 |
| 186 | iso_pu_bacteria | 8016539877 | 8016542419 | 50 |
| 187 | iso_pu_bacteria | 8016539877 | 8016545307 | 50 |
| 188 | iso_pu_bacteria | 8016548790 | 8016550856 | 50 |
| 189 | iso_pu_bacteria | 8016548790 | 8016556782 | 50 |
| 190 | iso_pu_bacteria | 8016557553 | 8016559268 | 50 |
| 191 | iso_pu_bacteria | 8016557553 | 8016565136 | 50 |
| 192 | iso_pu_bacteria | 8016566248 | 8016567807 | 50 |
| 193 | iso_pu_bacteria | 8016566248 | 8016570390 | 50 |
| 194 | iso_pu_bacteria | 8016575299 | 8016580497 | 50 |
| 195 | iso_pu_bacteria | 8016575299 | 8016582928 | 50 |
| 196 | iso_pu_bacteria | 8016583857 | 8016585372 | 50 |
| 197 | iso_pu_bacteria | 8016583857 | 8016588536 | 50 |
| 198 | iso_pu_bacteria | 8016595262 | 8016597217 | 50 |
| 199 | iso_pu_bacteria | 8016595262 | 8016602783 | 50 |
| 200 | iso_pu_bacteria | 8016603502 | 8016605050 | 50 |
| 201 | iso_pu_bacteria | 8016603502 | 8016605645 | 50 |
| 202 | iso_pu_bacteria | 8016613128 | 8016617558 | 50 |
| 203 | iso_pu_bacteria | 8016613128 | 8016619968 | 50 |
| 204 | iso_pu_bacteria | 8016622563 | 8016624012 | 50 |
| 205 | iso_pu_bacteria | 8016622563 | 8016624186 | 50 |
| 206 | iso_pu_bacteria | 8017057580 | 8017059366 | 50 |
| 207 | iso_pu_bacteria | 8019530166 | 8019531913 | 50 |
| 208 | iso_pu_bacteria | 8019530166 | 8019537812 | 50 |
| 209 | iso_pu_bacteria | 8019538911 | 8019539435 | 50 |
| 210 | iso_pu_bacteria | 8019538911 | 8019539621 | 50 |
| 211 | iso_pu_bacteria | 8019547302 | 8019551037 | 50 |
| 212 | iso_pu_bacteria | 8019547302 | 8019551204 | 50 |
| 213 | iso_pu_bacteria | 8019576017 | 8019576253 | 50 |
| 214 | iso_pu_bacteria | 8019586578 | 8019594133 | 50 |
| 215 | iso_pu_bacteria | 8019597564 | 8019607433 | 50 |
| 216 | iso_pu_bacteria | 8019608314 | 8019611078 | 50 |
| 217 | iso_pu_bacteria | 8055742211 | 8055743576 | 50 |
| 218 | iso_pu_bacteria | 8056967851 | 8056974119 | 50 |
| 219 | 3300005262 | Ga0065165_1070233 | Ga0065165_10702331 | 51 |
| 220 | 3300006038 | Ga0075365_10052962 | Ga0075365_100529625 | 51 |
| 221 | 3300006051 | Ga0075364_10007861 | Ga0075364_100078619 | 51 |
| 222 | 3300006178 | Ga0075367_10071534 | Ga0075367_100715342 | 51 |
| 223 | 3300006186 | Ga0075369_10002297 | Ga0075369_100022979 | 51 |
| 224 | 3300006353 | Ga0075370_10348564 | Ga0075370_103485642 | 51 |
| 225 | 3300025295 | Ga0209564_1027871 | Ga0209564_10278712 | 51 |
| 226 | 3300025302 | Ga0207426_1018923 | Ga0207426_10189232 | 51 |
| 227 | 3300048909 | Ga0496106_0515356 | Ga0496106_0515356_499_654 | 51 |
| 228 | 3300048919 | Ga0496116_0004251 | Ga0496116_0004251_12284_12439 | 51 |
| 229 | 3300048920 | Ga0496117_0012698 | Ga0496117_0012698_5102_5257 | 51 |
| 230 | 3300048921 | Ga0496118_0027495 | Ga0496118_0027495_1045_1200 | 51 |
| 231 | 3300048926 | Ga0496123_0086666 | Ga0496123_0086666_1487_1642 | 51 |
| 232 | 3300048927 | Ga0496124_0058363 | Ga0496124_0058363_1805_1960 | 51 |
| 233 | 3300048928 | Ga0496125_0015991 | Ga0496125_0015991_1122_1277 | 51 |
| 234 | 3300050491 | nmdc:mga00v17_4195_c1 | nmdc:mga00v17_4195_c1_67_222 | 51 |
| 235 | 3300050492 | nmdc:mga0yw44_60293_c1 | nmdc:mga0yw44_60293_c1_281_436 | 51 |
| 236 | 3300050516 | nmdc:mga0sz30_1155_c1 | nmdc:mga0sz30_1155_c1_3320_3475 | 51 |
| 237 | 3300025908 | Ga0207643_11104940 | Ga0207643_111049402 | 52 |
| 238 | 3300041494 | Ga0451837_1823684 | Ga0451837_1823684_104_262 | 52 |
| 239 | 3300003203 | JGI25406J46586_10001492 | JGI25406J46586_100014922 | 53 |
| 240 | 3300003203 | JGI25406J46586_10118246 | JGI25406J46586_101182462 | 53 |
| 241 | 3300003215 | JGI25153J46596_10005850 | JGI25153J46596_100058503 | 53 |
| 242 | 3300003320 | rootH2_10123764 | rootH2_101237644 | 53 |
| 243 | 3300003323 | rootH1_10154882 | rootH1_101548822 | 53 |
| 244 | 3300003775 | Ga0055524_1038196 | Ga0055524_10381962 | 53 |
| 245 | 3300003794 | Ga0055531_10023085 | Ga0055531_100230852 | 53 |
| 246 | 3300005262 | Ga0065165_1006344 | Ga0065165_10063443 | 53 |
| 247 | 3300005327 | Ga0070658_10019362 | Ga0070658_100193623 | 53 |
| 248 | 3300005339 | Ga0070660_100924642 | Ga0070660_1009246422 | 53 |
| 249 | 3300005366 | Ga0070659_100415159 | Ga0070659_1004151592 | 53 |
| 250 | 3300005455 | Ga0070663_102018590 | Ga0070663_1020185902 | 53 |
| 251 | 3300005457 | Ga0070662_100559373 | Ga0070662_1005593732 | 53 |
| 252 | 3300005543 | Ga0070672_100988899 | Ga0070672_1009888992 | 53 |
| 253 | 3300005548 | Ga0070665_102029195 | Ga0070665_1020291952 | 53 |
| 254 | 3300005563 | Ga0068855_102092934 | Ga0068855_1020929341 | 53 |
| 255 | 3300005564 | Ga0070664_102063726 | Ga0070664_1020637261 | 53 |
| 256 | 3300005985 | Ga0081539_10000250 | Ga0081539_100002504 | 53 |
| 257 | 3300005985 | Ga0081539_10048041 | Ga0081539_100480414 | 53 |
| 258 | 3300006051 | Ga0075364_10851317 | Ga0075364_108513171 | 53 |
| 259 | 3300006358 | Ga0068871_101231941 | Ga0068871_1012319411 | 53 |
| 260 | 3300006871 | Ga0075434_100179857 | Ga0075434_1001798573 | 53 |
| 261 | 3300013296 | Ga0157374_11822376 | Ga0157374_118223762 | 53 |
| 262 | 3300025245 | Ga0207425_1026204 | Ga0207425_10262042 | 53 |
| 263 | 3300025295 | Ga0209564_1015801 | Ga0209564_10158013 | 53 |
| 264 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011127 | 53 |
| 265 | 3300025297 | Ga0209758_1000209 | Ga0209758_1000209108 | 53 |
| 266 | 3300025299 | Ga0209256_1002188 | Ga0209256_10021883 | 53 |
| 267 | 3300025302 | Ga0207426_1004534 | Ga0207426_10045347 | 53 |
| 268 | 3300025304 | Ga0209257_1000620 | Ga0209257_10006204 | 53 |
| 269 | 3300025904 | Ga0207647_10638556 | Ga0207647_106385561 | 53 |
| 270 | 3300025909 | Ga0207705_10884677 | Ga0207705_108846772 | 53 |
| 271 | 3300025919 | Ga0207657_10673933 | Ga0207657_106739332 | 53 |
| 272 | 3300025932 | Ga0207690_10318288 | Ga0207690_103182882 | 53 |
| 273 | 3300025933 | Ga0207706_10149265 | Ga0207706_101492652 | 53 |
| 274 | 3300025940 | Ga0207691_11621650 | Ga0207691_116216501 | 53 |
| 275 | 3300026041 | Ga0207639_12062591 | Ga0207639_120625911 | 53 |
| 276 | 3300026067 | Ga0207678_10654004 | Ga0207678_106540042 | 53 |
| 277 | 3300026067 | Ga0207678_11151668 | Ga0207678_111516682 | 53 |
| 278 | 3300027296 | Ga0209389_1000412 | Ga0209389_100041215 | 53 |
| 279 | 3300027357 | Ga0209589_1004063 | Ga0209589_100406315 | 53 |
| 280 | 3300027361 | Ga0209489_100090 | Ga0209489_10009011 | 53 |
| 281 | 3300028379 | Ga0268266_12229898 | Ga0268266_122298981 | 53 |
| 282 | 3300031235 | Ga0265330_10008738 | Ga0265330_100087382 | 53 |
| 283 | 3300031249 | Ga0265339_10404020 | Ga0265339_104040202 | 53 |
| 284 | 3300031507 | Ga0307509_10367591 | Ga0307509_103675912 | 53 |
| 285 | 3300039437 | Ga0436365_1199722 | Ga0436365_1199722_344_505 | 53 |
| 286 | 3300039450 | Ga0436363_0537045 | Ga0436363_0537045_350_511 | 53 |
| 287 | 3300041505 | Ga0451849_0768268 | Ga0451849_0768268_330_491 | 53 |
| 288 | 3300042005 | Ga0439448_0318543 | Ga0439448_0318543_220_381 | 53 |
| 289 | 3300044658 | Ga0466972_0012408 | Ga0466972_0012408_1145_1309 | 53 |
| 290 | 3300044658 | Ga0466972_0213342 | Ga0466972_0213342_457_621 | 53 |
| 291 | 3300044735 | Ga0466968_0009585 | Ga0466968_0009585_371_535 | 53 |
| 292 | 3300044901 | Ga0466960_0038044 | Ga0466960_0038044_1527_1691 | 53 |
| 293 | 3300044901 | Ga0466960_0620221 | Ga0466960_0620221_314_475 | 53 |
| 294 | 3300048924 | Ga0496121_0100896 | Ga0496121_0100896_1299_1460 | 53 |
| 295 | 3300048929 | Ga0496126_0029913 | Ga0496126_0029913_1414_1575 | 53 |
| 296 | 3300001904 | JGI24736J21556_1030079 | JGI24736J21556_10300793 | 54 |
| 297 | 3300001990 | JGI24737J22298_10215399 | JGI24737J22298_102153992 | 54 |
| 298 | 3300002067 | JGI24735J21928_10064167 | JGI24735J21928_100641672 | 54 |
| 299 | 3300002067 | JGI24735J21928_10066827 | JGI24735J21928_100668272 | 54 |
| 300 | 3300002155 | JGI24033J26618_1065262 | JGI24033J26618_10652621 | 54 |
| 301 | 3300003203 | JGI25406J46586_10000012 | JGI25406J46586_1000001271 | 54 |
| 302 | 3300003215 | JGI25153J46596_10000453 | JGI25153J46596_100004535 | 54 |
| 303 | 3300003771 | Ga0055526_1026485 | Ga0055526_10264852 | 54 |
| 304 | 3300003775 | Ga0055524_1048024 | Ga0055524_10480242 | 54 |
| 305 | 3300003794 | Ga0055531_10003002 | Ga0055531_100030029 | 54 |
| 306 | 3300005262 | Ga0065165_1007785 | Ga0065165_10077854 | 54 |
| 307 | 3300005327 | Ga0070658_10230353 | Ga0070658_102303531 | 54 |
| 308 | 3300005327 | Ga0070658_10431512 | Ga0070658_104315122 | 54 |
| 309 | 3300005328 | Ga0070676_10520815 | Ga0070676_105208152 | 54 |
| 310 | 3300005329 | Ga0070683_100005616 | Ga0070683_10000561610 | 54 |
| 311 | 3300005329 | Ga0070683_101043574 | Ga0070683_1010435741 | 54 |
| 312 | 3300005330 | Ga0070690_101006546 | Ga0070690_1010065462 | 54 |
| 313 | 3300005331 | Ga0070670_100083921 | Ga0070670_1000839212 | 54 |
| 314 | 3300005333 | Ga0070677_10214699 | Ga0070677_102146992 | 54 |
| 315 | 3300005335 | Ga0070666_10611424 | Ga0070666_106114242 | 54 |
| 316 | 3300005336 | Ga0070680_100097139 | Ga0070680_1000971393 | 54 |
| 317 | 3300005336 | Ga0070680_100264096 | Ga0070680_1002640963 | 54 |
| 318 | 3300005337 | Ga0070682_100529849 | Ga0070682_1005298492 | 54 |
| 319 | 3300005339 | Ga0070660_100161002 | Ga0070660_1001610023 | 54 |
| 320 | 3300005339 | Ga0070660_100491310 | Ga0070660_1004913102 | 54 |
| 321 | 3300005341 | Ga0070691_10439384 | Ga0070691_104393841 | 54 |
| 322 | 3300005344 | Ga0070661_100065660 | Ga0070661_1000656605 | 54 |
| 323 | 3300005344 | Ga0070661_101067822 | Ga0070661_1010678221 | 54 |
| 324 | 3300005345 | Ga0070692_10433025 | Ga0070692_104330251 | 54 |
| 325 | 3300005353 | Ga0070669_101117654 | Ga0070669_1011176541 | 54 |
| 326 | 3300005354 | Ga0070675_100215875 | Ga0070675_1002158751 | 54 |
| 327 | 3300005354 | Ga0070675_101410291 | Ga0070675_1014102911 | 54 |
| 328 | 3300005355 | Ga0070671_101730010 | Ga0070671_1017300101 | 54 |
| 329 | 3300005356 | Ga0070674_100691559 | Ga0070674_1006915592 | 54 |
| 330 | 3300005364 | Ga0070673_100057683 | Ga0070673_1000576832 | 54 |
| 331 | 3300005364 | Ga0070673_100286293 | Ga0070673_1002862932 | 54 |
| 332 | 3300005366 | Ga0070659_100392966 | Ga0070659_1003929662 | 54 |
| 333 | 3300005367 | Ga0070667_100152210 | Ga0070667_1001522102 | 54 |
| 334 | 3300005434 | Ga0070709_10237946 | Ga0070709_102379462 | 54 |
| 335 | 3300005434 | Ga0070709_10283631 | Ga0070709_102836311 | 54 |
| 336 | 3300005435 | Ga0070714_100133409 | Ga0070714_1001334093 | 54 |
| 337 | 3300005435 | Ga0070714_100353386 | Ga0070714_1003533862 | 54 |
| 338 | 3300005435 | Ga0070714_100580984 | Ga0070714_1005809843 | 54 |
| 339 | 3300005436 | Ga0070713_100017348 | Ga0070713_1000173488 | 54 |
| 340 | 3300005436 | Ga0070713_100083086 | Ga0070713_1000830862 | 54 |
| 341 | 3300005436 | Ga0070713_100138576 | Ga0070713_1001385763 | 54 |
| 342 | 3300005436 | Ga0070713_100447587 | Ga0070713_1004475872 | 54 |
| 343 | 3300005436 | Ga0070713_100911575 | Ga0070713_1009115752 | 54 |
| 344 | 3300005436 | Ga0070713_101111320 | Ga0070713_1011113201 | 54 |
| 345 | 3300005437 | Ga0070710_11329729 | Ga0070710_113297292 | 54 |
| 346 | 3300005439 | Ga0070711_100554319 | Ga0070711_1005543193 | 54 |
| 347 | 3300005445 | Ga0070708_101593518 | Ga0070708_1015935181 | 54 |
| 348 | 3300005455 | Ga0070663_100714504 | Ga0070663_1007145041 | 54 |
| 349 | 3300005455 | Ga0070663_100768806 | Ga0070663_1007688061 | 54 |
| 350 | 3300005458 | Ga0070681_10017592 | Ga0070681_100175923 | 54 |
| 351 | 3300005458 | Ga0070681_10318213 | Ga0070681_103182132 | 54 |
| 352 | 3300005458 | Ga0070681_10519587 | Ga0070681_105195872 | 54 |
| 353 | 3300005459 | Ga0068867_100883767 | Ga0068867_1008837671 | 54 |
| 354 | 3300005471 | Ga0070698_100478590 | Ga0070698_1004785902 | 54 |
| 355 | 3300005530 | Ga0070679_100062309 | Ga0070679_1000623096 | 54 |
| 356 | 3300005530 | Ga0070679_100484901 | Ga0070679_1004849012 | 54 |
| 357 | 3300005535 | Ga0070684_100023098 | Ga0070684_1000230984 | 54 |
| 358 | 3300005536 | Ga0070697_100140408 | Ga0070697_1001404083 | 54 |
| 359 | 3300005536 | Ga0070697_100848342 | Ga0070697_1008483422 | 54 |
| 360 | 3300005539 | Ga0068853_100074050 | Ga0068853_1000740504 | 54 |
| 361 | 3300005539 | Ga0068853_100218501 | Ga0068853_1002185012 | 54 |
| 362 | 3300005543 | Ga0070672_100923058 | Ga0070672_1009230583 | 54 |
| 363 | 3300005547 | Ga0070693_100174018 | Ga0070693_1001740183 | 54 |
| 364 | 3300005547 | Ga0070693_100584715 | Ga0070693_1005847152 | 54 |
| 365 | 3300005547 | Ga0070693_101411763 | Ga0070693_1014117631 | 54 |
| 366 | 3300005563 | Ga0068855_100042130 | Ga0068855_1000421303 | 54 |
| 367 | 3300005563 | Ga0068855_100091543 | Ga0068855_1000915435 | 54 |
| 368 | 3300005563 | Ga0068855_100697608 | Ga0068855_1006976083 | 54 |
| 369 | 3300005564 | Ga0070664_100140429 | Ga0070664_1001404295 | 54 |
| 370 | 3300005564 | Ga0070664_101190127 | Ga0070664_1011901272 | 54 |
| 371 | 3300005577 | Ga0068857_100008314 | Ga0068857_1000083143 | 54 |
| 372 | 3300005578 | Ga0068854_100073898 | Ga0068854_1000738984 | 54 |
| 373 | 3300005578 | Ga0068854_101396445 | Ga0068854_1013964452 | 54 |
| 374 | 3300005614 | Ga0068856_100093682 | Ga0068856_1000936822 | 54 |
| 375 | 3300005614 | Ga0068856_100260950 | Ga0068856_1002609501 | 54 |
| 376 | 3300005614 | Ga0068856_102140325 | Ga0068856_1021403252 | 54 |
| 377 | 3300005616 | Ga0068852_100114322 | Ga0068852_1001143222 | 54 |
| 378 | 3300005616 | Ga0068852_100338220 | Ga0068852_1003382202 | 54 |
| 379 | 3300005616 | Ga0068852_100633593 | Ga0068852_1006335932 | 54 |
| 380 | 3300005617 | Ga0068859_101107794 | Ga0068859_1011077943 | 54 |
| 381 | 3300005719 | Ga0068861_100649892 | Ga0068861_1006498922 | 54 |
| 382 | 3300005834 | Ga0068851_10007628 | Ga0068851_100076282 | 54 |
| 383 | 3300005843 | Ga0068860_100577804 | Ga0068860_1005778042 | 54 |
| 384 | 3300005983 | Ga0081540_1307989 | Ga0081540_13079891 | 54 |
| 385 | 3300005985 | Ga0081539_10000040 | Ga0081539_10000040236 | 54 |
| 386 | 3300006028 | Ga0070717_10000355 | Ga0070717_1000035517 | 54 |
| 387 | 3300006028 | Ga0070717_10012461 | Ga0070717_100124618 | 54 |
| 388 | 3300006028 | Ga0070717_10046462 | Ga0070717_100464622 | 54 |
| 389 | 3300006028 | Ga0070717_10078841 | Ga0070717_100788414 | 54 |
| 390 | 3300006028 | Ga0070717_10345799 | Ga0070717_103457993 | 54 |
| 391 | 3300006028 | Ga0070717_10347901 | Ga0070717_103479012 | 54 |
| 392 | 3300006038 | Ga0075365_10900513 | Ga0075365_109005132 | 54 |
| 393 | 3300006048 | Ga0075363_100033304 | Ga0075363_1000333042 | 54 |
| 394 | 3300006051 | Ga0075364_10031107 | Ga0075364_100311074 | 54 |
| 395 | 3300006163 | Ga0070715_10085512 | Ga0070715_100855124 | 54 |
| 396 | 3300006173 | Ga0070716_100323897 | Ga0070716_1003238971 | 54 |
| 397 | 3300006173 | Ga0070716_101787873 | Ga0070716_1017878733 | 54 |
| 398 | 3300006175 | Ga0070712_100366486 | Ga0070712_1003664863 | 54 |
| 399 | 3300006175 | Ga0070712_100718546 | Ga0070712_1007185462 | 54 |
| 400 | 3300006175 | Ga0070712_101716096 | Ga0070712_1017160963 | 54 |
| 401 | 3300006177 | Ga0075362_10453395 | Ga0075362_104533952 | 54 |
| 402 | 3300006186 | Ga0075369_10035863 | Ga0075369_100358633 | 54 |
| 403 | 3300006186 | Ga0075369_10045900 | Ga0075369_100459002 | 54 |
| 404 | 3300006871 | Ga0075434_100579343 | Ga0075434_1005793432 | 54 |
| 405 | 3300006931 | Ga0097620_101107866 | Ga0097620_1011078663 | 54 |
| 406 | 3300007265 | Ga0099794_10036362 | Ga0099794_100363623 | 54 |
| 407 | 3300007788 | Ga0099795_10386968 | Ga0099795_103869681 | 54 |
| 408 | 3300007788 | Ga0099795_10578501 | Ga0099795_105785011 | 54 |
| 409 | 3300009093 | Ga0105240_10004694 | Ga0105240_1000469419 | 54 |
| 410 | 3300009093 | Ga0105240_10014338 | Ga0105240_100143388 | 54 |
| 411 | 3300009093 | Ga0105240_10084297 | Ga0105240_100842974 | 54 |
| 412 | 3300009093 | Ga0105240_10492881 | Ga0105240_104928813 | 54 |
| 413 | 3300009093 | Ga0105240_10756968 | Ga0105240_107569682 | 54 |
| 414 | 3300009094 | Ga0111539_12132211 | Ga0111539_121322112 | 54 |
| 415 | 3300009098 | Ga0105245_10375755 | Ga0105245_103757551 | 54 |
| 416 | 3300009098 | Ga0105245_12516233 | Ga0105245_125162331 | 54 |
| 417 | 3300009147 | Ga0114129_12984967 | Ga0114129_129849671 | 54 |
| 418 | 3300009148 | Ga0105243_10480226 | Ga0105243_104802262 | 54 |
| 419 | 3300009174 | Ga0105241_10093623 | Ga0105241_100936232 | 54 |
| 420 | 3300009174 | Ga0105241_10894490 | Ga0105241_108944902 | 54 |
| 421 | 3300009174 | Ga0105241_11906604 | Ga0105241_119066041 | 54 |
| 422 | 3300009176 | Ga0105242_10218695 | Ga0105242_102186952 | 54 |
| 423 | 3300009176 | Ga0105242_10449777 | Ga0105242_104497772 | 54 |
| 424 | 3300009176 | Ga0105242_12811762 | Ga0105242_128117621 | 54 |
| 425 | 3300009177 | Ga0105248_10049430 | Ga0105248_100494304 | 54 |
| 426 | 3300009545 | Ga0105237_10030752 | Ga0105237_100307525 | 54 |
| 427 | 3300009545 | Ga0105237_10048491 | Ga0105237_100484915 | 54 |
| 428 | 3300009545 | Ga0105237_10231071 | Ga0105237_102310713 | 54 |
| 429 | 3300009545 | Ga0105237_10235957 | Ga0105237_102359572 | 54 |
| 430 | 3300009545 | Ga0105237_11583211 | Ga0105237_115832112 | 54 |
| 431 | 3300009551 | Ga0105238_10007397 | Ga0105238_100073978 | 54 |
| 432 | 3300009551 | Ga0105238_10023868 | Ga0105238_100238682 | 54 |
| 433 | 3300009551 | Ga0105238_10215451 | Ga0105238_102154512 | 54 |
| 434 | 3300009551 | Ga0105238_10606305 | Ga0105238_106063053 | 54 |
| 435 | 3300009553 | Ga0105249_10166729 | Ga0105249_101667293 | 54 |
| 436 | 3300009553 | Ga0105249_11301134 | Ga0105249_113011341 | 54 |
| 437 | 3300010159 | Ga0099796_10042515 | Ga0099796_100425151 | 54 |
| 438 | 3300010159 | Ga0099796_10146099 | Ga0099796_101460992 | 54 |
| 439 | 3300010375 | Ga0105239_10018859 | Ga0105239_100188596 | 54 |
| 440 | 3300010375 | Ga0105239_10238970 | Ga0105239_102389702 | 54 |
| 441 | 3300011119 | Ga0105246_10058087 | Ga0105246_100580873 | 54 |
| 442 | 3300011119 | Ga0105246_10415609 | Ga0105246_104156091 | 54 |
| 443 | 3300012482 | Ga0157318_1038894 | Ga0157318_10388941 | 54 |
| 444 | 3300013100 | Ga0157373_10758972 | Ga0157373_107589723 | 54 |
| 445 | 3300013104 | Ga0157370_10064213 | Ga0157370_100642135 | 54 |
| 446 | 3300013105 | Ga0157369_10072277 | Ga0157369_100722775 | 54 |
| 447 | 3300013105 | Ga0157369_10512265 | Ga0157369_105122651 | 54 |
| 448 | 3300013296 | Ga0157374_10515844 | Ga0157374_105158442 | 54 |
| 449 | 3300013296 | Ga0157374_12888311 | Ga0157374_128883111 | 54 |
| 450 | 3300013297 | Ga0157378_10290428 | Ga0157378_102904282 | 54 |
| 451 | 3300013297 | Ga0157378_11002433 | Ga0157378_110024332 | 54 |
| 452 | 3300013297 | Ga0157378_11229727 | Ga0157378_112297272 | 54 |
| 453 | 3300013306 | Ga0163162_10907408 | Ga0163162_109074082 | 54 |
| 454 | 3300013306 | Ga0163162_13081175 | Ga0163162_130811752 | 54 |
| 455 | 3300013307 | Ga0157372_10412520 | Ga0157372_104125202 | 54 |
| 456 | 3300013308 | Ga0157375_10437390 | Ga0157375_104373901 | 54 |
| 457 | 3300013308 | Ga0157375_11228492 | Ga0157375_112284922 | 54 |
| 458 | 3300013308 | Ga0157375_12684788 | Ga0157375_126847882 | 54 |
| 459 | 3300014325 | Ga0163163_10693498 | Ga0163163_106934983 | 54 |
| 460 | 3300014497 | Ga0182008_10718014 | Ga0182008_107180141 | 54 |
| 461 | 3300014968 | Ga0157379_11017902 | Ga0157379_110179021 | 54 |
| 462 | 3300017792 | Ga0163161_10305982 | Ga0163161_103059821 | 54 |
| 463 | 3300020082 | Ga0206353_11182322 | Ga0206353_111823221 | 54 |
| 464 | 3300021384 | Ga0213876_10173952 | Ga0213876_101739522 | 54 |
| 465 | 3300022729 | Ga0228599_109105 | Ga0228599_1091051 | 54 |
| 466 | 3300024225 | Ga0224572_1024785 | Ga0224572_10247852 | 54 |
| 467 | 3300025245 | Ga0207425_1011029 | Ga0207425_10110292 | 54 |
| 468 | 3300025295 | Ga0209564_1008984 | Ga0209564_10089845 | 54 |
| 469 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021129 | 54 |
| 470 | 3300025299 | Ga0209256_1003782 | Ga0209256_10037822 | 54 |
| 471 | 3300025299 | Ga0209256_1094889 | Ga0209256_10948891 | 54 |
| 472 | 3300025302 | Ga0207426_1070356 | Ga0207426_10703562 | 54 |
| 473 | 3300025304 | Ga0209257_1001645 | Ga0209257_100164525 | 54 |
| 474 | 3300025315 | Ga0207697_10028208 | Ga0207697_100282081 | 54 |
| 475 | 3300025321 | Ga0207656_10004840 | Ga0207656_100048402 | 54 |
| 476 | 3300025901 | Ga0207688_11074974 | Ga0207688_110749741 | 54 |
| 477 | 3300025903 | Ga0207680_10590998 | Ga0207680_105909982 | 54 |
| 478 | 3300025904 | Ga0207647_10024774 | Ga0207647_100247744 | 54 |
| 479 | 3300025904 | Ga0207647_10510502 | Ga0207647_105105021 | 54 |
| 480 | 3300025905 | Ga0207685_10209634 | Ga0207685_102096342 | 54 |
| 481 | 3300025906 | Ga0207699_10242404 | Ga0207699_102424042 | 54 |
| 482 | 3300025909 | Ga0207705_10033639 | Ga0207705_100336394 | 54 |
| 483 | 3300025909 | Ga0207705_10046081 | Ga0207705_100460813 | 54 |
| 484 | 3300025912 | Ga0207707_10000706 | Ga0207707_1000070626 | 54 |
| 485 | 3300025912 | Ga0207707_10113336 | Ga0207707_101133361 | 54 |
| 486 | 3300025912 | Ga0207707_10676321 | Ga0207707_106763212 | 54 |
| 487 | 3300025912 | Ga0207707_10720220 | Ga0207707_107202202 | 54 |
| 488 | 3300025913 | Ga0207695_10096049 | Ga0207695_100960494 | 54 |
| 489 | 3300025913 | Ga0207695_10100277 | Ga0207695_101002775 | 54 |
| 490 | 3300025913 | Ga0207695_10558583 | Ga0207695_105585833 | 54 |
| 491 | 3300025914 | Ga0207671_10019453 | Ga0207671_100194536 | 54 |
| 492 | 3300025914 | Ga0207671_10085932 | Ga0207671_100859322 | 54 |
| 493 | 3300025914 | Ga0207671_10398364 | Ga0207671_103983642 | 54 |
| 494 | 3300025914 | Ga0207671_10992075 | Ga0207671_109920752 | 54 |
| 495 | 3300025915 | Ga0207693_10299821 | Ga0207693_102998213 | 54 |
| 496 | 3300025915 | Ga0207693_10609962 | Ga0207693_106099622 | 54 |
| 497 | 3300025916 | Ga0207663_10542876 | Ga0207663_105428761 | 54 |
| 498 | 3300025917 | Ga0207660_10012021 | Ga0207660_100120216 | 54 |
| 499 | 3300025917 | Ga0207660_10314918 | Ga0207660_103149183 | 54 |
| 500 | 3300025917 | Ga0207660_10663157 | Ga0207660_106631572 | 54 |
| 501 | 3300025919 | Ga0207657_10004672 | Ga0207657_100046723 | 54 |
| 502 | 3300025920 | Ga0207649_11400722 | Ga0207649_114007222 | 54 |
| 503 | 3300025921 | Ga0207652_10001458 | Ga0207652_1000145811 | 54 |
| 504 | 3300025921 | Ga0207652_10652805 | Ga0207652_106528051 | 54 |
| 505 | 3300025923 | Ga0207681_10594033 | Ga0207681_105940331 | 54 |
| 506 | 3300025923 | Ga0207681_11011066 | Ga0207681_110110661 | 54 |
| 507 | 3300025924 | Ga0207694_10009977 | Ga0207694_100099775 | 54 |
| 508 | 3300025924 | Ga0207694_10143082 | Ga0207694_101430822 | 54 |
| 509 | 3300025924 | Ga0207694_10461679 | Ga0207694_104616793 | 54 |
| 510 | 3300025925 | Ga0207650_10334423 | Ga0207650_103344232 | 54 |
| 511 | 3300025926 | Ga0207659_10274629 | Ga0207659_102746291 | 54 |
| 512 | 3300025928 | Ga0207700_10004801 | Ga0207700_100048018 | 54 |
| 513 | 3300025928 | Ga0207700_10236735 | Ga0207700_102367352 | 54 |
| 514 | 3300025928 | Ga0207700_10360259 | Ga0207700_103602591 | 54 |
| 515 | 3300025929 | Ga0207664_10174682 | Ga0207664_101746822 | 54 |
| 516 | 3300025929 | Ga0207664_10355352 | Ga0207664_103553522 | 54 |
| 517 | 3300025931 | Ga0207644_11643067 | Ga0207644_116430671 | 54 |
| 518 | 3300025932 | Ga0207690_10292599 | Ga0207690_102925993 | 54 |
| 519 | 3300025938 | Ga0207704_11933135 | Ga0207704_119331351 | 54 |
| 520 | 3300025940 | Ga0207691_10411954 | Ga0207691_104119541 | 54 |
| 521 | 3300025941 | Ga0207711_10239515 | Ga0207711_102395152 | 54 |
| 522 | 3300025944 | Ga0207661_10055049 | Ga0207661_100550495 | 54 |
| 523 | 3300025945 | Ga0207679_11304427 | Ga0207679_113044271 | 54 |
| 524 | 3300025945 | Ga0207679_12157524 | Ga0207679_121575242 | 54 |
| 525 | 3300025949 | Ga0207667_10006413 | Ga0207667_1000641314 | 54 |
| 526 | 3300025949 | Ga0207667_10605435 | Ga0207667_106054353 | 54 |
| 527 | 3300025949 | Ga0207667_12252186 | Ga0207667_122521862 | 54 |
| 528 | 3300025960 | Ga0207651_10215394 | Ga0207651_102153942 | 54 |
| 529 | 3300025960 | Ga0207651_10700957 | Ga0207651_107009573 | 54 |
| 530 | 3300025961 | Ga0207712_10813815 | Ga0207712_108138152 | 54 |
| 531 | 3300025972 | Ga0207668_12042859 | Ga0207668_120428592 | 54 |
| 532 | 3300025981 | Ga0207640_10228810 | Ga0207640_102288102 | 54 |
| 533 | 3300025981 | Ga0207640_10708628 | Ga0207640_107086282 | 54 |
| 534 | 3300025981 | Ga0207640_10830019 | Ga0207640_108300192 | 54 |
| 535 | 3300025981 | Ga0207640_11688245 | Ga0207640_116882451 | 54 |
| 536 | 3300025986 | Ga0207658_10116748 | Ga0207658_101167482 | 54 |
| 537 | 3300026023 | Ga0207677_10427979 | Ga0207677_104279791 | 54 |
| 538 | 3300026041 | Ga0207639_10176988 | Ga0207639_101769883 | 54 |
| 539 | 3300026041 | Ga0207639_10468728 | Ga0207639_104687282 | 54 |
| 540 | 3300026067 | Ga0207678_10073518 | Ga0207678_100735183 | 54 |
| 541 | 3300026067 | Ga0207678_10552613 | Ga0207678_105526132 | 54 |
| 542 | 3300026067 | Ga0207678_10658684 | Ga0207678_106586841 | 54 |
| 543 | 3300026067 | Ga0207678_11789197 | Ga0207678_117891971 | 54 |
| 544 | 3300026078 | Ga0207702_10224002 | Ga0207702_102240022 | 54 |
| 545 | 3300026078 | Ga0207702_12055886 | Ga0207702_120558861 | 54 |
| 546 | 3300026116 | Ga0207674_10025123 | Ga0207674_100251238 | 54 |
| 547 | 3300026118 | Ga0207675_101331309 | Ga0207675_1013313092 | 54 |
| 548 | 3300026121 | Ga0207683_10387368 | Ga0207683_103873682 | 54 |
| 549 | 3300026142 | Ga0207698_10028257 | Ga0207698_100282576 | 54 |
| 550 | 3300026142 | Ga0207698_11093214 | Ga0207698_110932142 | 54 |
| 551 | 3300026142 | Ga0207698_12141644 | Ga0207698_121416442 | 54 |
| 552 | 3300027671 | Ga0209588_1079520 | Ga0209588_10795202 | 54 |
| 553 | 3300027866 | Ga0209813_10174571 | Ga0209813_101745712 | 54 |
| 554 | 3300028381 | Ga0268264_10210877 | Ga0268264_102108772 | 54 |
| 555 | 3300028381 | Ga0268264_12086081 | Ga0268264_120860811 | 54 |
| 556 | 3300028573 | Ga0265334_10156826 | Ga0265334_101568262 | 54 |
| 557 | 3300028794 | Ga0307515_10145873 | Ga0307515_101458733 | 54 |
| 558 | 3300031235 | Ga0265330_10048506 | Ga0265330_100485064 | 54 |
| 559 | 3300031235 | Ga0265330_10156047 | Ga0265330_101560471 | 54 |
| 560 | 3300031238 | Ga0265332_10043894 | Ga0265332_100438944 | 54 |
| 561 | 3300031239 | Ga0265328_10053588 | Ga0265328_100535882 | 54 |
| 562 | 3300031241 | Ga0265325_10047163 | Ga0265325_100471632 | 54 |
| 563 | 3300031247 | Ga0265340_10109609 | Ga0265340_101096091 | 54 |
| 564 | 3300031249 | Ga0265339_10075924 | Ga0265339_100759244 | 54 |
| 565 | 3300031249 | Ga0265339_10503851 | Ga0265339_105038511 | 54 |
| 566 | 3300031250 | Ga0265331_10121242 | Ga0265331_101212423 | 54 |
| 567 | 3300031344 | Ga0265316_10550171 | Ga0265316_105501711 | 54 |
| 568 | 3300031344 | Ga0265316_10962008 | Ga0265316_109620081 | 54 |
| 569 | 3300031595 | Ga0265313_10027902 | Ga0265313_100279024 | 54 |
| 570 | 3300031616 | Ga0307508_10009028 | Ga0307508_100090283 | 54 |
| 571 | 3300031711 | Ga0265314_10720745 | Ga0265314_107207451 | 54 |
| 572 | 3300031712 | Ga0265342_10052401 | Ga0265342_100524011 | 54 |
| 573 | 3300031712 | Ga0265342_10061317 | Ga0265342_100613172 | 54 |
| 574 | 3300031712 | Ga0265342_10087530 | Ga0265342_100875302 | 54 |
| 575 | 3300031730 | Ga0307516_10143486 | Ga0307516_101434862 | 54 |
| 576 | 3300031810 | Ga0316044_120212 | Ga0316044_1202122 | 54 |
| 577 | 3300033544 | Ga0316215_1004213 | Ga0316215_10042131 | 54 |
| 578 | 3300033546 | Ga0316213_1006616 | Ga0316213_10066161 | 54 |
| 579 | 3300035086 | Ga0373934_0002445 | Ga0373934_0002445_6635_6799 | 54 |
| 580 | 3300035111 | Ga0373923_0000271 | Ga0373923_0000271_8659_8823 | 54 |
| 581 | 3300035117 | Ga0373953_0000155 | Ga0373953_0000155_12490_12654 | 54 |
| 582 | 3300035118 | Ga0373954_0000450 | Ga0373954_0000450_8641_8805 | 54 |
| 583 | 3300035119 | Ga0373956_0354398 | Ga0373956_0354398_519_683 | 54 |
| 584 | 3300035120 | Ga0373957_0000533 | Ga0373957_0000533_215_379 | 54 |
| 585 | 3300035172 | Ga0373955_0001317 | Ga0373955_0001317_6586_6750 | 54 |
| 586 | 3300035410 | Ga0373924_0002189 | Ga0373924_0002189_405_569 | 54 |
| 587 | 3300035724 | Ga0373933_0010648 | Ga0373933_0010648_1380_1544 | 54 |
| 588 | 3300036401 | Ga0373937_0008674 | Ga0373937_0008674_1564_1728 | 54 |
| 589 | 3300036401 | Ga0373937_0060546 | Ga0373937_0060546_2502_2666 | 54 |
| 590 | 3300037418 | Ga0395900_0152094 | Ga0395900_0152094_217_381 | 54 |
| 591 | 3300037466 | Ga0395898_0072855 | Ga0395898_0072855_454_618 | 54 |
| 592 | 3300038443 | Ga0395901_0442780 | Ga0395901_0442780_631_795 | 54 |
| 593 | 3300039437 | Ga0436365_0429661 | Ga0436365_0429661_487_651 | 54 |
| 594 | 3300039437 | Ga0436365_0606176 | Ga0436365_0606176_182_346 | 54 |
| 595 | 3300039450 | Ga0436363_0478130 | Ga0436363_0478130_249_413 | 54 |
| 596 | 3300041486 | Ga0451807_2513845 | Ga0451807_2513845_303_467 | 54 |
| 597 | 3300041509 | Ga0451843_0195165 | Ga0451843_0195165_446_610 | 54 |
| 598 | 3300041511 | Ga0451855_1969055 | Ga0451855_1969055_300_464 | 54 |
| 599 | 3300042012 | Ga0439455_0226718 | Ga0439455_0226718_81_245 | 54 |
| 600 | 3300042439 | Ga0439464_0291602 | Ga0439464_0291602_40_204 | 54 |
| 601 | 3300046454 | Ga0495592_0008383 | Ga0495592_0008383_2544_2708 | 54 |
| 602 | 3300046459 | Ga0495629_0000816 | Ga0495629_0000816_8349_8513 | 54 |
| 603 | 3300046462 | Ga0495651_0004762 | Ga0495651_0004762_1787_1951 | 54 |
| 604 | 3300046463 | Ga0495653_0013624 | Ga0495653_0013624_1488_1652 | 54 |
| 605 | 3300046476 | Ga0495662_0340839 | Ga0495662_0340839_215_379 | 54 |
| 606 | 3300046507 | Ga0495606_0007723 | Ga0495606_0007723_3745_3909 | 54 |
| 607 | 3300046511 | Ga0495608_0002302 | Ga0495608_0002302_9259_9423 | 54 |
| 608 | 3300046514 | Ga0495618_0144227 | Ga0495618_0144227_466_630 | 54 |
| 609 | 3300046516 | Ga0495628_0041829 | Ga0495628_0041829_3103_3267 | 54 |
| 610 | 3300046518 | Ga0495631_0166715 | Ga0495631_0166715_412_576 | 54 |
| 611 | 3300046524 | Ga0495648_0001509 | Ga0495648_0001509_9592_9756 | 54 |
| 612 | 3300046529 | Ga0495652_0004898 | Ga0495652_0004898_5360_5524 | 54 |
| 613 | 3300046533 | Ga0495640_0003100 | Ga0495640_0003100_9854_10018 | 54 |
| 614 | 3300046536 | Ga0495587_0002199 | Ga0495587_0002199_4236_4400 | 54 |
| 615 | 3300046536 | Ga0495587_0159307 | Ga0495587_0159307_140_304 | 54 |
| 616 | 3300046536 | Ga0495587_0182439 | Ga0495587_0182439_641_805 | 54 |
| 617 | 3300046542 | Ga0495597_0122749 | Ga0495597_0122749_631_801 | 54 |
| 618 | 3300046543 | Ga0495645_0012964 | Ga0495645_0012964_3308_3472 | 54 |
| 619 | 3300046559 | Ga0495667_0000496 | Ga0495667_0000496_16326_16490 | 54 |
| 620 | 3300046616 | Ga0495668_0023647 | Ga0495668_0023647_3320_3490 | 54 |
| 621 | 3300046642 | Ga0495634_0024070 | Ga0495634_0024070_3755_3919 | 54 |
| 622 | 3300046663 | Ga0495635_0000962 | Ga0495635_0000962_6529_6693 | 54 |
| 623 | 3300046675 | Ga0495657_0013532 | Ga0495657_0013532_4236_4400 | 54 |
| 624 | 3300046675 | Ga0495657_0867065 | Ga0495657_0867065_278_442 | 54 |
| 625 | 3300046678 | Ga0495599_0004531 | Ga0495599_0004531_1616_1780 | 54 |
| 626 | 3300046679 | Ga0495623_0004417 | Ga0495623_0004417_7713_7877 | 54 |
| 627 | 3300046679 | Ga0495623_0470858 | Ga0495623_0470858_263_427 | 54 |
| 628 | 3300046689 | Ga0495613_0100570 | Ga0495613_0100570_1706_1870 | 54 |
| 629 | 3300046809 | Ga0495600_0023717 | Ga0495600_0023717_2162_2326 | 54 |
| 630 | 3300046809 | Ga0495600_0024832 | Ga0495600_0024832_2207_2371 | 54 |
| 631 | 3300047317 | Ga0495604_0002548 | Ga0495604_0002548_10029_10193 | 54 |
| 632 | 3300047319 | Ga0495674_0040029 | Ga0495674_0040029_3324_3488 | 54 |
| 633 | 3300047322 | Ga0495680_0004880 | Ga0495680_0004880_7621_7785 | 54 |
| 634 | 3300047443 | Ga0495687_010132 | Ga0495687_010132_862_1032 | 54 |
| 635 | 3300047444 | Ga0495675_0001715 | Ga0495675_0001715_6130_6294 | 54 |
| 636 | 3300047444 | Ga0495675_0365258 | Ga0495675_0365258_289_453 | 54 |
| 637 | 3300047471 | Ga0495684_0000695 | Ga0495684_0000695_12617_12781 | 54 |
| 638 | 3300047673 | Ga0495593_0001764 | Ga0495593_0001764_6359_6523 | 54 |
| 639 | 3300048088 | Ga0495602_0005179 | Ga0495602_0005179_6678_6842 | 54 |
| 640 | 3300048088 | Ga0495602_0392303 | Ga0495602_0392303_675_839 | 54 |
| 641 | 3300048905 | Ga0496102_0154285 | Ga0496102_0154285_139_309 | 54 |
| 642 | 3300048905 | Ga0496102_1271943 | Ga0496102_1271943_59_223 | 54 |
| 643 | 3300048906 | Ga0496103_0003807 | Ga0496103_0003807_1469_1639 | 54 |
| 644 | 3300048906 | Ga0496103_0484519 | Ga0496103_0484519_379_543 | 54 |
| 645 | 3300048907 | Ga0496104_0174135 | Ga0496104_0174135_838_1008 | 54 |
| 646 | 3300048910 | Ga0496107_0035717 | Ga0496107_0035717_3295_3465 | 54 |
| 647 | 3300048911 | Ga0496108_0032425 | Ga0496108_0032425_2910_3080 | 54 |
| 648 | 3300048912 | Ga0496109_0036560 | Ga0496109_0036560_3056_3226 | 54 |
| 649 | 3300048913 | Ga0496110_0142828 | Ga0496110_0142828_377_547 | 54 |
| 650 | 3300048913 | Ga0496110_1053294 | Ga0496110_1053294_214_378 | 54 |
| 651 | 3300048914 | Ga0496111_0240247 | Ga0496111_0240247_973_1143 | 54 |
| 652 | 3300048914 | Ga0496111_0566498 | Ga0496111_0566498_530_694 | 54 |
| 653 | 3300048915 | Ga0496112_0000029 | Ga0496112_0000029_39072_39236 | 54 |
| 654 | 3300048915 | Ga0496112_0040806 | Ga0496112_0040806_3190_3360 | 54 |
| 655 | 3300048916 | Ga0496113_0129816 | Ga0496113_0129816_1061_1231 | 54 |
| 656 | 3300048918 | Ga0496115_0024573 | Ga0496115_0024573_4335_4499 | 54 |
| 657 | 3300048920 | Ga0496117_0202496 | Ga0496117_0202496_119_289 | 54 |
| 658 | 3300048922 | Ga0496119_0214815 | Ga0496119_0214815_122_292 | 54 |
| 659 | 3300048927 | Ga0496124_0135441 | Ga0496124_0135441_920_1084 | 54 |
| 660 | 3300048927 | Ga0496124_0358662 | Ga0496124_0358662_742_912 | 54 |
| 661 | 3300048928 | Ga0496125_0001204 | Ga0496125_0001204_10876_11040 | 54 |
| 662 | 3300048928 | Ga0496125_0048428 | Ga0496125_0048428_2956_3126 | 54 |
| 663 | 3300048929 | Ga0496126_0148059 | Ga0496126_0148059_1323_1487 | 54 |
| 664 | 3300050489 | nmdc:mga03683_469450_c1 | nmdc:mga03683_469450_c1_163_333 | 54 |
| 665 | 3300050492 | nmdc:mga0yw44_478371_c1 | nmdc:mga0yw44_478371_c1_287_457 | 54 |
| 666 | 3300050493 | nmdc:mga0k408_828135_c1 | nmdc:mga0k408_828135_c1_278_448 | 54 |
| 667 | 3300050496 | nmdc:mga07m45_164970_c1 | nmdc:mga07m45_164970_c1_948_1118 | 54 |
| 668 | 3300050516 | nmdc:mga0sz30_232354_c1 | nmdc:mga0sz30_232354_c1_182_352 | 54 |
| 669 | 3300053077 | Ga0495601_0002394 | Ga0495601_0002394_8927_9091 | 54 |
| 670 | 3300053077 | Ga0495601_0501526 | Ga0495601_0501526_58_234 | 54 |
| 671 | 3300053077 | Ga0495601_0674139 | Ga0495601_0674139_473_637 | 54 |
| 672 | 3300053078 | Ga0495612_0007364 | Ga0495612_0007364_1182_1358 | 54 |
| 673 | 3300053083 | Ga0495655_0071001 | Ga0495655_0071001_602_772 | 54 |
| 674 | 3300053084 | Ga0495595_0000887 | Ga0495595_0000887_9428_9592 | 54 |
| 675 | 3300053085 | Ga0495619_0002038 | Ga0495619_0002038_6446_6610 | 54 |
| 676 | 3300053085 | Ga0495619_0211024 | Ga0495619_0211024_142_306 | 54 |
| 677 | 3300053093 | Ga0500651_0355522 | Ga0500651_0355522_208_372 | 54 |
| 678 | 3300053094 | Ga0500566_0004519 | Ga0500566_0004519_4474_4638 | 54 |
| 679 | 3300053121 | Ga0500607_131099 | Ga0500607_131099_503_667 | 54 |
| 680 | 3300053122 | Ga0500608_000229 | Ga0500608_000229_1276_1440 | 54 |
| 681 | 3300053125 | Ga0500618_084854 | Ga0500618_084854_379_543 | 54 |
| 682 | 3300053136 | Ga0500559_0000105 | Ga0500559_0000105_4068_4232 | 54 |
| 683 | 3300053145 | Ga0500586_028805 | Ga0500586_028805_1275_1439 | 54 |
| 684 | 3300053147 | Ga0500589_130580 | Ga0500589_130580_834_998 | 54 |
| 685 | 3300053162 | Ga0500638_317312 | Ga0500638_317312_212_376 | 54 |
| 686 | 3300053177 | Ga0500636_0002483 | Ga0500636_0002483_681_845 | 54 |
| 687 | 3300053178 | Ga0500637_0104449 | Ga0500637_0104449_1340_1504 | 54 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar