F475240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 687 | 237 | 687 | 568 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100011851|Ga0070699_1000118515 |
| Length | 568 |
| Sequence | MTEPRAPSPQSRVYDVCIVGSGAGGGMAAHALTRAGADVIVLEAGVPWDNLKDSAMLTWPYESPRRGRSTKDHPFGEFDGCIGGWEIEGEPYTRAPGTEFNWWRARMVGGRTNHWGRISLRFGPYDFKRKSRDGLGDDWPISYEEVAAFYDKIDRLIGVFGSKESLPNEPDGVFLPPPRPRCHELLVKQAADRLHITCIPSRLSILTRPLNGRAPCHYCGQCNRGCRVNANFTSTNVLIGPALTTGRLTLVTNAMAREVTVDKAGRASGVAYVDKTTGSDQHVRARVVVLAASALETARLLLNSKSSAFPSGLANGSGTVGKYITDTTGTDVGGFIPKMMDHVPHNHDGVGGMHLYMPWWLEDQKLDFPRGYHIEVWGGTQVPSYGFGGGIQRYPSGGGYGKQLKDDYRRYYGATVGFSGRGEMIPNDDTYCEIDPRTVDRWGIPVLRFHWKWSDHEYKQVKHMQETFRALIEAMGGEVFSPMPGPERGYGIAAGGVIIHELGGARMGDDPKTSVTNRWCQAHECKNLFLADGAPFVSQADKNPTWTILALSLRTSEHIADLMKRGEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 171 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 231 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 232 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.51 |
| Rhizosphere | 95.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10063868 | 3300005327 | Bacteria | 3002 |
| 2 | Ga0070676_10027734 | 3300005328 | Bacteria | 3213 |
| 3 | Ga0070683_100000496 | 3300005329 | Bacteria | 27786 |
| 4 | Ga0070683_100001098 | 3300005329 | Bacteria | 20381 |
| 5 | Ga0070683_100009054 | 3300005329 | Bacteria | 8497 |
| 6 | Ga0070683_100013474 | 3300005329 | Bacteria | 7132 |
| 7 | Ga0070683_100068690 | 3300005329 | Bacteria | 3302 |
| 8 | Ga0070690_100009920 | 3300005330 | Bacteria | 5526 |
| 9 | Ga0070670_100005903 | 3300005331 | Bacteria | 10351 |
| 10 | Ga0070670_100010229 | 3300005331 | Bacteria | 8006 |
| 11 | Ga0068869_100003211 | 3300005334 | Bacteria | 9993 |
| 12 | Ga0068869_100011746 | 3300005334 | Bacteria | 5757 |
| 13 | Ga0068869_100015327 | 3300005334 | Bacteria | 5138 |
| 14 | Ga0068869_100032775 | 3300005334 | Bacteria | 3663 |
| 15 | Ga0068869_100086524 | 3300005334 | Bacteria | 2349 |
| 16 | Ga0070666_10002725 | 3300005335 | Bacteria | 10673 |
| 17 | Ga0070680_100044939 | 3300005336 | Bacteria | 3590 |
| 18 | Ga0070680_100053426 | 3300005336 | Unclassified | 3298 |
| 19 | Ga0068868_100003471 | 3300005338 | Bacteria | 10979 |
| 20 | Ga0068868_100005053 | 3300005338 | Bacteria | 9261 |
| 21 | Ga0068868_100008104 | 3300005338 | Bacteria | 7514 |
| 22 | Ga0068868_100044042 | 3300005338 | Unclassified | 3488 |
| 23 | Ga0070660_100009323 | 3300005339 | Bacteria | 6897 |
| 24 | Ga0070660_100068794 | 3300005339 | Bacteria | 2760 |
| 25 | Ga0070689_100000550 | 3300005340 | Bacteria | 22415 |
| 26 | Ga0070691_10036812 | 3300005341 | Bacteria | 2307 |
| 27 | Ga0070687_100006094 | 3300005343 | Bacteria | 4922 |
| 28 | Ga0070661_100002953 | 3300005344 | Bacteria | 11732 |
| 29 | Ga0070661_100005979 | 3300005344 | Bacteria | 8378 |
| 30 | Ga0070661_100006808 | 3300005344 | Bacteria | 7881 |
| 31 | Ga0070661_100009772 | 3300005344 | Bacteria | 6654 |
| 32 | Ga0070661_100068299 | 3300005344 | Unclassified | 2612 |
| 33 | Ga0070668_100006081 | 3300005347 | Bacteria | 8952 |
| 34 | Ga0070668_100012100 | 3300005347 | Bacteria | 6426 |
| 35 | Ga0070669_100012871 | 3300005353 | Bacteria | 5942 |
| 36 | Ga0070669_100022835 | 3300005353 | Bacteria | 4475 |
| 37 | Ga0070675_100009201 | 3300005354 | Bacteria | 7673 |
| 38 | Ga0070671_100045357 | 3300005355 | Bacteria | 3654 |
| 39 | Ga0070671_100089295 | 3300005355 | Bacteria | 2580 |
| 40 | Ga0070674_100003574 | 3300005356 | Bacteria | 8740 |
| 41 | Ga0070673_100084581 | 3300005364 | Bacteria | 2580 |
| 42 | Ga0070688_100000197 | 3300005365 | Bacteria | 32010 |
| 43 | Ga0070659_100006718 | 3300005366 | Bacteria | 8316 |
| 44 | Ga0070659_100011058 | 3300005366 | Bacteria | 6666 |
| 45 | Ga0070667_100005223 | 3300005367 | Bacteria | 10853 |
| 46 | Ga0070709_10000899 | 3300005434 | Bacteria | 16569 |
| 47 | Ga0070709_10031441 | 3300005434 | Unclassified | 3192 |
| 48 | Ga0070714_100001358 | 3300005435 | Bacteria | 17707 |
| 49 | Ga0070714_100006555 | 3300005435 | Bacteria | 9004 |
| 50 | Ga0070714_100029396 | 3300005435 | Bacteria | 4569 |
| 51 | Ga0070714_100042616 | 3300005435 | Unclassified | 3835 |
| 52 | Ga0070714_100051489 | 3300005435 | Bacteria | 3510 |
| 53 | Ga0070713_100000134 | 3300005436 | Bacteria | 48639 |
| 54 | Ga0070713_100001365 | 3300005436 | Bacteria | 15613 |
| 55 | Ga0070713_100002354 | 3300005436 | Bacteria | 12338 |
| 56 | Ga0070713_100036781 | 3300005436 | Unclassified | 3954 |
| 57 | Ga0070713_100041168 | 3300005436 | Unclassified | 3762 |
| 58 | Ga0070713_100058279 | 3300005436 | Archaea | 3220 |
| 59 | Ga0070713_100065399 | 3300005436 | Unclassified | 3055 |
| 60 | Ga0070713_100111355 | 3300005436 | Unclassified | 2387 |
| 61 | Ga0070710_10035394 | 3300005437 | Unclassified | 2722 |
| 62 | Ga0070711_100000814 | 3300005439 | Bacteria | 16335 |
| 63 | Ga0070711_100001063 | 3300005439 | Bacteria | 14659 |
| 64 | Ga0070711_100002531 | 3300005439 | Bacteria | 10457 |
| 65 | Ga0070711_100084603 | 3300005439 | Unclassified | 2269 |
| 66 | Ga0070705_100008919 | 3300005440 | Bacteria | 4973 |
| 67 | Ga0070694_100004167 | 3300005444 | Bacteria | 8686 |
| 68 | Ga0070694_100047874 | 3300005444 | Bacteria | 2874 |
| 69 | Ga0070708_100000598 | 3300005445 | Bacteria | 27157 |
| 70 | Ga0070708_100001014 | 3300005445 | Bacteria | 21388 |
| 71 | Ga0070708_100004228 | 3300005445 | Bacteria | 11275 |
| 72 | Ga0070708_100013577 | 3300005445 | Bacteria | 6675 |
| 73 | Ga0070708_100015179 | 3300005445 | Bacteria | 6351 |
| 74 | Ga0070708_100015797 | 3300005445 | Bacteria | 6242 |
| 75 | Ga0070708_100030590 | 3300005445 | Bacteria | 4654 |
| 76 | Ga0070708_100048646 | 3300005445 | Bacteria | 3749 |
| 77 | Ga0070708_100074323 | 3300005445 | Bacteria | 3065 |
| 78 | Ga0070708_100151173 | 3300005445 | Bacteria | 2159 |
| 79 | Ga0070663_100003084 | 3300005455 | Bacteria | 9526 |
| 80 | Ga0070663_100007437 | 3300005455 | Bacteria | 6663 |
| 81 | Ga0070678_100006234 | 3300005456 | Bacteria | 6977 |
| 82 | Ga0070662_100001005 | 3300005457 | Bacteria | 17236 |
| 83 | Ga0070662_100007919 | 3300005457 | Bacteria | 6909 |
| 84 | Ga0070681_10002963 | 3300005458 | Bacteria | 15761 |
| 85 | Ga0070681_10005375 | 3300005458 | Bacteria | 12370 |
| 86 | Ga0068867_100001846 | 3300005459 | Bacteria | 14738 |
| 87 | Ga0068867_100028245 | 3300005459 | Bacteria | 4038 |
| 88 | Ga0070685_10003176 | 3300005466 | Bacteria | 8357 |
| 89 | Ga0070706_100000980 | 3300005467 | Bacteria | 31089 |
| 90 | Ga0070706_100050660 | 3300005467 | Bacteria | 3832 |
| 91 | Ga0070706_100059978 | 3300005467 | Unclassified | 3512 |
| 92 | Ga0070707_100000915 | 3300005468 | Bacteria | 29244 |
| 93 | Ga0070707_100009766 | 3300005468 | Bacteria | 8921 |
| 94 | Ga0070707_100125811 | 3300005468 | Bacteria | 2490 |
| 95 | Ga0070698_100000140 | 3300005471 | Bacteria | 65074 |
| 96 | Ga0070698_100043123 | 3300005471 | Unclassified | 4627 |
| 97 | Ga0070698_100047025 | 3300005471 | Unclassified | 4411 |
| 98 | Ga0070699_100006667 | 3300005518 | Bacteria | 10040 |
| 99 | Ga0070699_100006913 | 3300005518 | Bacteria | 9865 |
| 100 | Ga0070699_100010792 | 3300005518 | Bacteria | 7906 |
| 101 | Ga0070699_100011851 | 3300005518 | Bacteria | 7524 |
| 102 | Ga0070699_100029973 | 3300005518 | Bacteria | 4694 |
| 103 | Ga0070699_100035282 | 3300005518 | Unclassified | 4323 |
| 104 | Ga0070679_100003801 | 3300005530 | Bacteria | 13856 |
| 105 | Ga0070679_100022913 | 3300005530 | Bacteria | 6108 |
| 106 | Ga0070679_100069245 | 3300005530 | Bacteria | 3520 |
| 107 | Ga0070684_100002526 | 3300005535 | Bacteria | 13497 |
| 108 | Ga0070684_100004956 | 3300005535 | Bacteria | 10161 |
| 109 | Ga0070684_100011109 | 3300005535 | Bacteria | 7164 |
| 110 | Ga0070684_100033759 | 3300005535 | Bacteria | 4372 |
| 111 | Ga0070684_100053708 | 3300005535 | Bacteria | 3509 |
| 112 | Ga0070684_100101805 | 3300005535 | Bacteria | 2567 |
| 113 | Ga0070697_100000015 | 3300005536 | Bacteria | 143397 |
| 114 | Ga0070697_100000518 | 3300005536 | Bacteria | 29110 |
| 115 | Ga0070697_100001215 | 3300005536 | Bacteria | 19429 |
| 116 | Ga0070697_100008196 | 3300005536 | Bacteria | 8157 |
| 117 | Ga0070697_100012341 | 3300005536 | Bacteria | 6693 |
| 118 | Ga0070697_100051952 | 3300005536 | Bacteria | 3330 |
| 119 | Ga0070697_100067374 | 3300005536 | Unclassified | 2928 |
| 120 | Ga0068853_100000179 | 3300005539 | Bacteria | 44192 |
| 121 | Ga0068853_100083325 | 3300005539 | Bacteria | 2802 |
| 122 | Ga0068853_100100201 | 3300005539 | Bacteria | 2560 |
| 123 | Ga0070672_100000810 | 3300005543 | Bacteria | 18654 |
| 124 | Ga0070686_100003853 | 3300005544 | Bacteria | 8251 |
| 125 | Ga0070695_100000210 | 3300005545 | Bacteria | 28472 |
| 126 | Ga0070695_100004421 | 3300005545 | Bacteria | 8249 |
| 127 | Ga0070695_100095390 | 3300005545 | Bacteria | 1993 |
| 128 | Ga0070696_100002816 | 3300005546 | Bacteria | 11551 |
| 129 | Ga0070696_100064741 | 3300005546 | Bacteria | 2562 |
| 130 | Ga0070693_100000105 | 3300005547 | Bacteria | 37510 |
| 131 | Ga0070693_100053715 | 3300005547 | Bacteria | 2314 |
| 132 | Ga0070665_100010236 | 3300005548 | Bacteria | 9487 |
| 133 | Ga0070704_100097476 | 3300005549 | Bacteria | 2206 |
| 134 | Ga0068855_100001050 | 3300005563 | Bacteria | 34270 |
| 135 | Ga0068855_100002077 | 3300005563 | Bacteria | 24799 |
| 136 | Ga0068855_100002180 | 3300005563 | Bacteria | 24210 |
| 137 | Ga0068855_100003268 | 3300005563 | Bacteria | 19840 |
| 138 | Ga0068855_100007466 | 3300005563 | Bacteria | 13242 |
| 139 | Ga0068855_100031181 | 3300005563 | Bacteria | 6367 |
| 140 | Ga0068855_100049055 | 3300005563 | Unclassified | 4981 |
| 141 | Ga0068855_100066847 | 3300005563 | Unclassified | 4190 |
| 142 | Ga0068855_100080770 | 3300005563 | Bacteria | 3770 |
| 143 | Ga0070664_100000457 | 3300005564 | Bacteria | 30953 |
| 144 | Ga0070664_100010450 | 3300005564 | Bacteria | 7525 |
| 145 | Ga0070664_100115180 | 3300005564 | Bacteria | 2349 |
| 146 | Ga0068857_100002167 | 3300005577 | Bacteria | 15964 |
| 147 | Ga0068857_100018225 | 3300005577 | Bacteria | 6157 |
| 148 | Ga0068857_100112505 | 3300005577 | Bacteria | 2447 |
| 149 | Ga0068854_100021010 | 3300005578 | Bacteria | 4425 |
| 150 | Ga0068856_100000072 | 3300005614 | Bacteria | 95094 |
| 151 | Ga0068856_100000346 | 3300005614 | Bacteria | 50548 |
| 152 | Ga0068856_100003709 | 3300005614 | Bacteria | 15327 |
| 153 | Ga0068856_100006056 | 3300005614 | Bacteria | 11886 |
| 154 | Ga0068856_100007392 | 3300005614 | Bacteria | 10721 |
| 155 | Ga0068856_100008986 | 3300005614 | Bacteria | 9721 |
| 156 | Ga0068856_100009251 | 3300005614 | Bacteria | 9575 |
| 157 | Ga0068856_100014582 | 3300005614 | Bacteria | 7594 |
| 158 | Ga0068856_100034026 | 3300005614 | Bacteria | 4991 |
| 159 | Ga0068856_100036579 | 3300005614 | Bacteria | 4813 |
| 160 | Ga0068856_100038592 | 3300005614 | Bacteria | 4688 |
| 161 | Ga0068856_100061482 | 3300005614 | Bacteria | 3710 |
| 162 | Ga0068856_100075097 | 3300005614 | Bacteria | 3348 |
| 163 | Ga0068856_100176545 | 3300005614 | Bacteria | 2149 |
| 164 | Ga0070702_100000146 | 3300005615 | Bacteria | 22142 |
| 165 | Ga0068852_100000009 | 3300005616 | Bacteria | 149600 |
| 166 | Ga0068852_100000406 | 3300005616 | Bacteria | 28743 |
| 167 | Ga0068852_100031868 | 3300005616 | Bacteria | 4358 |
| 168 | Ga0068852_100052101 | 3300005616 | Bacteria | 3516 |
| 169 | Ga0068852_100149109 | 3300005616 | Bacteria | 2173 |
| 170 | Ga0068859_100006285 | 3300005617 | Bacteria | 12052 |
| 171 | Ga0068859_100029749 | 3300005617 | Bacteria | 5480 |
| 172 | Ga0068859_100109075 | 3300005617 | Bacteria | 2829 |
| 173 | Ga0068864_100023233 | 3300005618 | Bacteria | 5205 |
| 174 | Ga0068864_100033090 | 3300005618 | Bacteria | 4394 |
| 175 | Ga0068864_100087397 | 3300005618 | Bacteria | 2744 |
| 176 | Ga0068864_100094924 | 3300005618 | Bacteria | 2637 |
| 177 | Ga0068864_100109283 | 3300005618 | Bacteria | 2462 |
| 178 | Ga0068866_10001182 | 3300005718 | Bacteria | 11415 |
| 179 | Ga0068861_100018868 | 3300005719 | Bacteria | 4917 |
| 180 | Ga0068861_100057885 | 3300005719 | Bacteria | 2962 |
| 181 | Ga0068851_10003049 | 3300005834 | Bacteria | 7409 |
| 182 | Ga0068851_10007212 | 3300005834 | Bacteria | 5095 |
| 183 | Ga0068870_10001323 | 3300005840 | Bacteria | 9974 |
| 184 | Ga0068863_100010773 | 3300005841 | Bacteria | 8870 |
| 185 | Ga0068863_100011177 | 3300005841 | Bacteria | 8702 |
| 186 | Ga0068863_100012533 | 3300005841 | Bacteria | 8180 |
| 187 | Ga0068863_100028831 | 3300005841 | Bacteria | 5301 |
| 188 | Ga0068863_100030584 | 3300005841 | Bacteria | 5141 |
| 189 | Ga0068863_100070880 | 3300005841 | Unclassified | 3297 |
| 190 | Ga0068863_100167871 | 3300005841 | Bacteria | 2105 |
| 191 | Ga0068858_100008509 | 3300005842 | Bacteria | 9860 |
| 192 | Ga0068858_100011944 | 3300005842 | Bacteria | 8184 |
| 193 | Ga0068858_100025578 | 3300005842 | Bacteria | 5492 |
| 194 | Ga0068858_100036498 | 3300005842 | Bacteria | 4558 |
| 195 | Ga0068858_100116252 | 3300005842 | Bacteria | 2500 |
| 196 | Ga0068860_100005600 | 3300005843 | Bacteria | 12691 |
| 197 | Ga0068860_100023618 | 3300005843 | Bacteria | 5942 |
| 198 | Ga0068862_100003922 | 3300005844 | Bacteria | 12654 |
| 199 | Ga0068862_100036976 | 3300005844 | Bacteria | 4137 |
| 200 | Ga0070717_10001053 | 3300006028 | Bacteria | 18508 |
| 201 | Ga0070717_10001280 | 3300006028 | Bacteria | 17207 |
| 202 | Ga0070717_10001842 | 3300006028 | Bacteria | 14813 |
| 203 | Ga0070717_10004636 | 3300006028 | Bacteria | 9964 |
| 204 | Ga0070717_10006455 | 3300006028 | Bacteria | 8629 |
| 205 | Ga0070717_10009698 | 3300006028 | Bacteria | 7246 |
| 206 | Ga0070717_10013661 | 3300006028 | Bacteria | 6229 |
| 207 | Ga0070717_10037695 | 3300006028 | Bacteria | 3927 |
| 208 | Ga0070717_10083480 | 3300006028 | Bacteria | 2687 |
| 209 | Ga0070717_10092915 | 3300006028 | Bacteria | 2549 |
| 210 | Ga0070715_10001337 | 3300006163 | Bacteria | 7105 |
| 211 | Ga0070715_10003622 | 3300006163 | Bacteria | 4954 |
| 212 | Ga0070715_10007950 | 3300006163 | Unclassified | 3675 |
| 213 | Ga0070716_100000114 | 3300006173 | Bacteria | 31714 |
| 214 | Ga0070716_100002526 | 3300006173 | Bacteria | 8474 |
| 215 | Ga0070716_100006521 | 3300006173 | Bacteria | 5705 |
| 216 | Ga0070716_100006812 | 3300006173 | Bacteria | 5600 |
| 217 | Ga0070712_100000100 | 3300006175 | Bacteria | 43745 |
| 218 | Ga0070712_100000389 | 3300006175 | Bacteria | 25090 |
| 219 | Ga0070712_100001533 | 3300006175 | Bacteria | 14105 |
| 220 | Ga0070712_100001556 | 3300006175 | Bacteria | 14028 |
| 221 | Ga0070712_100001951 | 3300006175 | Bacteria | 12648 |
| 222 | Ga0070712_100056545 | 3300006175 | Bacteria | 2752 |
| 223 | Ga0097621_100000117 | 3300006237 | Bacteria | 45470 |
| 224 | Ga0097621_100000329 | 3300006237 | Bacteria | 32168 |
| 225 | Ga0097621_100005597 | 3300006237 | Bacteria | 8858 |
| 226 | Ga0097621_100005791 | 3300006237 | Bacteria | 8727 |
| 227 | Ga0097621_100007474 | 3300006237 | Bacteria | 7818 |
| 228 | Ga0097621_100014299 | 3300006237 | Bacteria | 5936 |
| 229 | Ga0097621_100022905 | 3300006237 | Bacteria | 4854 |
| 230 | Ga0097621_100025801 | 3300006237 | Bacteria | 4601 |
| 231 | Ga0097621_100043365 | 3300006237 | Unclassified | 3626 |
| 232 | Ga0097621_100085583 | 3300006237 | Bacteria | 2630 |
| 233 | Ga0068871_100000971 | 3300006358 | Bacteria | 19186 |
| 234 | Ga0068871_100014897 | 3300006358 | Bacteria | 5811 |
| 235 | Ga0068871_100082202 | 3300006358 | Bacteria | 2670 |
| 236 | Ga0068871_100096975 | 3300006358 | Bacteria | 2464 |
| 237 | Ga0068871_100102961 | 3300006358 | Bacteria | 2393 |
| 238 | Ga0075433_10000213 | 3300006852 | Bacteria | 32853 |
| 239 | Ga0075433_10053871 | 3300006852 | Unclassified | 3509 |
| 240 | Ga0075434_100000122 | 3300006871 | Bacteria | 45781 |
| 241 | Ga0075434_100000564 | 3300006871 | Bacteria | 28515 |
| 242 | Ga0075434_100001669 | 3300006871 | Bacteria | 18928 |
| 243 | Ga0075434_100009940 | 3300006871 | Bacteria | 8901 |
| 244 | Ga0075434_100015193 | 3300006871 | Bacteria | 7376 |
| 245 | Ga0075434_100042690 | 3300006871 | Bacteria | 4496 |
| 246 | Ga0068865_100002421 | 3300006881 | Bacteria | 11021 |
| 247 | Ga0068865_100004633 | 3300006881 | Bacteria | 8304 |
| 248 | Ga0068865_100005168 | 3300006881 | Bacteria | 7897 |
| 249 | Ga0075436_100002250 | 3300006914 | Bacteria | 13326 |
| 250 | Ga0075436_100014222 | 3300006914 | Bacteria | 5449 |
| 251 | Ga0075436_100017147 | 3300006914 | Bacteria | 4956 |
| 252 | Ga0075436_100050586 | 3300006914 | Unclassified | 2868 |
| 253 | Ga0097620_100006285 | 3300006931 | Bacteria | 12052 |
| 254 | Ga0097620_100029749 | 3300006931 | Bacteria | 5480 |
| 255 | Ga0097620_100109078 | 3300006931 | Bacteria | 2829 |
| 256 | Ga0075435_100000038 | 3300007076 | Bacteria | 67821 |
| 257 | Ga0075435_100075816 | 3300007076 | Bacteria | 2755 |
| 258 | Ga0075435_100081819 | 3300007076 | Unclassified | 2653 |
| 259 | Ga0099794_10003075 | 3300007265 | Bacteria | 6303 |
| 260 | Ga0099794_10007517 | 3300007265 | Bacteria | 4482 |
| 261 | Ga0099794_10019157 | 3300007265 | Bacteria | 3078 |
| 262 | Ga0099794_10023702 | 3300007265 | Bacteria | 2811 |
| 263 | Ga0099795_10004867 | 3300007788 | Bacteria | 3511 |
| 264 | Ga0105240_10000148 | 3300009093 | Bacteria | 142265 |
| 265 | Ga0105240_10002085 | 3300009093 | Bacteria | 32732 |
| 266 | Ga0105240_10003334 | 3300009093 | Bacteria | 24999 |
| 267 | Ga0105240_10003778 | 3300009093 | Bacteria | 23384 |
| 268 | Ga0105240_10016695 | 3300009093 | Bacteria | 9929 |
| 269 | Ga0105240_10022638 | 3300009093 | Bacteria | 8325 |
| 270 | Ga0105240_10039166 | 3300009093 | Bacteria | 6072 |
| 271 | Ga0105240_10041000 | 3300009093 | Bacteria | 5914 |
| 272 | Ga0105240_10062894 | 3300009093 | Bacteria | 4619 |
| 273 | Ga0105240_10086421 | 3300009093 | Unclassified | 3841 |
| 274 | Ga0105240_10137558 | 3300009093 | Bacteria | 2924 |
| 275 | Ga0105240_10200390 | 3300009093 | Bacteria | 2339 |
| 276 | Ga0105245_10002835 | 3300009098 | Bacteria | 15579 |
| 277 | Ga0105245_10023408 | 3300009098 | Bacteria | 5421 |
| 278 | Ga0105245_10034473 | 3300009098 | Bacteria | 4490 |
| 279 | Ga0105245_10076732 | 3300009098 | Bacteria | 3045 |
| 280 | Ga0105245_10157031 | 3300009098 | Bacteria | 2155 |
| 281 | Ga0105247_10003343 | 3300009101 | Bacteria | 10499 |
| 282 | Ga0114129_10094507 | 3300009147 | Bacteria | 4141 |
| 283 | Ga0114129_10109743 | 3300009147 | Bacteria | 3808 |
| 284 | Ga0105243_10056060 | 3300009148 | Bacteria | 3132 |
| 285 | Ga0105241_10000034 | 3300009174 | Bacteria | 115663 |
| 286 | Ga0105241_10000157 | 3300009174 | Bacteria | 49365 |
| 287 | Ga0105241_10001200 | 3300009174 | Bacteria | 19826 |
| 288 | Ga0105241_10007492 | 3300009174 | Bacteria | 8033 |
| 289 | Ga0105241_10018950 | 3300009174 | Bacteria | 5072 |
| 290 | Ga0105241_10028405 | 3300009174 | Bacteria | 4169 |
| 291 | Ga0105242_10081172 | 3300009176 | Bacteria | 2711 |
| 292 | Ga0105248_10000003 | 3300009177 | Bacteria | 1019601 |
| 293 | Ga0105248_10009349 | 3300009177 | Bacteria | 10790 |
| 294 | Ga0105248_10010236 | 3300009177 | Bacteria | 10325 |
| 295 | Ga0105248_10129135 | 3300009177 | Bacteria | 2851 |
| 296 | Ga0105237_10001511 | 3300009545 | Bacteria | 30572 |
| 297 | Ga0105237_10005226 | 3300009545 | Bacteria | 14688 |
| 298 | Ga0105237_10010821 | 3300009545 | Bacteria | 9682 |
| 299 | Ga0105237_10014822 | 3300009545 | Bacteria | 8135 |
| 300 | Ga0105237_10081703 | 3300009545 | Unclassified | 3222 |
| 301 | Ga0105237_10155290 | 3300009545 | Bacteria | 2285 |
| 302 | Ga0105238_10000121 | 3300009551 | Bacteria | 85582 |
| 303 | Ga0105238_10007714 | 3300009551 | Bacteria | 10758 |
| 304 | Ga0105238_10007802 | 3300009551 | Bacteria | 10706 |
| 305 | Ga0105238_10018538 | 3300009551 | Bacteria | 7084 |
| 306 | Ga0105238_10048974 | 3300009551 | Bacteria | 4257 |
| 307 | Ga0105238_10112641 | 3300009551 | Unclassified | 2700 |
| 308 | Ga0105249_10026101 | 3300009553 | Bacteria | 5262 |
| 309 | Ga0099796_10002143 | 3300010159 | Bacteria | 4252 |
| 310 | Ga0105239_10002108 | 3300010375 | Bacteria | 25691 |
| 311 | Ga0105239_10007899 | 3300010375 | Bacteria | 12162 |
| 312 | Ga0105239_10013560 | 3300010375 | Bacteria | 9048 |
| 313 | Ga0105239_10032944 | 3300010375 | Bacteria | 5693 |
| 314 | Ga0105239_10034893 | 3300010375 | Bacteria | 5525 |
| 315 | Ga0105239_10206745 | 3300010375 | Unclassified | 2200 |
| 316 | Ga0105246_10007094 | 3300011119 | Bacteria | 6857 |
| 317 | Ga0105246_10041358 | 3300011119 | Bacteria | 3115 |
| 318 | Ga0157373_10001145 | 3300013100 | Bacteria | 20351 |
| 319 | Ga0157373_10011714 | 3300013100 | Bacteria | 6441 |
| 320 | Ga0157373_10039559 | 3300013100 | Bacteria | 3376 |
| 321 | Ga0157373_10107230 | 3300013100 | Bacteria | 1964 |
| 322 | Ga0157371_10006441 | 3300013102 | Bacteria | 9685 |
| 323 | Ga0157371_10031814 | 3300013102 | Bacteria | 3799 |
| 324 | Ga0157370_10000059 | 3300013104 | Bacteria | 116740 |
| 325 | Ga0157369_10000035 | 3300013105 | Bacteria | 191300 |
| 326 | Ga0157369_10000468 | 3300013105 | Bacteria | 53588 |
| 327 | Ga0157369_10000617 | 3300013105 | Bacteria | 46260 |
| 328 | Ga0157369_10001957 | 3300013105 | Bacteria | 24813 |
| 329 | Ga0157369_10007147 | 3300013105 | Bacteria | 12867 |
| 330 | Ga0157369_10007485 | 3300013105 | Bacteria | 12567 |
| 331 | Ga0157369_10007497 | 3300013105 | Bacteria | 12555 |
| 332 | Ga0157369_10007988 | 3300013105 | Bacteria | 12155 |
| 333 | Ga0157369_10018975 | 3300013105 | Bacteria | 7703 |
| 334 | Ga0157369_10019328 | 3300013105 | Bacteria | 7622 |
| 335 | Ga0157369_10028070 | 3300013105 | Bacteria | 6232 |
| 336 | Ga0157369_10056407 | 3300013105 | Unclassified | 4239 |
| 337 | Ga0157369_10075426 | 3300013105 | Bacteria | 3616 |
| 338 | Ga0157369_10100117 | 3300013105 | Bacteria | 3089 |
| 339 | Ga0157374_10000294 | 3300013296 | Bacteria | 46093 |
| 340 | Ga0157374_10003048 | 3300013296 | Bacteria | 14047 |
| 341 | Ga0157374_10003917 | 3300013296 | Bacteria | 12506 |
| 342 | Ga0157374_10009405 | 3300013296 | Bacteria | 8389 |
| 343 | Ga0157374_10015000 | 3300013296 | Bacteria | 6791 |
| 344 | Ga0157374_10075570 | 3300013296 | Bacteria | 3183 |
| 345 | Ga0157378_10000217 | 3300013297 | Bacteria | 55710 |
| 346 | Ga0157378_10000250 | 3300013297 | Bacteria | 52510 |
| 347 | Ga0157378_10002396 | 3300013297 | Bacteria | 16655 |
| 348 | Ga0157378_10004037 | 3300013297 | Bacteria | 12960 |
| 349 | Ga0157378_10028879 | 3300013297 | Bacteria | 4896 |
| 350 | Ga0157378_10031278 | 3300013297 | Bacteria | 4701 |
| 351 | Ga0157378_10040910 | 3300013297 | Bacteria | 4111 |
| 352 | Ga0157378_10053830 | 3300013297 | Bacteria | 3583 |
| 353 | Ga0157378_10069112 | 3300013297 | Bacteria | 3168 |
| 354 | Ga0163162_10005493 | 3300013306 | Bacteria | 12250 |
| 355 | Ga0163162_10021857 | 3300013306 | Bacteria | 6303 |
| 356 | Ga0157372_10000049 | 3300013307 | Bacteria | 142350 |
| 357 | Ga0157372_10000504 | 3300013307 | Bacteria | 42933 |
| 358 | Ga0157372_10000951 | 3300013307 | Bacteria | 31615 |
| 359 | Ga0157372_10001326 | 3300013307 | Bacteria | 26787 |
| 360 | Ga0157372_10001767 | 3300013307 | Bacteria | 23440 |
| 361 | Ga0157372_10002380 | 3300013307 | Bacteria | 20348 |
| 362 | Ga0157372_10005533 | 3300013307 | Bacteria | 13430 |
| 363 | Ga0157372_10026556 | 3300013307 | Bacteria | 6302 |
| 364 | Ga0157372_10034155 | 3300013307 | Bacteria | 5590 |
| 365 | Ga0157372_10085623 | 3300013307 | Bacteria | 3575 |
| 366 | Ga0157372_10131718 | 3300013307 | Unclassified | 2877 |
| 367 | Ga0157372_10143191 | 3300013307 | Bacteria | 2756 |
| 368 | Ga0157372_10249514 | 3300013307 | Bacteria | 2060 |
| 369 | Ga0157375_10015850 | 3300013308 | Bacteria | 6754 |
| 370 | Ga0157375_10022219 | 3300013308 | Bacteria | 5837 |
| 371 | Ga0157375_10117734 | 3300013308 | Unclassified | 2762 |
| 372 | Ga0157375_10135046 | 3300013308 | Bacteria | 2590 |
| 373 | Ga0163163_10012152 | 3300014325 | Bacteria | 7834 |
| 374 | Ga0163163_10016663 | 3300014325 | Bacteria | 6834 |
| 375 | Ga0182008_10004291 | 3300014497 | Bacteria | 8350 |
| 376 | Ga0157377_10006030 | 3300014745 | Bacteria | 5748 |
| 377 | Ga0157379_10011316 | 3300014968 | Bacteria | 7778 |
| 378 | Ga0157379_10021319 | 3300014968 | Bacteria | 5734 |
| 379 | Ga0157376_10000023 | 3300014969 | Bacteria | 223978 |
| 380 | Ga0157376_10000828 | 3300014969 | Bacteria | 20258 |
| 381 | Ga0157376_10007328 | 3300014969 | Bacteria | 7862 |
| 382 | Ga0157376_10019767 | 3300014969 | Bacteria | 5197 |
| 383 | Ga0157376_10051629 | 3300014969 | Bacteria | 3416 |
| 384 | Ga0157376_10057382 | 3300014969 | Bacteria | 3256 |
| 385 | Ga0157376_10063234 | 3300014969 | Bacteria | 3117 |
| 386 | Ga0163161_10014818 | 3300017792 | Bacteria | 5431 |
| 387 | Ga0207697_10015086 | 3300025315 | Bacteria | 3197 |
| 388 | Ga0207656_10017038 | 3300025321 | Bacteria | 2840 |
| 389 | Ga0207692_10005505 | 3300025898 | Bacteria | 5078 |
| 390 | Ga0207692_10031103 | 3300025898 | Bacteria | 2553 |
| 391 | Ga0207642_10023834 | 3300025899 | Bacteria | 2451 |
| 392 | Ga0207647_10016743 | 3300025904 | Bacteria | 4995 |
| 393 | Ga0207685_10001246 | 3300025905 | Bacteria | 5189 |
| 394 | Ga0207699_10000496 | 3300025906 | Bacteria | 19714 |
| 395 | Ga0207645_10000471 | 3300025907 | Bacteria | 33296 |
| 396 | Ga0207645_10003288 | 3300025907 | Bacteria | 12327 |
| 397 | Ga0207643_10000375 | 3300025908 | Bacteria | 30034 |
| 398 | Ga0207705_10044818 | 3300025909 | Unclassified | 3179 |
| 399 | Ga0207705_10057727 | 3300025909 | Bacteria | 2799 |
| 400 | Ga0207684_10001117 | 3300025910 | Bacteria | 29965 |
| 401 | Ga0207684_10007311 | 3300025910 | Bacteria | 9962 |
| 402 | Ga0207684_10007842 | 3300025910 | Bacteria | 9548 |
| 403 | Ga0207684_10110009 | 3300025910 | Unclassified | 2359 |
| 404 | Ga0207684_10145399 | 3300025910 | Bacteria | 2039 |
| 405 | Ga0207654_10000029 | 3300025911 | Bacteria | 123429 |
| 406 | Ga0207654_10000097 | 3300025911 | Bacteria | 59168 |
| 407 | Ga0207654_10013372 | 3300025911 | Bacteria | 4223 |
| 408 | Ga0207707_10003501 | 3300025912 | Bacteria | 13896 |
| 409 | Ga0207707_10038050 | 3300025912 | Unclassified | 4204 |
| 410 | Ga0207695_10000096 | 3300025913 | Bacteria | 265048 |
| 411 | Ga0207695_10000105 | 3300025913 | Bacteria | 254764 |
| 412 | Ga0207695_10000461 | 3300025913 | Bacteria | 88337 |
| 413 | Ga0207695_10006004 | 3300025913 | Bacteria | 15875 |
| 414 | Ga0207695_10015608 | 3300025913 | Bacteria | 8933 |
| 415 | Ga0207695_10023604 | 3300025913 | Bacteria | 6941 |
| 416 | Ga0207695_10035449 | 3300025913 | Bacteria | 5410 |
| 417 | Ga0207695_10043213 | 3300025913 | Bacteria | 4804 |
| 418 | Ga0207695_10069900 | 3300025913 | Bacteria | 3592 |
| 419 | Ga0207671_10000390 | 3300025914 | Bacteria | 61349 |
| 420 | Ga0207671_10001421 | 3300025914 | Bacteria | 27820 |
| 421 | Ga0207671_10010795 | 3300025914 | Bacteria | 7495 |
| 422 | Ga0207671_10061085 | 3300025914 | Bacteria | 2796 |
| 423 | Ga0207693_10000034 | 3300025915 | Bacteria | 113763 |
| 424 | Ga0207693_10000164 | 3300025915 | Bacteria | 59739 |
| 425 | Ga0207693_10000275 | 3300025915 | Bacteria | 47590 |
| 426 | Ga0207693_10003136 | 3300025915 | Bacteria | 14213 |
| 427 | Ga0207693_10011260 | 3300025915 | Bacteria | 7240 |
| 428 | Ga0207693_10023128 | 3300025915 | Unclassified | 4935 |
| 429 | Ga0207693_10042748 | 3300025915 | Bacteria | 3567 |
| 430 | Ga0207693_10047262 | 3300025915 | Bacteria | 3381 |
| 431 | Ga0207663_10025097 | 3300025916 | Unclassified | 3441 |
| 432 | Ga0207663_10075238 | 3300025916 | Bacteria | 2191 |
| 433 | Ga0207660_10018437 | 3300025917 | Bacteria | 4652 |
| 434 | Ga0207660_10030633 | 3300025917 | Bacteria | 3699 |
| 435 | Ga0207662_10002575 | 3300025918 | Bacteria | 9138 |
| 436 | Ga0207657_10000254 | 3300025919 | Bacteria | 56893 |
| 437 | Ga0207657_10002735 | 3300025919 | Bacteria | 18996 |
| 438 | Ga0207657_10005257 | 3300025919 | Bacteria | 13559 |
| 439 | Ga0207649_10000233 | 3300025920 | Bacteria | 45406 |
| 440 | Ga0207649_10016237 | 3300025920 | Bacteria | 4194 |
| 441 | Ga0207649_10018077 | 3300025920 | Bacteria | 4002 |
| 442 | Ga0207649_10028858 | 3300025920 | Bacteria | 3271 |
| 443 | Ga0207649_10051043 | 3300025920 | Bacteria | 2560 |
| 444 | Ga0207649_10052436 | 3300025920 | Bacteria | 2530 |
| 445 | Ga0207649_10096657 | 3300025920 | Bacteria | 1946 |
| 446 | Ga0207652_10006558 | 3300025921 | Bacteria | 9380 |
| 447 | Ga0207652_10021150 | 3300025921 | Bacteria | 5368 |
| 448 | Ga0207646_10000471 | 3300025922 | Bacteria | 53728 |
| 449 | Ga0207646_10010305 | 3300025922 | Bacteria | 9142 |
| 450 | Ga0207646_10032934 | 3300025922 | Unclassified | 4687 |
| 451 | Ga0207681_10053553 | 3300025923 | Bacteria | 2740 |
| 452 | Ga0207694_10000104 | 3300025924 | Bacteria | 91561 |
| 453 | Ga0207694_10005650 | 3300025924 | Bacteria | 9595 |
| 454 | Ga0207650_10000107 | 3300025925 | Bacteria | 109863 |
| 455 | Ga0207650_10008720 | 3300025925 | Bacteria | 6924 |
| 456 | Ga0207650_10030113 | 3300025925 | Bacteria | 3907 |
| 457 | Ga0207687_10004264 | 3300025927 | Bacteria | 9564 |
| 458 | Ga0207700_10000111 | 3300025928 | Bacteria | 48784 |
| 459 | Ga0207700_10032088 | 3300025928 | Unclassified | 3741 |
| 460 | Ga0207700_10098057 | 3300025928 | Bacteria | 2330 |
| 461 | Ga0207700_10138713 | 3300025928 | Unclassified | 1995 |
| 462 | Ga0207664_10025215 | 3300025929 | Bacteria | 4476 |
| 463 | Ga0207664_10035263 | 3300025929 | Bacteria | 3859 |
| 464 | Ga0207664_10148565 | 3300025929 | Bacteria | 1989 |
| 465 | Ga0207644_10004657 | 3300025931 | Bacteria | 8914 |
| 466 | Ga0207706_10000238 | 3300025933 | Bacteria | 60595 |
| 467 | Ga0207706_10003488 | 3300025933 | Bacteria | 15016 |
| 468 | Ga0207706_10005861 | 3300025933 | Bacteria | 11429 |
| 469 | Ga0207706_10033194 | 3300025933 | Bacteria | 4594 |
| 470 | Ga0207669_10039321 | 3300025937 | Bacteria | 2732 |
| 471 | Ga0207704_10006270 | 3300025938 | Bacteria | 5531 |
| 472 | Ga0207704_10014847 | 3300025938 | Unclassified | 3948 |
| 473 | Ga0207665_10000040 | 3300025939 | Bacteria | 84223 |
| 474 | Ga0207665_10003529 | 3300025939 | Bacteria | 10445 |
| 475 | Ga0207665_10006116 | 3300025939 | Bacteria | 7992 |
| 476 | Ga0207665_10009881 | 3300025939 | Bacteria | 6262 |
| 477 | Ga0207665_10011614 | 3300025939 | Bacteria | 5788 |
| 478 | Ga0207665_10011903 | 3300025939 | Bacteria | 5713 |
| 479 | Ga0207665_10011970 | 3300025939 | Bacteria | 5698 |
| 480 | Ga0207665_10019746 | 3300025939 | Bacteria | 4429 |
| 481 | Ga0207691_10000751 | 3300025940 | Bacteria | 32082 |
| 482 | Ga0207691_10081386 | 3300025940 | Bacteria | 2911 |
| 483 | Ga0207711_10000013 | 3300025941 | Bacteria | 514850 |
| 484 | Ga0207711_10000708 | 3300025941 | Bacteria | 32770 |
| 485 | Ga0207711_10072624 | 3300025941 | Bacteria | 2989 |
| 486 | Ga0207689_10000105 | 3300025942 | Bacteria | 68595 |
| 487 | Ga0207689_10000713 | 3300025942 | Bacteria | 31792 |
| 488 | Ga0207689_10003153 | 3300025942 | Bacteria | 15125 |
| 489 | Ga0207689_10024883 | 3300025942 | Bacteria | 5019 |
| 490 | Ga0207689_10047852 | 3300025942 | Bacteria | 3528 |
| 491 | Ga0207661_10000138 | 3300025944 | Bacteria | 46093 |
| 492 | Ga0207661_10014752 | 3300025944 | Bacteria | 5732 |
| 493 | Ga0207661_10023158 | 3300025944 | Bacteria | 4690 |
| 494 | Ga0207661_10049937 | 3300025944 | Bacteria | 3332 |
| 495 | Ga0207661_10149111 | 3300025944 | Bacteria | 2020 |
| 496 | Ga0207679_10000058 | 3300025945 | Bacteria | 101602 |
| 497 | Ga0207679_10016880 | 3300025945 | Unclassified | 4854 |
| 498 | Ga0207667_10001323 | 3300025949 | Bacteria | 31111 |
| 499 | Ga0207667_10004082 | 3300025949 | Bacteria | 17933 |
| 500 | Ga0207667_10005768 | 3300025949 | Bacteria | 15107 |
| 501 | Ga0207667_10005835 | 3300025949 | Bacteria | 15004 |
| 502 | Ga0207667_10028895 | 3300025949 | Bacteria | 6019 |
| 503 | Ga0207667_10031572 | 3300025949 | Bacteria | 5716 |
| 504 | Ga0207667_10038955 | 3300025949 | Bacteria | 5068 |
| 505 | Ga0207667_10050227 | 3300025949 | Bacteria | 4401 |
| 506 | Ga0207667_10089642 | 3300025949 | Bacteria | 3178 |
| 507 | Ga0207712_10006914 | 3300025961 | Bacteria | 7158 |
| 508 | Ga0207668_10003703 | 3300025972 | Bacteria | 8999 |
| 509 | Ga0207640_10013067 | 3300025981 | Bacteria | 4748 |
| 510 | Ga0207640_10031274 | 3300025981 | Bacteria | 3287 |
| 511 | Ga0207658_10034607 | 3300025986 | Bacteria | 3611 |
| 512 | Ga0207677_10001114 | 3300026023 | Bacteria | 14641 |
| 513 | Ga0207677_10003786 | 3300026023 | Bacteria | 8038 |
| 514 | Ga0207677_10004408 | 3300026023 | Bacteria | 7548 |
| 515 | Ga0207677_10018639 | 3300026023 | Bacteria | 4170 |
| 516 | Ga0207677_10025030 | 3300026023 | Bacteria | 3718 |
| 517 | Ga0207703_10002099 | 3300026035 | Bacteria | 17533 |
| 518 | Ga0207703_10002661 | 3300026035 | Bacteria | 15360 |
| 519 | Ga0207703_10042648 | 3300026035 | Bacteria | 3640 |
| 520 | Ga0207703_10097565 | 3300026035 | Bacteria | 2483 |
| 521 | Ga0207703_10129058 | 3300026035 | Bacteria | 2181 |
| 522 | Ga0207639_10000147 | 3300026041 | Bacteria | 52732 |
| 523 | Ga0207639_10042714 | 3300026041 | Bacteria | 3399 |
| 524 | Ga0207639_10056976 | 3300026041 | Bacteria | 2998 |
| 525 | Ga0207678_10000256 | 3300026067 | Bacteria | 48140 |
| 526 | Ga0207678_10001492 | 3300026067 | Bacteria | 21439 |
| 527 | Ga0207702_10000436 | 3300026078 | Bacteria | 47578 |
| 528 | Ga0207702_10000679 | 3300026078 | Bacteria | 36920 |
| 529 | Ga0207702_10000860 | 3300026078 | Bacteria | 31725 |
| 530 | Ga0207702_10012416 | 3300026078 | Bacteria | 7092 |
| 531 | Ga0207702_10017930 | 3300026078 | Bacteria | 5856 |
| 532 | Ga0207702_10020318 | 3300026078 | Bacteria | 5501 |
| 533 | Ga0207702_10025887 | 3300026078 | Unclassified | 4870 |
| 534 | Ga0207702_10037829 | 3300026078 | Bacteria | 4040 |
| 535 | Ga0207702_10128335 | 3300026078 | Bacteria | 2279 |
| 536 | Ga0207641_10000163 | 3300026088 | Bacteria | 94033 |
| 537 | Ga0207641_10003212 | 3300026088 | Bacteria | 14628 |
| 538 | Ga0207641_10013835 | 3300026088 | Bacteria | 6618 |
| 539 | Ga0207641_10060386 | 3300026088 | Unclassified | 3231 |
| 540 | Ga0207641_10066043 | 3300026088 | Bacteria | 3096 |
| 541 | Ga0207648_10000604 | 3300026089 | Bacteria | 40445 |
| 542 | Ga0207648_10006028 | 3300026089 | Bacteria | 12087 |
| 543 | Ga0207648_10017106 | 3300026089 | Bacteria | 6608 |
| 544 | Ga0207676_10000142 | 3300026095 | Bacteria | 62851 |
| 545 | Ga0207676_10001489 | 3300026095 | Bacteria | 17325 |
| 546 | Ga0207676_10027492 | 3300026095 | Bacteria | 4237 |
| 547 | Ga0207676_10091999 | 3300026095 | Bacteria | 2493 |
| 548 | Ga0207674_10000336 | 3300026116 | Bacteria | 60214 |
| 549 | Ga0207674_10006617 | 3300026116 | Bacteria | 13618 |
| 550 | Ga0207674_10013044 | 3300026116 | Bacteria | 9256 |
| 551 | Ga0207674_10028182 | 3300026116 | Bacteria | 5931 |
| 552 | Ga0207674_10074895 | 3300026116 | Bacteria | 3396 |
| 553 | Ga0207675_100033596 | 3300026118 | Bacteria | 4779 |
| 554 | Ga0207675_100082153 | 3300026118 | Bacteria | 3022 |
| 555 | Ga0207683_10000078 | 3300026121 | Bacteria | 77219 |
| 556 | Ga0207683_10001600 | 3300026121 | Bacteria | 20352 |
| 557 | Ga0207683_10006753 | 3300026121 | Bacteria | 9816 |
| 558 | Ga0207698_10000020 | 3300026142 | Bacteria | 139630 |
| 559 | Ga0207698_10000316 | 3300026142 | Bacteria | 28798 |
| 560 | Ga0207698_10010630 | 3300026142 | Bacteria | 5931 |
| 561 | Ga0207698_10093894 | 3300026142 | Unclassified | 2465 |
| 562 | Ga0209588_1003163 | 3300027671 | Bacteria | 4540 |
| 563 | Ga0209588_1008523 | 3300027671 | Unclassified | 3043 |
| 564 | Ga0265354_1000067 | 3300028016 | Bacteria | 17414 |
| 565 | Ga0265356_1000027 | 3300028017 | Bacteria | 22799 |
| 566 | Ga0268266_10000276 | 3300028379 | Bacteria | 84981 |
| 567 | Ga0268266_10022928 | 3300028379 | Bacteria | 5312 |
| 568 | Ga0268266_10049729 | 3300028379 | Bacteria | 3596 |
| 569 | Ga0268265_10018167 | 3300028380 | Bacteria | 4870 |
| 570 | Ga0268264_10003435 | 3300028381 | Bacteria | 13665 |
| 571 | Ga0268264_10005525 | 3300028381 | Bacteria | 10721 |
| 572 | Ga0268264_10028085 | 3300028381 | Bacteria | 4602 |
| 573 | Ga0265338_10000633 | 3300028800 | Bacteria | 61054 |
| 574 | Ga0265762_1000402 | 3300030760 | Bacteria | 7440 |
| 575 | Ga0265762_1000913 | 3300030760 | Bacteria | 5265 |
| 576 | Ga0265770_1001056 | 3300030878 | Bacteria | 3822 |
| 577 | Ga0265760_10009661 | 3300031090 | Bacteria | 2755 |
| 578 | Ga0265339_10004676 | 3300031249 | Bacteria | 9294 |
| 579 | Ga0265316_10026823 | 3300031344 | Bacteria | 4784 |
| 580 | Ga0265314_10039621 | 3300031711 | Bacteria | 3391 |
| 581 | Ga0373959_0000161 | 3300034820 | Bacteria | 15201 |
| 582 | Ga0373932_0004078 | 3300035112 | Bacteria | 3471 |
| 583 | Ga0373936_0020305 | 3300035113 | Unclassified | 2580 |
| 584 | Ga0373960_0009799 | 3300035121 | Bacteria | 2329 |
| 585 | Ga0373946_0000567 | 3300035171 | Bacteria | 12201 |
| 586 | Ga0373946_0021182 | 3300035171 | Unclassified | 2519 |
| 587 | Ga0373931_0032592 | 3300035691 | Bacteria | 2697 |
| 588 | Ga0373935_0001647 | 3300035692 | Bacteria | 12486 |
| 589 | Ga0373935_0064068 | 3300035692 | Unclassified | 2356 |
| 590 | Ga0373927_0000203 | 3300035695 | Bacteria | 47593 |
| 591 | Ga0373927_0020898 | 3300035695 | Unclassified | 4290 |
| 592 | Ga0373927_0075539 | 3300035695 | Bacteria | 2182 |
| 593 | Ga0373933_0058870 | 3300035724 | Unclassified | 2312 |
| 594 | Ga0373947_0005482 | 3300035725 | Bacteria | 7404 |
| 595 | Ga0373937_0094651 | 3300036401 | Bacteria | 2770 |
| 596 | Ga0373925_0000172 | 3300037068 | Bacteria | 70000 |
| 597 | Ga0373925_0009682 | 3300037068 | Bacteria | 7010 |
| 598 | Ga0373925_0012233 | 3300037068 | Bacteria | 6210 |
| 599 | Ga0373925_0061770 | 3300037068 | Bacteria | 2815 |
| 600 | Ga0373925_0063691 | 3300037068 | Bacteria | 2775 |
| 601 | Ga0436365_1656802 | 3300039437 | Bacteria | 9654 |
| 602 | Ga0466963_0005652 | 3300044694 | Bacteria | 7344 |
| 603 | Ga0466963_0082063 | 3300044694 | Bacteria | 2185 |
| 604 | Ga0466967_0018480 | 3300045976 | Bacteria | 5573 |
| 605 | Ga0495603_0022592 | 3300046455 | Bacteria | 3807 |
| 606 | Ga0495629_0045788 | 3300046459 | Bacteria | 3069 |
| 607 | Ga0495641_0028581 | 3300046461 | Bacteria | 2697 |
| 608 | Ga0495580_0003809 | 3300046472 | Bacteria | 12776 |
| 609 | Ga0495580_0004417 | 3300046472 | Bacteria | 11814 |
| 610 | Ga0495580_0013349 | 3300046472 | Bacteria | 6274 |
| 611 | Ga0495580_0021204 | 3300046472 | Bacteria | 4797 |
| 612 | Ga0495580_0023451 | 3300046472 | Unclassified | 4531 |
| 613 | Ga0495580_0043095 | 3300046472 | Bacteria | 3213 |
| 614 | Ga0495580_0047984 | 3300046472 | Bacteria | 3026 |
| 615 | Ga0495580_0083390 | 3300046472 | Unclassified | 2227 |
| 616 | Ga0495582_0000277 | 3300046473 | Bacteria | 28667 |
| 617 | Ga0495582_0002058 | 3300046473 | Bacteria | 11248 |
| 618 | Ga0495664_0107868 | 3300046477 | Unclassified | 1680 |
| 619 | Ga0495630_0005254 | 3300046517 | Bacteria | 9133 |
| 620 | Ga0495665_0004469 | 3300046531 | Bacteria | 7546 |
| 621 | Ga0495640_0040545 | 3300046533 | Bacteria | 3260 |
| 622 | Ga0495634_0079352 | 3300046642 | Bacteria | 2150 |
| 623 | Ga0495647_0002757 | 3300046681 | Bacteria | 5575 |
| 624 | Ga0495658_0005438 | 3300046683 | Bacteria | 6262 |
| 625 | Ga0495658_0021957 | 3300046683 | Bacteria | 3370 |
| 626 | Ga0495669_0008161 | 3300046684 | Unclassified | 4394 |
| 627 | Ga0495613_0010773 | 3300046689 | Bacteria | 6783 |
| 628 | Ga0495624_0063174 | 3300046690 | Bacteria | 2315 |
| 629 | Ga0495581_0022292 | 3300047315 | Bacteria | 3670 |
| 630 | Ga0495674_0165823 | 3300047319 | Unclassified | 1846 |
| 631 | Ga0495676_0018164 | 3300047321 | Bacteria | 6203 |
| 632 | Ga0495593_0010495 | 3300047673 | Bacteria | 5347 |
| 633 | Ga0495602_0042183 | 3300048088 | Bacteria | 4160 |
| 634 | Ga0495602_0104809 | 3300048088 | Bacteria | 2313 |
| 635 | Ga0496100_0000958 | 3300048903 | Bacteria | 13809 |
| 636 | Ga0496101_0019396 | 3300048904 | Bacteria | 4642 |
| 637 | Ga0496102_0001575 | 3300048905 | Bacteria | 20118 |
| 638 | Ga0496102_0242480 | 3300048905 | Bacteria | 1699 |
| 639 | Ga0496103_0013534 | 3300048906 | Bacteria | 4838 |
| 640 | Ga0496104_0028148 | 3300048907 | Bacteria | 5208 |
| 641 | Ga0496104_0139053 | 3300048907 | Bacteria | 2334 |
| 642 | Ga0496104_0147163 | 3300048907 | Bacteria | 2262 |
| 643 | Ga0496106_0031226 | 3300048909 | Bacteria | 3969 |
| 644 | Ga0496106_0045641 | 3300048909 | Bacteria | 3292 |
| 645 | Ga0496108_0000082 | 3300048911 | Bacteria | 101998 |
| 646 | Ga0496109_0000148 | 3300048912 | Bacteria | 69299 |
| 647 | Ga0496110_0002311 | 3300048913 | Bacteria | 14249 |
| 648 | Ga0496110_0029670 | 3300048913 | Bacteria | 4710 |
| 649 | Ga0496111_0010400 | 3300048914 | Bacteria | 6243 |
| 650 | Ga0496111_0040939 | 3300048914 | Bacteria | 3324 |
| 651 | Ga0496112_0000093 | 3300048915 | Bacteria | 58124 |
| 652 | Ga0496112_0015242 | 3300048915 | Bacteria | 7166 |
| 653 | Ga0496112_0052940 | 3300048915 | Bacteria | 3985 |
| 654 | Ga0496112_0103558 | 3300048915 | Bacteria | 2816 |
| 655 | Ga0496113_0003134 | 3300048916 | Bacteria | 9841 |
| 656 | Ga0496113_0016718 | 3300048916 | Bacteria | 5073 |
| 657 | Ga0496114_0013547 | 3300048917 | Bacteria | 6541 |
| 658 | Ga0496114_0015725 | 3300048917 | Bacteria | 6089 |
| 659 | Ga0496114_0036562 | 3300048917 | Bacteria | 4059 |
| 660 | Ga0496114_0165154 | 3300048917 | Bacteria | 1927 |
| 661 | Ga0496115_0003600 | 3300048918 | Bacteria | 11135 |
| 662 | Ga0496115_0006608 | 3300048918 | Bacteria | 8500 |
| 663 | Ga0496115_0007549 | 3300048918 | Bacteria | 8008 |
| 664 | Ga0496115_0085588 | 3300048918 | Bacteria | 2571 |
| 665 | Ga0496115_0164938 | 3300048918 | Bacteria | 1832 |
| 666 | Ga0496126_0001121 | 3300048929 | Bacteria | 44841 |
| 667 | nmdc:mga05p37_78294_c1 | 3300050507 | Unclassified | 4070 |
| 668 | nmdc:mga0n895_102_c1 | 3300050512 | Bacteria | 50003 |
| 669 | nmdc:mga0n895_11535_c1 | 3300050512 | Bacteria | 7891 |
| 670 | nmdc:mga0n895_30546_c1 | 3300050512 | Bacteria | 5151 |
| 671 | nmdc:mga0n895_325_c1 | 3300050512 | Bacteria | 30724 |
| 672 | nmdc:mga0n895_44202_c1 | 3300050512 | Bacteria | 4344 |
| 673 | nmdc:mga0n895_8777_c1 | 3300050512 | Bacteria | 8790 |
| 674 | nmdc:mga0rr50_109473_c1 | 3300050513 | Bacteria | 2184 |
| 675 | nmdc:mga0rr50_110_c1 | 3300050513 | Bacteria | 20297 |
| 676 | nmdc:mga0rr50_199197_c1 | 3300050513 | Bacteria | 1645 |
| 677 | nmdc:mga0rr50_87451_c1 | 3300050513 | Unclassified | 2419 |
| 678 | nmdc:mga08x19_1121_c1 | 3300050514 | Bacteria | 16708 |
| 679 | nmdc:mga08x19_23657_c1 | 3300050514 | Unclassified | 3812 |
| 680 | nmdc:mga08x19_27595_c1 | 3300050514 | Unclassified | 3551 |
| 681 | nmdc:mga08x19_29357_c1 | 3300050514 | Bacteria | 3449 |
| 682 | nmdc:mga08x19_3025_c1 | 3300050514 | Bacteria | 10111 |
| 683 | nmdc:mga08x19_90137_c1 | 3300050514 | Bacteria | 2023 |
| 684 | nmdc:mga08x19_9881_c1 | 3300050514 | Bacteria | 5721 |
| 685 | nmdc:mga0a205_131_c1 | 3300050515 | Bacteria | 46472 |
| 686 | nmdc:mga0a205_2453_c1 | 3300050515 | Bacteria | 16370 |
| 687 | Ga0495601_0034117 | 3300053077 | Bacteria | 3173 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050513 | nmdc:mga0rr50_199197_c1 | nmdc:mga0rr50_199197_c1_234_1622 | 459 |
| 2 | 3300046477 | Ga0495664_0107868 | Ga0495664_0107868_144_1670 | 505 |
| 3 | 3300048918 | Ga0496115_0164938 | Ga0496115_0164938_245_1795 | 510 |
| 4 | 3300006852 | Ga0075433_10053871 | Ga0075433_100538711 | 514 |
| 5 | 3300048917 | Ga0496114_0013547 | Ga0496114_0013547_4254_5834 | 520 |
| 6 | 3300025321 | Ga0207656_10017038 | Ga0207656_100170381 | 521 |
| 7 | 3300036401 | Ga0373937_0094651 | Ga0373937_0094651_1151_2743 | 528 |
| 8 | 3300047319 | Ga0495674_0165823 | Ga0495674_0165823_83_1675 | 528 |
| 9 | 3300048915 | Ga0496112_0015242 | Ga0496112_0015242_4888_6480 | 528 |
| 10 | 3300048905 | Ga0496102_0242480 | Ga0496102_0242480_48_1643 | 529 |
| 11 | 3300005344 | Ga0070661_100009772 | Ga0070661_1000097723 | 537 |
| 12 | 3300050514 | nmdc:mga08x19_90137_c1 | nmdc:mga08x19_90137_c1_325_1953 | 538 |
| 13 | 3300006871 | Ga0075434_100001669 | Ga0075434_1000016695 | 541 |
| 14 | 3300046642 | Ga0495634_0079352 | Ga0495634_0079352_474_2108 | 541 |
| 15 | 3300047321 | Ga0495676_0018164 | Ga0495676_0018164_44_1678 | 541 |
| 16 | 3300050512 | nmdc:mga0n895_11535_c1 | nmdc:mga0n895_11535_c1_4524_6158 | 541 |
| 17 | 3300050512 | nmdc:mga0n895_44202_c1 | nmdc:mga0n895_44202_c1_2452_4086 | 541 |
| 18 | 3300035695 | Ga0373927_0075539 | Ga0373927_0075539_57_1760 | 546 |
| 19 | 3300009177 | Ga0105248_10000003 | Ga0105248_10000003673 | 557 |
| 20 | 3300025941 | Ga0207711_10000013 | Ga0207711_10000013249 | 557 |
| 21 | 3300037068 | Ga0373925_0063691 | Ga0373925_0063691_716_2419 | 557 |
| 22 | 3300005440 | Ga0070705_100008919 | Ga0070705_1000089194 | 558 |
| 23 | 3300005518 | Ga0070699_100010792 | Ga0070699_1000107927 | 558 |
| 24 | 3300005518 | Ga0070699_100011851 | Ga0070699_1000118515 | 558 |
| 25 | 3300005545 | Ga0070695_100004421 | Ga0070695_1000044216 | 558 |
| 26 | 3300005549 | Ga0070704_100097476 | Ga0070704_1000974761 | 558 |
| 27 | 3300006871 | Ga0075434_100042690 | Ga0075434_1000426904 | 558 |
| 28 | 3300025910 | Ga0207684_10145399 | Ga0207684_101453992 | 558 |
| 29 | 3300025922 | Ga0207646_10010305 | Ga0207646_100103052 | 558 |
| 30 | 3300027671 | Ga0209588_1003163 | Ga0209588_10031633 | 558 |
| 31 | 3300005445 | Ga0070708_100048646 | Ga0070708_1000486462 | 560 |
| 32 | 3300009147 | Ga0114129_10109743 | Ga0114129_101097433 | 560 |
| 33 | 3300034820 | Ga0373959_0000161 | Ga0373959_0000161_6686_8380 | 560 |
| 34 | 3300048918 | Ga0496115_0003600 | Ga0496115_0003600_7267_8955 | 560 |
| 35 | 3300050512 | nmdc:mga0n895_8777_c1 | nmdc:mga0n895_8777_c1_869_2563 | 560 |
| 36 | 3300005536 | Ga0070697_100051952 | Ga0070697_1000519523 | 561 |
| 37 | 3300005435 | Ga0070714_100042616 | Ga0070714_1000426163 | 562 |
| 38 | 3300005435 | Ga0070714_100051489 | Ga0070714_1000514892 | 562 |
| 39 | 3300005436 | Ga0070713_100041168 | Ga0070713_1000411682 | 562 |
| 40 | 3300006914 | Ga0075436_100017147 | Ga0075436_1000171474 | 562 |
| 41 | 3300007076 | Ga0075435_100075816 | Ga0075435_1000758161 | 562 |
| 42 | 3300009093 | Ga0105240_10022638 | Ga0105240_100226384 | 562 |
| 43 | 3300013307 | Ga0157372_10249514 | Ga0157372_102495142 | 562 |
| 44 | 3300025929 | Ga0207664_10035263 | Ga0207664_100352633 | 562 |
| 45 | 3300025929 | Ga0207664_10148565 | Ga0207664_101485652 | 562 |
| 46 | 3300050513 | nmdc:mga0rr50_109473_c1 | nmdc:mga0rr50_109473_c1_329_2032 | 562 |
| 47 | 3300050514 | nmdc:mga08x19_29357_c1 | nmdc:mga08x19_29357_c1_1620_3323 | 562 |
| 48 | 3300050514 | nmdc:mga08x19_3025_c1 | nmdc:mga08x19_3025_c1_4221_5924 | 562 |
| 49 | 3300005434 | Ga0070709_10000899 | Ga0070709_100008999 | 564 |
| 50 | 3300005444 | Ga0070694_100004167 | Ga0070694_1000041677 | 564 |
| 51 | 3300005445 | Ga0070708_100000598 | Ga0070708_10000059815 | 564 |
| 52 | 3300005445 | Ga0070708_100030590 | Ga0070708_1000305905 | 564 |
| 53 | 3300005468 | Ga0070707_100009766 | Ga0070707_1000097662 | 564 |
| 54 | 3300005471 | Ga0070698_100043123 | Ga0070698_1000431233 | 564 |
| 55 | 3300005518 | Ga0070699_100006667 | Ga0070699_1000066676 | 564 |
| 56 | 3300005518 | Ga0070699_100029973 | Ga0070699_1000299733 | 564 |
| 57 | 3300005518 | Ga0070699_100035282 | Ga0070699_1000352822 | 564 |
| 58 | 3300005530 | Ga0070679_100022913 | Ga0070679_1000229133 | 564 |
| 59 | 3300005536 | Ga0070697_100000518 | Ga0070697_1000005184 | 564 |
| 60 | 3300005536 | Ga0070697_100008196 | Ga0070697_1000081966 | 564 |
| 61 | 3300005545 | Ga0070695_100000210 | Ga0070695_1000002106 | 564 |
| 62 | 3300005546 | Ga0070696_100002816 | Ga0070696_1000028164 | 564 |
| 63 | 3300005547 | Ga0070693_100000105 | Ga0070693_10000010515 | 564 |
| 64 | 3300005563 | Ga0068855_100080770 | Ga0068855_1000807702 | 564 |
| 65 | 3300005841 | Ga0068863_100010773 | Ga0068863_1000107732 | 564 |
| 66 | 3300006175 | Ga0070712_100056545 | Ga0070712_1000565452 | 564 |
| 67 | 3300006237 | Ga0097621_100005597 | Ga0097621_1000055977 | 564 |
| 68 | 3300006871 | Ga0075434_100009940 | Ga0075434_1000099405 | 564 |
| 69 | 3300007265 | Ga0099794_10003075 | Ga0099794_100030752 | 564 |
| 70 | 3300007265 | Ga0099794_10007517 | Ga0099794_100075172 | 564 |
| 71 | 3300007265 | Ga0099794_10019157 | Ga0099794_100191572 | 564 |
| 72 | 3300007788 | Ga0099795_10004867 | Ga0099795_100048672 | 564 |
| 73 | 3300010159 | Ga0099796_10002143 | Ga0099796_100021433 | 564 |
| 74 | 3300013105 | Ga0157369_10007988 | Ga0157369_100079887 | 564 |
| 75 | 3300013297 | Ga0157378_10004037 | Ga0157378_100040372 | 564 |
| 76 | 3300014325 | Ga0163163_10016663 | Ga0163163_100166638 | 564 |
| 77 | 3300014968 | Ga0157379_10021319 | Ga0157379_100213192 | 564 |
| 78 | 3300014969 | Ga0157376_10000023 | Ga0157376_10000023102 | 564 |
| 79 | 3300014969 | Ga0157376_10000828 | Ga0157376_100008289 | 564 |
| 80 | 3300025899 | Ga0207642_10023834 | Ga0207642_100238342 | 564 |
| 81 | 3300025906 | Ga0207699_10000496 | Ga0207699_1000049611 | 564 |
| 82 | 3300025910 | Ga0207684_10007842 | Ga0207684_100078421 | 564 |
| 83 | 3300025915 | Ga0207693_10042748 | Ga0207693_100427482 | 564 |
| 84 | 3300025921 | Ga0207652_10021150 | Ga0207652_100211504 | 564 |
| 85 | 3300025939 | Ga0207665_10011614 | Ga0207665_100116144 | 564 |
| 86 | 3300025939 | Ga0207665_10011903 | Ga0207665_100119034 | 564 |
| 87 | 3300025949 | Ga0207667_10089642 | Ga0207667_100896422 | 564 |
| 88 | 3300026088 | Ga0207641_10003212 | Ga0207641_100032128 | 564 |
| 89 | 3300027671 | Ga0209588_1008523 | Ga0209588_10085231 | 564 |
| 90 | 3300028016 | Ga0265354_1000067 | Ga0265354_100006711 | 564 |
| 91 | 3300028379 | Ga0268266_10000276 | Ga0268266_1000027661 | 564 |
| 92 | 3300028381 | Ga0268264_10028085 | Ga0268264_100280855 | 564 |
| 93 | 3300030878 | Ga0265770_1001056 | Ga0265770_10010562 | 564 |
| 94 | 3300031090 | Ga0265760_10009661 | Ga0265760_100096612 | 564 |
| 95 | 3300035171 | Ga0373946_0000567 | Ga0373946_0000567_4922_6625 | 564 |
| 96 | 3300035691 | Ga0373931_0032592 | Ga0373931_0032592_910_2613 | 564 |
| 97 | 3300035695 | Ga0373927_0000203 | Ga0373927_0000203_10974_12677 | 564 |
| 98 | 3300035725 | Ga0373947_0005482 | Ga0373947_0005482_4150_5853 | 564 |
| 99 | 3300037068 | Ga0373925_0000172 | Ga0373925_0000172_1221_2924 | 564 |
| 100 | 3300039437 | Ga0436365_1656802 | Ga0436365_1656802_3680_5383 | 564 |
| 101 | 3300046455 | Ga0495603_0022592 | Ga0495603_0022592_145_1848 | 564 |
| 102 | 3300046459 | Ga0495629_0045788 | Ga0495629_0045788_46_1749 | 564 |
| 103 | 3300046461 | Ga0495641_0028581 | Ga0495641_0028581_674_2377 | 564 |
| 104 | 3300046472 | Ga0495580_0021204 | Ga0495580_0021204_3041_4744 | 564 |
| 105 | 3300046472 | Ga0495580_0047984 | Ga0495580_0047984_44_1747 | 564 |
| 106 | 3300046473 | Ga0495582_0000277 | Ga0495582_0000277_12435_14138 | 564 |
| 107 | 3300046517 | Ga0495630_0005254 | Ga0495630_0005254_5011_6714 | 564 |
| 108 | 3300046533 | Ga0495640_0040545 | Ga0495640_0040545_271_1974 | 564 |
| 109 | 3300046681 | Ga0495647_0002757 | Ga0495647_0002757_2489_4192 | 564 |
| 110 | 3300046683 | Ga0495658_0021957 | Ga0495658_0021957_614_2317 | 564 |
| 111 | 3300046689 | Ga0495613_0010773 | Ga0495613_0010773_681_2384 | 564 |
| 112 | 3300046690 | Ga0495624_0063174 | Ga0495624_0063174_90_1793 | 564 |
| 113 | 3300047315 | Ga0495581_0022292 | Ga0495581_0022292_1376_3079 | 564 |
| 114 | 3300047673 | Ga0495593_0010495 | Ga0495593_0010495_1056_2759 | 564 |
| 115 | 3300048917 | Ga0496114_0036562 | Ga0496114_0036562_1559_3262 | 564 |
| 116 | 3300048917 | Ga0496114_0165154 | Ga0496114_0165154_127_1830 | 564 |
| 117 | 3300048918 | Ga0496115_0006608 | Ga0496115_0006608_789_2492 | 564 |
| 118 | 3300048918 | Ga0496115_0085588 | Ga0496115_0085588_778_2481 | 564 |
| 119 | 3300050514 | nmdc:mga08x19_1121_c1 | nmdc:mga08x19_1121_c1_9630_11333 | 564 |
| 120 | 3300005328 | Ga0070676_10027734 | Ga0070676_100277342 | 565 |
| 121 | 3300005329 | Ga0070683_100000496 | Ga0070683_10000049624 | 565 |
| 122 | 3300005330 | Ga0070690_100009920 | Ga0070690_1000099203 | 565 |
| 123 | 3300005331 | Ga0070670_100010229 | Ga0070670_1000102292 | 565 |
| 124 | 3300005334 | Ga0068869_100003211 | Ga0068869_1000032116 | 565 |
| 125 | 3300005334 | Ga0068869_100086524 | Ga0068869_1000865241 | 565 |
| 126 | 3300005338 | Ga0068868_100003471 | Ga0068868_1000034719 | 565 |
| 127 | 3300005338 | Ga0068868_100008104 | Ga0068868_1000081044 | 565 |
| 128 | 3300005338 | Ga0068868_100044042 | Ga0068868_1000440422 | 565 |
| 129 | 3300005339 | Ga0070660_100009323 | Ga0070660_1000093233 | 565 |
| 130 | 3300005340 | Ga0070689_100000550 | Ga0070689_10000055014 | 565 |
| 131 | 3300005341 | Ga0070691_10036812 | Ga0070691_100368122 | 565 |
| 132 | 3300005343 | Ga0070687_100006094 | Ga0070687_1000060943 | 565 |
| 133 | 3300005344 | Ga0070661_100002953 | Ga0070661_1000029533 | 565 |
| 134 | 3300005344 | Ga0070661_100006808 | Ga0070661_1000068084 | 565 |
| 135 | 3300005347 | Ga0070668_100012100 | Ga0070668_1000121001 | 565 |
| 136 | 3300005353 | Ga0070669_100012871 | Ga0070669_1000128712 | 565 |
| 137 | 3300005354 | Ga0070675_100009201 | Ga0070675_1000092015 | 565 |
| 138 | 3300005355 | Ga0070671_100045357 | Ga0070671_1000453572 | 565 |
| 139 | 3300005355 | Ga0070671_100089295 | Ga0070671_1000892952 | 565 |
| 140 | 3300005356 | Ga0070674_100003574 | Ga0070674_1000035749 | 565 |
| 141 | 3300005364 | Ga0070673_100084581 | Ga0070673_1000845812 | 565 |
| 142 | 3300005365 | Ga0070688_100000197 | Ga0070688_10000019720 | 565 |
| 143 | 3300005366 | Ga0070659_100006718 | Ga0070659_1000067185 | 565 |
| 144 | 3300005435 | Ga0070714_100001358 | Ga0070714_10000135819 | 565 |
| 145 | 3300005435 | Ga0070714_100006555 | Ga0070714_1000065557 | 565 |
| 146 | 3300005436 | Ga0070713_100000134 | Ga0070713_10000013444 | 565 |
| 147 | 3300005436 | Ga0070713_100001365 | Ga0070713_10000136510 | 565 |
| 148 | 3300005436 | Ga0070713_100002354 | Ga0070713_1000023547 | 565 |
| 149 | 3300005436 | Ga0070713_100065399 | Ga0070713_1000653992 | 565 |
| 150 | 3300005436 | Ga0070713_100111355 | Ga0070713_1001113552 | 565 |
| 151 | 3300005439 | Ga0070711_100001063 | Ga0070711_1000010635 | 565 |
| 152 | 3300005439 | Ga0070711_100002531 | Ga0070711_1000025318 | 565 |
| 153 | 3300005439 | Ga0070711_100084603 | Ga0070711_1000846032 | 565 |
| 154 | 3300005445 | Ga0070708_100015797 | Ga0070708_1000157974 | 565 |
| 155 | 3300005445 | Ga0070708_100074323 | Ga0070708_1000743232 | 565 |
| 156 | 3300005445 | Ga0070708_100151173 | Ga0070708_1001511732 | 565 |
| 157 | 3300005455 | Ga0070663_100007437 | Ga0070663_1000074376 | 565 |
| 158 | 3300005456 | Ga0070678_100006234 | Ga0070678_1000062344 | 565 |
| 159 | 3300005458 | Ga0070681_10002963 | Ga0070681_1000296313 | 565 |
| 160 | 3300005458 | Ga0070681_10005375 | Ga0070681_100053758 | 565 |
| 161 | 3300005459 | Ga0068867_100001846 | Ga0068867_10000184610 | 565 |
| 162 | 3300005466 | Ga0070685_10003176 | Ga0070685_100031765 | 565 |
| 163 | 3300005467 | Ga0070706_100059978 | Ga0070706_1000599783 | 565 |
| 164 | 3300005468 | Ga0070707_100125811 | Ga0070707_1001258112 | 565 |
| 165 | 3300005471 | Ga0070698_100047025 | Ga0070698_1000470252 | 565 |
| 166 | 3300005530 | Ga0070679_100003801 | Ga0070679_10000380110 | 565 |
| 167 | 3300005539 | Ga0068853_100083325 | Ga0068853_1000833252 | 565 |
| 168 | 3300005543 | Ga0070672_100000810 | Ga0070672_10000081010 | 565 |
| 169 | 3300005544 | Ga0070686_100003853 | Ga0070686_1000038533 | 565 |
| 170 | 3300005563 | Ga0068855_100001050 | Ga0068855_10000105025 | 565 |
| 171 | 3300005563 | Ga0068855_100007466 | Ga0068855_1000074667 | 565 |
| 172 | 3300005563 | Ga0068855_100031181 | Ga0068855_1000311815 | 565 |
| 173 | 3300005563 | Ga0068855_100049055 | Ga0068855_1000490552 | 565 |
| 174 | 3300005564 | Ga0070664_100000457 | Ga0070664_10000045722 | 565 |
| 175 | 3300005564 | Ga0070664_100115180 | Ga0070664_1001151801 | 565 |
| 176 | 3300005577 | Ga0068857_100002167 | Ga0068857_10000216711 | 565 |
| 177 | 3300005578 | Ga0068854_100021010 | Ga0068854_1000210103 | 565 |
| 178 | 3300005614 | Ga0068856_100000072 | Ga0068856_10000007211 | 565 |
| 179 | 3300005614 | Ga0068856_100000346 | Ga0068856_10000034639 | 565 |
| 180 | 3300005614 | Ga0068856_100003709 | Ga0068856_10000370914 | 565 |
| 181 | 3300005614 | Ga0068856_100006056 | Ga0068856_1000060567 | 565 |
| 182 | 3300005614 | Ga0068856_100014582 | Ga0068856_1000145822 | 565 |
| 183 | 3300005614 | Ga0068856_100061482 | Ga0068856_1000614822 | 565 |
| 184 | 3300005614 | Ga0068856_100176545 | Ga0068856_1001765451 | 565 |
| 185 | 3300005615 | Ga0070702_100000146 | Ga0070702_10000014614 | 565 |
| 186 | 3300005616 | Ga0068852_100149109 | Ga0068852_1001491092 | 565 |
| 187 | 3300005617 | Ga0068859_100029749 | Ga0068859_1000297493 | 565 |
| 188 | 3300005617 | Ga0068859_100109075 | Ga0068859_1001090754 | 565 |
| 189 | 3300005618 | Ga0068864_100087397 | Ga0068864_1000873972 | 565 |
| 190 | 3300005618 | Ga0068864_100094924 | Ga0068864_1000949243 | 565 |
| 191 | 3300005718 | Ga0068866_10001182 | Ga0068866_100011825 | 565 |
| 192 | 3300005719 | Ga0068861_100018868 | Ga0068861_1000188682 | 565 |
| 193 | 3300005834 | Ga0068851_10007212 | Ga0068851_100072122 | 565 |
| 194 | 3300005840 | Ga0068870_10001323 | Ga0068870_100013239 | 565 |
| 195 | 3300005841 | Ga0068863_100028831 | Ga0068863_1000288314 | 565 |
| 196 | 3300005841 | Ga0068863_100030584 | Ga0068863_1000305842 | 565 |
| 197 | 3300005841 | Ga0068863_100070880 | Ga0068863_1000708802 | 565 |
| 198 | 3300005842 | Ga0068858_100008509 | Ga0068858_1000085096 | 565 |
| 199 | 3300005842 | Ga0068858_100011944 | Ga0068858_10001194411 | 565 |
| 200 | 3300005842 | Ga0068858_100036498 | Ga0068858_1000364983 | 565 |
| 201 | 3300005842 | Ga0068858_100116252 | Ga0068858_1001162521 | 565 |
| 202 | 3300005843 | Ga0068860_100023618 | Ga0068860_1000236182 | 565 |
| 203 | 3300005844 | Ga0068862_100003922 | Ga0068862_1000039226 | 565 |
| 204 | 3300006028 | Ga0070717_10001053 | Ga0070717_1000105317 | 565 |
| 205 | 3300006028 | Ga0070717_10001280 | Ga0070717_100012808 | 565 |
| 206 | 3300006028 | Ga0070717_10006455 | Ga0070717_100064553 | 565 |
| 207 | 3300006028 | Ga0070717_10009698 | Ga0070717_100096988 | 565 |
| 208 | 3300006028 | Ga0070717_10013661 | Ga0070717_100136615 | 565 |
| 209 | 3300006028 | Ga0070717_10037695 | Ga0070717_100376951 | 565 |
| 210 | 3300006028 | Ga0070717_10083480 | Ga0070717_100834801 | 565 |
| 211 | 3300006028 | Ga0070717_10092915 | Ga0070717_100929151 | 565 |
| 212 | 3300006163 | Ga0070715_10001337 | Ga0070715_100013374 | 565 |
| 213 | 3300006173 | Ga0070716_100002526 | Ga0070716_1000025269 | 565 |
| 214 | 3300006173 | Ga0070716_100006812 | Ga0070716_1000068124 | 565 |
| 215 | 3300006175 | Ga0070712_100000100 | Ga0070712_1000001008 | 565 |
| 216 | 3300006175 | Ga0070712_100001556 | Ga0070712_10000155613 | 565 |
| 217 | 3300006175 | Ga0070712_100001951 | Ga0070712_1000019515 | 565 |
| 218 | 3300006237 | Ga0097621_100000117 | Ga0097621_10000011719 | 565 |
| 219 | 3300006237 | Ga0097621_100000329 | Ga0097621_1000003292 | 565 |
| 220 | 3300006237 | Ga0097621_100005791 | Ga0097621_1000057918 | 565 |
| 221 | 3300006237 | Ga0097621_100014299 | Ga0097621_1000142993 | 565 |
| 222 | 3300006237 | Ga0097621_100085583 | Ga0097621_1000855832 | 565 |
| 223 | 3300006358 | Ga0068871_100000971 | Ga0068871_10000097114 | 565 |
| 224 | 3300006358 | Ga0068871_100014897 | Ga0068871_1000148975 | 565 |
| 225 | 3300006871 | Ga0075434_100000564 | Ga0075434_10000056415 | 565 |
| 226 | 3300006881 | Ga0068865_100002421 | Ga0068865_1000024212 | 565 |
| 227 | 3300006881 | Ga0068865_100004633 | Ga0068865_1000046336 | 565 |
| 228 | 3300006914 | Ga0075436_100002250 | Ga0075436_1000022504 | 565 |
| 229 | 3300006914 | Ga0075436_100050586 | Ga0075436_1000505862 | 565 |
| 230 | 3300006931 | Ga0097620_100029749 | Ga0097620_1000297493 | 565 |
| 231 | 3300006931 | Ga0097620_100109078 | Ga0097620_1001090782 | 565 |
| 232 | 3300007076 | Ga0075435_100081819 | Ga0075435_1000818192 | 565 |
| 233 | 3300009093 | Ga0105240_10041000 | Ga0105240_100410006 | 565 |
| 234 | 3300009093 | Ga0105240_10062894 | Ga0105240_100628942 | 565 |
| 235 | 3300009093 | Ga0105240_10137558 | Ga0105240_101375582 | 565 |
| 236 | 3300009093 | Ga0105240_10200390 | Ga0105240_102003902 | 565 |
| 237 | 3300009098 | Ga0105245_10002835 | Ga0105245_100028357 | 565 |
| 238 | 3300009098 | Ga0105245_10023408 | Ga0105245_100234082 | 565 |
| 239 | 3300009174 | Ga0105241_10001200 | Ga0105241_1000120015 | 565 |
| 240 | 3300009176 | Ga0105242_10081172 | Ga0105242_100811722 | 565 |
| 241 | 3300009177 | Ga0105248_10009349 | Ga0105248_100093496 | 565 |
| 242 | 3300009545 | Ga0105237_10005226 | Ga0105237_1000522612 | 565 |
| 243 | 3300009545 | Ga0105237_10010821 | Ga0105237_100108219 | 565 |
| 244 | 3300009545 | Ga0105237_10014822 | Ga0105237_100148225 | 565 |
| 245 | 3300009551 | Ga0105238_10007802 | Ga0105238_100078026 | 565 |
| 246 | 3300010375 | Ga0105239_10002108 | Ga0105239_100021087 | 565 |
| 247 | 3300010375 | Ga0105239_10034893 | Ga0105239_100348935 | 565 |
| 248 | 3300013100 | Ga0157373_10001145 | Ga0157373_1000114516 | 565 |
| 249 | 3300013100 | Ga0157373_10011714 | Ga0157373_100117144 | 565 |
| 250 | 3300013102 | Ga0157371_10006441 | Ga0157371_1000644110 | 565 |
| 251 | 3300013105 | Ga0157369_10000468 | Ga0157369_1000046842 | 565 |
| 252 | 3300013105 | Ga0157369_10007147 | Ga0157369_1000714710 | 565 |
| 253 | 3300013105 | Ga0157369_10007497 | Ga0157369_100074974 | 565 |
| 254 | 3300013105 | Ga0157369_10019328 | Ga0157369_100193282 | 565 |
| 255 | 3300013105 | Ga0157369_10056407 | Ga0157369_100564072 | 565 |
| 256 | 3300013105 | Ga0157369_10075426 | Ga0157369_100754261 | 565 |
| 257 | 3300013296 | Ga0157374_10000294 | Ga0157374_1000029440 | 565 |
| 258 | 3300013296 | Ga0157374_10003048 | Ga0157374_100030485 | 565 |
| 259 | 3300013296 | Ga0157374_10009405 | Ga0157374_100094055 | 565 |
| 260 | 3300013297 | Ga0157378_10000217 | Ga0157378_1000021745 | 565 |
| 261 | 3300013297 | Ga0157378_10000250 | Ga0157378_1000025043 | 565 |
| 262 | 3300013297 | Ga0157378_10002396 | Ga0157378_1000239613 | 565 |
| 263 | 3300013297 | Ga0157378_10040910 | Ga0157378_100409103 | 565 |
| 264 | 3300013297 | Ga0157378_10053830 | Ga0157378_100538305 | 565 |
| 265 | 3300013306 | Ga0163162_10021857 | Ga0163162_100218573 | 565 |
| 266 | 3300013307 | Ga0157372_10000504 | Ga0157372_1000050419 | 565 |
| 267 | 3300013307 | Ga0157372_10000951 | Ga0157372_100009516 | 565 |
| 268 | 3300013307 | Ga0157372_10001326 | Ga0157372_100013265 | 565 |
| 269 | 3300013307 | Ga0157372_10005533 | Ga0157372_1000553311 | 565 |
| 270 | 3300013307 | Ga0157372_10026556 | Ga0157372_100265562 | 565 |
| 271 | 3300013307 | Ga0157372_10034155 | Ga0157372_100341553 | 565 |
| 272 | 3300013307 | Ga0157372_10131718 | Ga0157372_101317182 | 565 |
| 273 | 3300013308 | Ga0157375_10015850 | Ga0157375_100158505 | 565 |
| 274 | 3300013308 | Ga0157375_10135046 | Ga0157375_101350462 | 565 |
| 275 | 3300014325 | Ga0163163_10012152 | Ga0163163_100121522 | 565 |
| 276 | 3300014745 | Ga0157377_10006030 | Ga0157377_100060305 | 565 |
| 277 | 3300014968 | Ga0157379_10011316 | Ga0157379_100113162 | 565 |
| 278 | 3300014969 | Ga0157376_10019767 | Ga0157376_100197672 | 565 |
| 279 | 3300025898 | Ga0207692_10005505 | Ga0207692_100055054 | 565 |
| 280 | 3300025898 | Ga0207692_10031103 | Ga0207692_100311032 | 565 |
| 281 | 3300025905 | Ga0207685_10001246 | Ga0207685_100012463 | 565 |
| 282 | 3300025907 | Ga0207645_10000471 | Ga0207645_1000047114 | 565 |
| 283 | 3300025908 | Ga0207643_10000375 | Ga0207643_100003756 | 565 |
| 284 | 3300025910 | Ga0207684_10110009 | Ga0207684_101100092 | 565 |
| 285 | 3300025912 | Ga0207707_10003501 | Ga0207707_100035014 | 565 |
| 286 | 3300025912 | Ga0207707_10038050 | Ga0207707_100380503 | 565 |
| 287 | 3300025913 | Ga0207695_10006004 | Ga0207695_1000600411 | 565 |
| 288 | 3300025913 | Ga0207695_10043213 | Ga0207695_100432132 | 565 |
| 289 | 3300025915 | Ga0207693_10000164 | Ga0207693_100001648 | 565 |
| 290 | 3300025915 | Ga0207693_10000275 | Ga0207693_1000027510 | 565 |
| 291 | 3300025915 | Ga0207693_10011260 | Ga0207693_100112605 | 565 |
| 292 | 3300025915 | Ga0207693_10023128 | Ga0207693_100231282 | 565 |
| 293 | 3300025915 | Ga0207693_10047262 | Ga0207693_100472622 | 565 |
| 294 | 3300025916 | Ga0207663_10025097 | Ga0207663_100250973 | 565 |
| 295 | 3300025918 | Ga0207662_10002575 | Ga0207662_100025753 | 565 |
| 296 | 3300025919 | Ga0207657_10005257 | Ga0207657_100052575 | 565 |
| 297 | 3300025920 | Ga0207649_10000233 | Ga0207649_1000023323 | 565 |
| 298 | 3300025920 | Ga0207649_10051043 | Ga0207649_100510432 | 565 |
| 299 | 3300025921 | Ga0207652_10006558 | Ga0207652_100065585 | 565 |
| 300 | 3300025924 | Ga0207694_10005650 | Ga0207694_100056502 | 565 |
| 301 | 3300025925 | Ga0207650_10000107 | Ga0207650_1000010753 | 565 |
| 302 | 3300025925 | Ga0207650_10008720 | Ga0207650_100087204 | 565 |
| 303 | 3300025928 | Ga0207700_10000111 | Ga0207700_1000011125 | 565 |
| 304 | 3300025928 | Ga0207700_10032088 | Ga0207700_100320884 | 565 |
| 305 | 3300025928 | Ga0207700_10098057 | Ga0207700_100980572 | 565 |
| 306 | 3300025928 | Ga0207700_10138713 | Ga0207700_101387131 | 565 |
| 307 | 3300025929 | Ga0207664_10025215 | Ga0207664_100252153 | 565 |
| 308 | 3300025931 | Ga0207644_10004657 | Ga0207644_100046574 | 565 |
| 309 | 3300025933 | Ga0207706_10000238 | Ga0207706_1000023814 | 565 |
| 310 | 3300025937 | Ga0207669_10039321 | Ga0207669_100393212 | 565 |
| 311 | 3300025938 | Ga0207704_10014847 | Ga0207704_100148473 | 565 |
| 312 | 3300025939 | Ga0207665_10003529 | Ga0207665_100035294 | 565 |
| 313 | 3300025939 | Ga0207665_10009881 | Ga0207665_100098812 | 565 |
| 314 | 3300025939 | Ga0207665_10011970 | Ga0207665_100119707 | 565 |
| 315 | 3300025940 | Ga0207691_10000751 | Ga0207691_1000075117 | 565 |
| 316 | 3300025942 | Ga0207689_10000105 | Ga0207689_1000010553 | 565 |
| 317 | 3300025942 | Ga0207689_10003153 | Ga0207689_100031533 | 565 |
| 318 | 3300025944 | Ga0207661_10000138 | Ga0207661_1000013824 | 565 |
| 319 | 3300025944 | Ga0207661_10023158 | Ga0207661_100231585 | 565 |
| 320 | 3300025944 | Ga0207661_10149111 | Ga0207661_101491112 | 565 |
| 321 | 3300025945 | Ga0207679_10000058 | Ga0207679_1000005844 | 565 |
| 322 | 3300025945 | Ga0207679_10016880 | Ga0207679_100168802 | 565 |
| 323 | 3300025949 | Ga0207667_10004082 | Ga0207667_100040826 | 565 |
| 324 | 3300025949 | Ga0207667_10038955 | Ga0207667_100389556 | 565 |
| 325 | 3300025949 | Ga0207667_10050227 | Ga0207667_100502272 | 565 |
| 326 | 3300025981 | Ga0207640_10031274 | Ga0207640_100312742 | 565 |
| 327 | 3300026023 | Ga0207677_10001114 | Ga0207677_1000111411 | 565 |
| 328 | 3300026023 | Ga0207677_10004408 | Ga0207677_100044084 | 565 |
| 329 | 3300026023 | Ga0207677_10025030 | Ga0207677_100250302 | 565 |
| 330 | 3300026035 | Ga0207703_10002099 | Ga0207703_1000209917 | 565 |
| 331 | 3300026035 | Ga0207703_10002661 | Ga0207703_1000266113 | 565 |
| 332 | 3300026035 | Ga0207703_10042648 | Ga0207703_100426483 | 565 |
| 333 | 3300026041 | Ga0207639_10056976 | Ga0207639_100569761 | 565 |
| 334 | 3300026067 | Ga0207678_10001492 | Ga0207678_1000149219 | 565 |
| 335 | 3300026078 | Ga0207702_10000436 | Ga0207702_1000043613 | 565 |
| 336 | 3300026078 | Ga0207702_10000679 | Ga0207702_1000067922 | 565 |
| 337 | 3300026078 | Ga0207702_10012416 | Ga0207702_100124165 | 565 |
| 338 | 3300026078 | Ga0207702_10017930 | Ga0207702_100179303 | 565 |
| 339 | 3300026078 | Ga0207702_10020318 | Ga0207702_100203182 | 565 |
| 340 | 3300026078 | Ga0207702_10037829 | Ga0207702_100378293 | 565 |
| 341 | 3300026078 | Ga0207702_10128335 | Ga0207702_101283351 | 565 |
| 342 | 3300026088 | Ga0207641_10000163 | Ga0207641_1000016333 | 565 |
| 343 | 3300026088 | Ga0207641_10060386 | Ga0207641_100603863 | 565 |
| 344 | 3300026089 | Ga0207648_10000604 | Ga0207648_1000060425 | 565 |
| 345 | 3300026089 | Ga0207648_10017106 | Ga0207648_100171061 | 565 |
| 346 | 3300026095 | Ga0207676_10000142 | Ga0207676_1000014245 | 565 |
| 347 | 3300026095 | Ga0207676_10001489 | Ga0207676_100014896 | 565 |
| 348 | 3300026116 | Ga0207674_10000336 | Ga0207674_1000033639 | 565 |
| 349 | 3300026116 | Ga0207674_10028182 | Ga0207674_100281824 | 565 |
| 350 | 3300026118 | Ga0207675_100033596 | Ga0207675_1000335962 | 565 |
| 351 | 3300026121 | Ga0207683_10001600 | Ga0207683_1000160014 | 565 |
| 352 | 3300026142 | Ga0207698_10093894 | Ga0207698_100938942 | 565 |
| 353 | 3300028017 | Ga0265356_1000027 | Ga0265356_100002718 | 565 |
| 354 | 3300028380 | Ga0268265_10018167 | Ga0268265_100181673 | 565 |
| 355 | 3300028381 | Ga0268264_10003435 | Ga0268264_100034356 | 565 |
| 356 | 3300028800 | Ga0265338_10000633 | Ga0265338_1000063332 | 565 |
| 357 | 3300030760 | Ga0265762_1000402 | Ga0265762_10004026 | 565 |
| 358 | 3300030760 | Ga0265762_1000913 | Ga0265762_10009133 | 565 |
| 359 | 3300031249 | Ga0265339_10004676 | Ga0265339_100046763 | 565 |
| 360 | 3300031711 | Ga0265314_10039621 | Ga0265314_100396212 | 565 |
| 361 | 3300035113 | Ga0373936_0020305 | Ga0373936_0020305_771_2474 | 565 |
| 362 | 3300035171 | Ga0373946_0021182 | Ga0373946_0021182_216_1919 | 565 |
| 363 | 3300035692 | Ga0373935_0001647 | Ga0373935_0001647_5648_7351 | 565 |
| 364 | 3300035692 | Ga0373935_0064068 | Ga0373935_0064068_478_2181 | 565 |
| 365 | 3300035695 | Ga0373927_0020898 | Ga0373927_0020898_2289_3992 | 565 |
| 366 | 3300035724 | Ga0373933_0058870 | Ga0373933_0058870_524_2227 | 565 |
| 367 | 3300037068 | Ga0373925_0009682 | Ga0373925_0009682_3162_4865 | 565 |
| 368 | 3300037068 | Ga0373925_0012233 | Ga0373925_0012233_2163_3866 | 565 |
| 369 | 3300044694 | Ga0466963_0082063 | Ga0466963_0082063_171_1874 | 565 |
| 370 | 3300046472 | Ga0495580_0003809 | Ga0495580_0003809_9429_11132 | 565 |
| 371 | 3300046472 | Ga0495580_0004417 | Ga0495580_0004417_3495_5198 | 565 |
| 372 | 3300046472 | Ga0495580_0023451 | Ga0495580_0023451_659_2362 | 565 |
| 373 | 3300046472 | Ga0495580_0043095 | Ga0495580_0043095_345_2048 | 565 |
| 374 | 3300046473 | Ga0495582_0002058 | Ga0495582_0002058_1401_3104 | 565 |
| 375 | 3300046531 | Ga0495665_0004469 | Ga0495665_0004469_2516_4219 | 565 |
| 376 | 3300046683 | Ga0495658_0005438 | Ga0495658_0005438_4158_5861 | 565 |
| 377 | 3300046684 | Ga0495669_0008161 | Ga0495669_0008161_31_1734 | 565 |
| 378 | 3300048088 | Ga0495602_0042183 | Ga0495602_0042183_306_2009 | 565 |
| 379 | 3300048911 | Ga0496108_0000082 | Ga0496108_0000082_65102_66805 | 565 |
| 380 | 3300048912 | Ga0496109_0000148 | Ga0496109_0000148_45191_46894 | 565 |
| 381 | 3300048913 | Ga0496110_0002311 | Ga0496110_0002311_8481_10184 | 565 |
| 382 | 3300048914 | Ga0496111_0010400 | Ga0496111_0010400_3122_4825 | 565 |
| 383 | 3300048915 | Ga0496112_0000093 | Ga0496112_0000093_53628_55331 | 565 |
| 384 | 3300048915 | Ga0496112_0052940 | Ga0496112_0052940_1468_3171 | 565 |
| 385 | 3300048915 | Ga0496112_0103558 | Ga0496112_0103558_258_1961 | 565 |
| 386 | 3300048916 | Ga0496113_0003134 | Ga0496113_0003134_7516_9219 | 565 |
| 387 | 3300050512 | nmdc:mga0n895_325_c1 | nmdc:mga0n895_325_c1_13443_15155 | 565 |
| 388 | 3300050513 | nmdc:mga0rr50_87451_c1 | nmdc:mga0rr50_87451_c1_469_2181 | 565 |
| 389 | 3300050514 | nmdc:mga08x19_23657_c1 | nmdc:mga08x19_23657_c1_1340_3043 | 565 |
| 390 | 3300050514 | nmdc:mga08x19_9881_c1 | nmdc:mga08x19_9881_c1_2454_4157 | 565 |
| 391 | 3300050515 | nmdc:mga0a205_2453_c1 | nmdc:mga0a205_2453_c1_9538_11250 | 565 |
| 392 | 3300053077 | Ga0495601_0034117 | Ga0495601_0034117_371_2074 | 565 |
| 393 | 3300005329 | Ga0070683_100009054 | Ga0070683_1000090545 | 566 |
| 394 | 3300005334 | Ga0068869_100032775 | Ga0068869_1000327753 | 566 |
| 395 | 3300005335 | Ga0070666_10002725 | Ga0070666_100027255 | 566 |
| 396 | 3300005336 | Ga0070680_100053426 | Ga0070680_1000534262 | 566 |
| 397 | 3300005339 | Ga0070660_100068794 | Ga0070660_1000687941 | 566 |
| 398 | 3300005344 | Ga0070661_100005979 | Ga0070661_1000059795 | 566 |
| 399 | 3300005347 | Ga0070668_100006081 | Ga0070668_1000060817 | 566 |
| 400 | 3300005353 | Ga0070669_100022835 | Ga0070669_1000228353 | 566 |
| 401 | 3300005366 | Ga0070659_100011058 | Ga0070659_1000110584 | 566 |
| 402 | 3300005367 | Ga0070667_100005223 | Ga0070667_1000052236 | 566 |
| 403 | 3300005434 | Ga0070709_10031441 | Ga0070709_100314412 | 566 |
| 404 | 3300005435 | Ga0070714_100029396 | Ga0070714_1000293963 | 566 |
| 405 | 3300005436 | Ga0070713_100036781 | Ga0070713_1000367812 | 566 |
| 406 | 3300005436 | Ga0070713_100058279 | Ga0070713_1000582791 | 566 |
| 407 | 3300005437 | Ga0070710_10035394 | Ga0070710_100353943 | 566 |
| 408 | 3300005439 | Ga0070711_100000814 | Ga0070711_1000008142 | 566 |
| 409 | 3300005444 | Ga0070694_100047874 | Ga0070694_1000478742 | 566 |
| 410 | 3300005445 | Ga0070708_100001014 | Ga0070708_10000101410 | 566 |
| 411 | 3300005445 | Ga0070708_100004228 | Ga0070708_1000042286 | 566 |
| 412 | 3300005445 | Ga0070708_100013577 | Ga0070708_1000135775 | 566 |
| 413 | 3300005455 | Ga0070663_100003084 | Ga0070663_1000030845 | 566 |
| 414 | 3300005457 | Ga0070662_100001005 | Ga0070662_10000100510 | 566 |
| 415 | 3300005459 | Ga0068867_100028245 | Ga0068867_1000282451 | 566 |
| 416 | 3300005467 | Ga0070706_100000980 | Ga0070706_10000098027 | 566 |
| 417 | 3300005468 | Ga0070707_100000915 | Ga0070707_1000009153 | 566 |
| 418 | 3300005471 | Ga0070698_100000140 | Ga0070698_10000014043 | 566 |
| 419 | 3300005518 | Ga0070699_100006913 | Ga0070699_1000069136 | 566 |
| 420 | 3300005535 | Ga0070684_100011109 | Ga0070684_1000111095 | 566 |
| 421 | 3300005536 | Ga0070697_100000015 | Ga0070697_100000015114 | 566 |
| 422 | 3300005536 | Ga0070697_100001215 | Ga0070697_1000012157 | 566 |
| 423 | 3300005536 | Ga0070697_100012341 | Ga0070697_1000123417 | 566 |
| 424 | 3300005545 | Ga0070695_100095390 | Ga0070695_1000953902 | 566 |
| 425 | 3300005546 | Ga0070696_100064741 | Ga0070696_1000647412 | 566 |
| 426 | 3300005547 | Ga0070693_100053715 | Ga0070693_1000537152 | 566 |
| 427 | 3300005548 | Ga0070665_100010236 | Ga0070665_1000102365 | 566 |
| 428 | 3300005564 | Ga0070664_100010450 | Ga0070664_1000104505 | 566 |
| 429 | 3300005577 | Ga0068857_100112505 | Ga0068857_1001125052 | 566 |
| 430 | 3300005614 | Ga0068856_100008986 | Ga0068856_1000089863 | 566 |
| 431 | 3300005614 | Ga0068856_100075097 | Ga0068856_1000750973 | 566 |
| 432 | 3300005616 | Ga0068852_100031868 | Ga0068852_1000318683 | 566 |
| 433 | 3300005617 | Ga0068859_100006285 | Ga0068859_1000062854 | 566 |
| 434 | 3300005618 | Ga0068864_100033090 | Ga0068864_1000330901 | 566 |
| 435 | 3300005618 | Ga0068864_100109283 | Ga0068864_1001092832 | 566 |
| 436 | 3300005719 | Ga0068861_100057885 | Ga0068861_1000578852 | 566 |
| 437 | 3300005834 | Ga0068851_10003049 | Ga0068851_100030495 | 566 |
| 438 | 3300005841 | Ga0068863_100011177 | Ga0068863_1000111776 | 566 |
| 439 | 3300005841 | Ga0068863_100167871 | Ga0068863_1001678712 | 566 |
| 440 | 3300005842 | Ga0068858_100025578 | Ga0068858_1000255783 | 566 |
| 441 | 3300005844 | Ga0068862_100036976 | Ga0068862_1000369762 | 566 |
| 442 | 3300006028 | Ga0070717_10004636 | Ga0070717_100046364 | 566 |
| 443 | 3300006163 | Ga0070715_10003622 | Ga0070715_100036222 | 566 |
| 444 | 3300006163 | Ga0070715_10007950 | Ga0070715_100079503 | 566 |
| 445 | 3300006173 | Ga0070716_100000114 | Ga0070716_1000001143 | 566 |
| 446 | 3300006173 | Ga0070716_100006521 | Ga0070716_1000065213 | 566 |
| 447 | 3300006175 | Ga0070712_100000389 | Ga0070712_10000038916 | 566 |
| 448 | 3300006175 | Ga0070712_100001533 | Ga0070712_1000015334 | 566 |
| 449 | 3300006237 | Ga0097621_100007474 | Ga0097621_1000074747 | 566 |
| 450 | 3300006237 | Ga0097621_100022905 | Ga0097621_1000229053 | 566 |
| 451 | 3300006237 | Ga0097621_100043365 | Ga0097621_1000433653 | 566 |
| 452 | 3300006358 | Ga0068871_100102961 | Ga0068871_1001029612 | 566 |
| 453 | 3300006852 | Ga0075433_10000213 | Ga0075433_1000021328 | 566 |
| 454 | 3300006871 | Ga0075434_100000122 | Ga0075434_10000012220 | 566 |
| 455 | 3300006871 | Ga0075434_100015193 | Ga0075434_1000151934 | 566 |
| 456 | 3300006881 | Ga0068865_100005168 | Ga0068865_1000051684 | 566 |
| 457 | 3300006914 | Ga0075436_100014222 | Ga0075436_1000142224 | 566 |
| 458 | 3300006931 | Ga0097620_100006285 | Ga0097620_1000062857 | 566 |
| 459 | 3300007076 | Ga0075435_100000038 | Ga0075435_10000003819 | 566 |
| 460 | 3300007265 | Ga0099794_10023702 | Ga0099794_100237022 | 566 |
| 461 | 3300009093 | Ga0105240_10016695 | Ga0105240_100166955 | 566 |
| 462 | 3300009098 | Ga0105245_10157031 | Ga0105245_101570312 | 566 |
| 463 | 3300009101 | Ga0105247_10003343 | Ga0105247_100033434 | 566 |
| 464 | 3300009147 | Ga0114129_10094507 | Ga0114129_100945073 | 566 |
| 465 | 3300009148 | Ga0105243_10056060 | Ga0105243_100560603 | 566 |
| 466 | 3300009174 | Ga0105241_10018950 | Ga0105241_100189503 | 566 |
| 467 | 3300009545 | Ga0105237_10155290 | Ga0105237_101552902 | 566 |
| 468 | 3300009551 | Ga0105238_10007714 | Ga0105238_100077147 | 566 |
| 469 | 3300009553 | Ga0105249_10026101 | Ga0105249_100261012 | 566 |
| 470 | 3300010375 | Ga0105239_10206745 | Ga0105239_102067452 | 566 |
| 471 | 3300013100 | Ga0157373_10039559 | Ga0157373_100395592 | 566 |
| 472 | 3300013102 | Ga0157371_10031814 | Ga0157371_100318143 | 566 |
| 473 | 3300013105 | Ga0157369_10028070 | Ga0157369_100280702 | 566 |
| 474 | 3300013296 | Ga0157374_10003917 | Ga0157374_100039177 | 566 |
| 475 | 3300013296 | Ga0157374_10015000 | Ga0157374_100150005 | 566 |
| 476 | 3300013297 | Ga0157378_10028879 | Ga0157378_100288793 | 566 |
| 477 | 3300013297 | Ga0157378_10031278 | Ga0157378_100312782 | 566 |
| 478 | 3300013306 | Ga0163162_10005493 | Ga0163162_100054937 | 566 |
| 479 | 3300013307 | Ga0157372_10143191 | Ga0157372_101431912 | 566 |
| 480 | 3300014497 | Ga0182008_10004291 | Ga0182008_100042913 | 566 |
| 481 | 3300014969 | Ga0157376_10051629 | Ga0157376_100516293 | 566 |
| 482 | 3300014969 | Ga0157376_10057382 | Ga0157376_100573822 | 566 |
| 483 | 3300025907 | Ga0207645_10003288 | Ga0207645_100032883 | 566 |
| 484 | 3300025909 | Ga0207705_10044818 | Ga0207705_100448182 | 566 |
| 485 | 3300025910 | Ga0207684_10001117 | Ga0207684_1000111715 | 566 |
| 486 | 3300025910 | Ga0207684_10007311 | Ga0207684_100073117 | 566 |
| 487 | 3300025914 | Ga0207671_10010795 | Ga0207671_100107953 | 566 |
| 488 | 3300025915 | Ga0207693_10000034 | Ga0207693_1000003450 | 566 |
| 489 | 3300025915 | Ga0207693_10003136 | Ga0207693_100031366 | 566 |
| 490 | 3300025916 | Ga0207663_10075238 | Ga0207663_100752382 | 566 |
| 491 | 3300025917 | Ga0207660_10018437 | Ga0207660_100184373 | 566 |
| 492 | 3300025919 | Ga0207657_10000254 | Ga0207657_100002543 | 566 |
| 493 | 3300025919 | Ga0207657_10002735 | Ga0207657_1000273515 | 566 |
| 494 | 3300025920 | Ga0207649_10018077 | Ga0207649_100180773 | 566 |
| 495 | 3300025920 | Ga0207649_10096657 | Ga0207649_100966571 | 566 |
| 496 | 3300025922 | Ga0207646_10000471 | Ga0207646_1000047117 | 566 |
| 497 | 3300025923 | Ga0207681_10053553 | Ga0207681_100535532 | 566 |
| 498 | 3300025927 | Ga0207687_10004264 | Ga0207687_100042644 | 566 |
| 499 | 3300025933 | Ga0207706_10003488 | Ga0207706_100034888 | 566 |
| 500 | 3300025933 | Ga0207706_10033194 | Ga0207706_100331943 | 566 |
| 501 | 3300025938 | Ga0207704_10006270 | Ga0207704_100062704 | 566 |
| 502 | 3300025939 | Ga0207665_10000040 | Ga0207665_1000004042 | 566 |
| 503 | 3300025939 | Ga0207665_10006116 | Ga0207665_100061165 | 566 |
| 504 | 3300025939 | Ga0207665_10019746 | Ga0207665_100197462 | 566 |
| 505 | 3300025941 | Ga0207711_10000708 | Ga0207711_100007084 | 566 |
| 506 | 3300025942 | Ga0207689_10024883 | Ga0207689_100248835 | 566 |
| 507 | 3300025949 | Ga0207667_10005768 | Ga0207667_100057687 | 566 |
| 508 | 3300025961 | Ga0207712_10006914 | Ga0207712_100069142 | 566 |
| 509 | 3300025972 | Ga0207668_10003703 | Ga0207668_100037034 | 566 |
| 510 | 3300025981 | Ga0207640_10013067 | Ga0207640_100130672 | 566 |
| 511 | 3300025986 | Ga0207658_10034607 | Ga0207658_100346072 | 566 |
| 512 | 3300026023 | Ga0207677_10018639 | Ga0207677_100186393 | 566 |
| 513 | 3300026035 | Ga0207703_10129058 | Ga0207703_101290582 | 566 |
| 514 | 3300026067 | Ga0207678_10000256 | Ga0207678_100002568 | 566 |
| 515 | 3300026088 | Ga0207641_10066043 | Ga0207641_100660432 | 566 |
| 516 | 3300026089 | Ga0207648_10006028 | Ga0207648_100060287 | 566 |
| 517 | 3300026118 | Ga0207675_100082153 | Ga0207675_1000821532 | 566 |
| 518 | 3300026121 | Ga0207683_10006753 | Ga0207683_100067537 | 566 |
| 519 | 3300026142 | Ga0207698_10010630 | Ga0207698_100106304 | 566 |
| 520 | 3300028379 | Ga0268266_10022928 | Ga0268266_100229284 | 566 |
| 521 | 3300035112 | Ga0373932_0004078 | Ga0373932_0004078_816_2522 | 566 |
| 522 | 3300035121 | Ga0373960_0009799 | Ga0373960_0009799_484_2190 | 566 |
| 523 | 3300037068 | Ga0373925_0061770 | Ga0373925_0061770_463_2169 | 566 |
| 524 | 3300046472 | Ga0495580_0013349 | Ga0495580_0013349_4473_6179 | 566 |
| 525 | 3300048903 | Ga0496100_0000958 | Ga0496100_0000958_7348_9054 | 566 |
| 526 | 3300048904 | Ga0496101_0019396 | Ga0496101_0019396_1785_3491 | 566 |
| 527 | 3300048905 | Ga0496102_0001575 | Ga0496102_0001575_6083_7789 | 566 |
| 528 | 3300048906 | Ga0496103_0013534 | Ga0496103_0013534_2166_3872 | 566 |
| 529 | 3300048907 | Ga0496104_0028148 | Ga0496104_0028148_1893_3599 | 566 |
| 530 | 3300048907 | Ga0496104_0139053 | Ga0496104_0139053_371_2077 | 566 |
| 531 | 3300048907 | Ga0496104_0147163 | Ga0496104_0147163_465_2171 | 566 |
| 532 | 3300048909 | Ga0496106_0031226 | Ga0496106_0031226_122_1828 | 566 |
| 533 | 3300048909 | Ga0496106_0045641 | Ga0496106_0045641_1568_3274 | 566 |
| 534 | 3300048913 | Ga0496110_0029670 | Ga0496110_0029670_2207_3913 | 566 |
| 535 | 3300048914 | Ga0496111_0040939 | Ga0496111_0040939_1412_3118 | 566 |
| 536 | 3300048916 | Ga0496113_0016718 | Ga0496113_0016718_1806_3512 | 566 |
| 537 | 3300048917 | Ga0496114_0015725 | Ga0496114_0015725_2676_4382 | 566 |
| 538 | 3300048929 | Ga0496126_0001121 | Ga0496126_0001121_37430_39136 | 566 |
| 539 | 3300050507 | nmdc:mga05p37_78294_c1 | nmdc:mga05p37_78294_c1_59_1768 | 566 |
| 540 | 3300050512 | nmdc:mga0n895_102_c1 | nmdc:mga0n895_102_c1_33137_34843 | 566 |
| 541 | 3300050512 | nmdc:mga0n895_30546_c1 | nmdc:mga0n895_30546_c1_421_2130 | 566 |
| 542 | 3300050513 | nmdc:mga0rr50_110_c1 | nmdc:mga0rr50_110_c1_983_2689 | 566 |
| 543 | 3300050514 | nmdc:mga08x19_27595_c1 | nmdc:mga08x19_27595_c1_1356_3062 | 566 |
| 544 | 3300050515 | nmdc:mga0a205_131_c1 | nmdc:mga0a205_131_c1_43999_45705 | 566 |
| 545 | 3300005445 | Ga0070708_100015179 | Ga0070708_1000151795 | 567 |
| 546 | 3300005467 | Ga0070706_100050660 | Ga0070706_1000506602 | 567 |
| 547 | 3300005536 | Ga0070697_100067374 | Ga0070697_1000673742 | 567 |
| 548 | 3300025922 | Ga0207646_10032934 | Ga0207646_100329343 | 567 |
| 549 | 3300031344 | Ga0265316_10026823 | Ga0265316_100268232 | 573 |
| 550 | 3300005329 | Ga0070683_100001098 | Ga0070683_10000109815 | 574 |
| 551 | 3300005329 | Ga0070683_100013474 | Ga0070683_1000134744 | 574 |
| 552 | 3300005329 | Ga0070683_100068690 | Ga0070683_1000686902 | 574 |
| 553 | 3300005331 | Ga0070670_100005903 | Ga0070670_1000059034 | 574 |
| 554 | 3300005334 | Ga0068869_100011746 | Ga0068869_1000117464 | 574 |
| 555 | 3300005334 | Ga0068869_100015327 | Ga0068869_1000153274 | 574 |
| 556 | 3300005336 | Ga0070680_100044939 | Ga0070680_1000449393 | 574 |
| 557 | 3300005338 | Ga0068868_100005053 | Ga0068868_1000050536 | 574 |
| 558 | 3300005457 | Ga0070662_100007919 | Ga0070662_1000079192 | 574 |
| 559 | 3300005530 | Ga0070679_100069245 | Ga0070679_1000692452 | 574 |
| 560 | 3300005535 | Ga0070684_100002526 | Ga0070684_1000025264 | 574 |
| 561 | 3300005535 | Ga0070684_100004956 | Ga0070684_1000049566 | 574 |
| 562 | 3300005535 | Ga0070684_100033759 | Ga0070684_1000337592 | 574 |
| 563 | 3300005535 | Ga0070684_100053708 | Ga0070684_1000537082 | 574 |
| 564 | 3300005535 | Ga0070684_100101805 | Ga0070684_1001018053 | 574 |
| 565 | 3300005539 | Ga0068853_100000179 | Ga0068853_1000001799 | 574 |
| 566 | 3300005539 | Ga0068853_100100201 | Ga0068853_1001002011 | 574 |
| 567 | 3300005563 | Ga0068855_100002077 | Ga0068855_1000020773 | 574 |
| 568 | 3300005563 | Ga0068855_100002180 | Ga0068855_10000218014 | 574 |
| 569 | 3300005563 | Ga0068855_100003268 | Ga0068855_10000326818 | 574 |
| 570 | 3300005563 | Ga0068855_100066847 | Ga0068855_1000668472 | 574 |
| 571 | 3300005577 | Ga0068857_100018225 | Ga0068857_1000182252 | 574 |
| 572 | 3300005614 | Ga0068856_100007392 | Ga0068856_1000073927 | 574 |
| 573 | 3300005614 | Ga0068856_100009251 | Ga0068856_1000092516 | 574 |
| 574 | 3300005614 | Ga0068856_100034026 | Ga0068856_1000340263 | 574 |
| 575 | 3300005614 | Ga0068856_100036579 | Ga0068856_1000365792 | 574 |
| 576 | 3300005614 | Ga0068856_100038592 | Ga0068856_1000385922 | 574 |
| 577 | 3300005616 | Ga0068852_100000009 | Ga0068852_10000000981 | 574 |
| 578 | 3300005616 | Ga0068852_100000406 | Ga0068852_1000004067 | 574 |
| 579 | 3300005616 | Ga0068852_100052101 | Ga0068852_1000521014 | 574 |
| 580 | 3300005618 | Ga0068864_100023233 | Ga0068864_1000232332 | 574 |
| 581 | 3300005841 | Ga0068863_100012533 | Ga0068863_1000125334 | 574 |
| 582 | 3300005843 | Ga0068860_100005600 | Ga0068860_1000056008 | 574 |
| 583 | 3300006028 | Ga0070717_10001842 | Ga0070717_1000184211 | 574 |
| 584 | 3300006237 | Ga0097621_100025801 | Ga0097621_1000258013 | 574 |
| 585 | 3300006358 | Ga0068871_100082202 | Ga0068871_1000822022 | 574 |
| 586 | 3300006358 | Ga0068871_100096975 | Ga0068871_1000969751 | 574 |
| 587 | 3300009093 | Ga0105240_10000148 | Ga0105240_1000014885 | 574 |
| 588 | 3300009093 | Ga0105240_10002085 | Ga0105240_1000208518 | 574 |
| 589 | 3300009093 | Ga0105240_10003334 | Ga0105240_1000333414 | 574 |
| 590 | 3300009093 | Ga0105240_10003778 | Ga0105240_1000377813 | 574 |
| 591 | 3300009093 | Ga0105240_10086421 | Ga0105240_100864214 | 574 |
| 592 | 3300009098 | Ga0105245_10034473 | Ga0105245_100344732 | 574 |
| 593 | 3300009098 | Ga0105245_10076732 | Ga0105245_100767322 | 574 |
| 594 | 3300009174 | Ga0105241_10000034 | Ga0105241_1000003463 | 574 |
| 595 | 3300009174 | Ga0105241_10000157 | Ga0105241_1000015723 | 574 |
| 596 | 3300009174 | Ga0105241_10007492 | Ga0105241_100074923 | 574 |
| 597 | 3300009174 | Ga0105241_10028405 | Ga0105241_100284054 | 574 |
| 598 | 3300009177 | Ga0105248_10010236 | Ga0105248_100102365 | 574 |
| 599 | 3300009177 | Ga0105248_10129135 | Ga0105248_101291353 | 574 |
| 600 | 3300009545 | Ga0105237_10001511 | Ga0105237_1000151112 | 574 |
| 601 | 3300009545 | Ga0105237_10081703 | Ga0105237_100817032 | 574 |
| 602 | 3300009551 | Ga0105238_10000121 | Ga0105238_1000012116 | 574 |
| 603 | 3300009551 | Ga0105238_10018538 | Ga0105238_100185386 | 574 |
| 604 | 3300009551 | Ga0105238_10048974 | Ga0105238_100489744 | 574 |
| 605 | 3300009551 | Ga0105238_10112641 | Ga0105238_101126412 | 574 |
| 606 | 3300010375 | Ga0105239_10007899 | Ga0105239_100078993 | 574 |
| 607 | 3300010375 | Ga0105239_10013560 | Ga0105239_100135606 | 574 |
| 608 | 3300010375 | Ga0105239_10032944 | Ga0105239_100329443 | 574 |
| 609 | 3300011119 | Ga0105246_10007094 | Ga0105246_100070946 | 574 |
| 610 | 3300011119 | Ga0105246_10041358 | Ga0105246_100413583 | 574 |
| 611 | 3300013104 | Ga0157370_10000059 | Ga0157370_1000005964 | 574 |
| 612 | 3300013105 | Ga0157369_10000035 | Ga0157369_1000003589 | 574 |
| 613 | 3300013105 | Ga0157369_10000617 | Ga0157369_1000061716 | 574 |
| 614 | 3300013105 | Ga0157369_10001957 | Ga0157369_1000195710 | 574 |
| 615 | 3300013105 | Ga0157369_10007485 | Ga0157369_1000748511 | 574 |
| 616 | 3300013105 | Ga0157369_10018975 | Ga0157369_100189753 | 574 |
| 617 | 3300013296 | Ga0157374_10075570 | Ga0157374_100755703 | 574 |
| 618 | 3300013297 | Ga0157378_10069112 | Ga0157378_100691122 | 574 |
| 619 | 3300013307 | Ga0157372_10000049 | Ga0157372_1000004983 | 574 |
| 620 | 3300013307 | Ga0157372_10001767 | Ga0157372_1000176712 | 574 |
| 621 | 3300013307 | Ga0157372_10002380 | Ga0157372_100023805 | 574 |
| 622 | 3300013307 | Ga0157372_10085623 | Ga0157372_100856232 | 574 |
| 623 | 3300013308 | Ga0157375_10022219 | Ga0157375_100222194 | 574 |
| 624 | 3300013308 | Ga0157375_10117734 | Ga0157375_101177342 | 574 |
| 625 | 3300014969 | Ga0157376_10007328 | Ga0157376_100073283 | 574 |
| 626 | 3300014969 | Ga0157376_10063234 | Ga0157376_100632342 | 574 |
| 627 | 3300017792 | Ga0163161_10014818 | Ga0163161_100148182 | 574 |
| 628 | 3300025315 | Ga0207697_10015086 | Ga0207697_100150861 | 574 |
| 629 | 3300025904 | Ga0207647_10016743 | Ga0207647_100167434 | 574 |
| 630 | 3300025909 | Ga0207705_10057727 | Ga0207705_100577272 | 574 |
| 631 | 3300025911 | Ga0207654_10000029 | Ga0207654_1000002981 | 574 |
| 632 | 3300025911 | Ga0207654_10000097 | Ga0207654_1000009723 | 574 |
| 633 | 3300025911 | Ga0207654_10013372 | Ga0207654_100133723 | 574 |
| 634 | 3300025913 | Ga0207695_10000096 | Ga0207695_10000096204 | 574 |
| 635 | 3300025913 | Ga0207695_10000105 | Ga0207695_10000105110 | 574 |
| 636 | 3300025913 | Ga0207695_10000461 | Ga0207695_1000046119 | 574 |
| 637 | 3300025913 | Ga0207695_10023604 | Ga0207695_100236043 | 574 |
| 638 | 3300025913 | Ga0207695_10035449 | Ga0207695_100354494 | 574 |
| 639 | 3300025913 | Ga0207695_10069900 | Ga0207695_100699004 | 574 |
| 640 | 3300025914 | Ga0207671_10000390 | Ga0207671_1000039024 | 574 |
| 641 | 3300025914 | Ga0207671_10001421 | Ga0207671_1000142116 | 574 |
| 642 | 3300025914 | Ga0207671_10061085 | Ga0207671_100610852 | 574 |
| 643 | 3300025917 | Ga0207660_10030633 | Ga0207660_100306333 | 574 |
| 644 | 3300025920 | Ga0207649_10016237 | Ga0207649_100162371 | 574 |
| 645 | 3300025920 | Ga0207649_10052436 | Ga0207649_100524362 | 574 |
| 646 | 3300025924 | Ga0207694_10000104 | Ga0207694_1000010423 | 574 |
| 647 | 3300025925 | Ga0207650_10030113 | Ga0207650_100301132 | 574 |
| 648 | 3300025933 | Ga0207706_10005861 | Ga0207706_100058613 | 574 |
| 649 | 3300025940 | Ga0207691_10081386 | Ga0207691_100813862 | 574 |
| 650 | 3300025941 | Ga0207711_10072624 | Ga0207711_100726242 | 574 |
| 651 | 3300025942 | Ga0207689_10000713 | Ga0207689_100007134 | 574 |
| 652 | 3300025942 | Ga0207689_10047852 | Ga0207689_100478522 | 574 |
| 653 | 3300025944 | Ga0207661_10014752 | Ga0207661_100147526 | 574 |
| 654 | 3300025944 | Ga0207661_10049937 | Ga0207661_100499372 | 574 |
| 655 | 3300025949 | Ga0207667_10001323 | Ga0207667_1000132328 | 574 |
| 656 | 3300025949 | Ga0207667_10005835 | Ga0207667_100058358 | 574 |
| 657 | 3300025949 | Ga0207667_10028895 | Ga0207667_100288952 | 574 |
| 658 | 3300025949 | Ga0207667_10031572 | Ga0207667_100315722 | 574 |
| 659 | 3300026023 | Ga0207677_10003786 | Ga0207677_100037866 | 574 |
| 660 | 3300026035 | Ga0207703_10097565 | Ga0207703_100975652 | 574 |
| 661 | 3300026041 | Ga0207639_10000147 | Ga0207639_1000014715 | 574 |
| 662 | 3300026041 | Ga0207639_10042714 | Ga0207639_100427142 | 574 |
| 663 | 3300026078 | Ga0207702_10000860 | Ga0207702_1000086011 | 574 |
| 664 | 3300026078 | Ga0207702_10025887 | Ga0207702_100258872 | 574 |
| 665 | 3300026088 | Ga0207641_10013835 | Ga0207641_100138356 | 574 |
| 666 | 3300026095 | Ga0207676_10027492 | Ga0207676_100274924 | 574 |
| 667 | 3300026095 | Ga0207676_10091999 | Ga0207676_100919992 | 574 |
| 668 | 3300026116 | Ga0207674_10006617 | Ga0207674_100066176 | 574 |
| 669 | 3300026116 | Ga0207674_10013044 | Ga0207674_100130444 | 574 |
| 670 | 3300026116 | Ga0207674_10074895 | Ga0207674_100748952 | 574 |
| 671 | 3300026121 | Ga0207683_10000078 | Ga0207683_1000007821 | 574 |
| 672 | 3300026142 | Ga0207698_10000020 | Ga0207698_1000002076 | 574 |
| 673 | 3300026142 | Ga0207698_10000316 | Ga0207698_1000031616 | 574 |
| 674 | 3300028379 | Ga0268266_10049729 | Ga0268266_100497292 | 574 |
| 675 | 3300028381 | Ga0268264_10005525 | Ga0268264_100055253 | 574 |
| 676 | 3300044694 | Ga0466963_0005652 | Ga0466963_0005652_3703_5427 | 574 |
| 677 | 3300045976 | Ga0466967_0018480 | Ga0466967_0018480_2318_4042 | 574 |
| 678 | 3300046472 | Ga0495580_0083390 | Ga0495580_0083390_283_2025 | 574 |
| 679 | 3300048088 | Ga0495602_0104809 | Ga0495602_0104809_34_1776 | 574 |
| 680 | 3300048918 | Ga0496115_0007549 | Ga0496115_0007549_4026_5768 | 574 |
| 681 | 3300009093 | Ga0105240_10039166 | Ga0105240_100391664 | 586 |
| 682 | 3300013100 | Ga0157373_10107230 | Ga0157373_101072302 | 587 |
| 683 | 3300013105 | Ga0157369_10100117 | Ga0157369_101001172 | 587 |
| 684 | 3300005344 | Ga0070661_100068299 | Ga0070661_1000682992 | 594 |
| 685 | 3300025913 | Ga0207695_10015608 | Ga0207695_100156087 | 594 |
| 686 | 3300025920 | Ga0207649_10028858 | Ga0207649_100288583 | 594 |
| 687 | 3300005327 | Ga0070658_10063868 | Ga0070658_100638682 | 595 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i8t-assembly1.cif.gz_B | structure of udp-galactopyranose mutase from e.coli | 0.9885 | 31 | 63 |
| 6gnd-assembly1.cif.gz_G | crystal structure of the complex of a ferredoxin-flavin thioredoxin reductase and a thioredoxin from clostridium acetobutylicum at 2.9 a resolution | 0.9784 | 30 | 60 |
| 3f8d-assembly2.cif.gz_D | structure of sulfolobus solfataricus thioredoxin reductase mutant c147a | 0.9712 | 32 | 60 |
| 3f8r-assembly2.cif.gz_D | crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules | 0.9677 | 32 | 60 |
| 6gnd-assembly2.cif.gz_E-2 | crystal structure of the complex of a ferredoxin-flavin thioredoxin reductase and a thioredoxin from clostridium acetobutylicum at 2.9 a resolution | 0.9663 | 30 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K8F7V7_1826_1944_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9872 | 34 | 63 | 3.50.50.60 |
| 2x3nA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9831 | 30 | 63 | 3.50.50.60 |
| af_I6XF25_1_136_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9811 | 33 | 62 | 3.40.50.720 |
| 4zn0A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9788 | 31 | 61 | 3.50.50.60 |
| af_M9NFH8_1768_1873_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9786 | 33 | 63 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3D6R3-F1-model_v4 | GMC family oxidoreductase | 0.9464 | 136 | 471 |
GO:0016614
GO:0050660 |
| AF-A0A2V9XAK7-F1-model_v4 | GMC family oxidoreductase | 0.9438 | 208 | 363 |
GO:0016614
GO:0050660 |
| AF-A0A2V7EGS5-F1-model_v4 | GMC family oxidoreductase | 0.939 | 148 | 302 |
GO:0016614
GO:0050660 |
| AF-A0A2V9GLD4-F1-model_v4 | Glucose-methanol-choline oxidoreductase N-terminal domain-containing protein | 0.9383 | 30 | 352 |
GO:0016614
GO:0050660 |
| AF-A0A1Q7ZHG1-F1-model_v4 | GMC family oxidoreductase | 0.9357 | 98 | 527 |
GO:0016614
GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar