F475240

General Info

Members Datasets Scaffolds Average Seq Length
687 237 687 568

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100011851|Ga0070699_1000118515
Length 568
Sequence MTEPRAPSPQSRVYDVCIVGSGAGGGMAAHALTRAGADVIVLEAGVPWDNLKDSAMLTWPYESPRRGRSTKDHPFGEFDGCIGGWEIEGEPYTRAPGTEFNWWRARMVGGRTNHWGRISLRFGPYDFKRKSRDGLGDDWPISYEEVAAFYDKIDRLIGVFGSKESLPNEPDGVFLPPPRPRCHELLVKQAADRLHITCIPSRLSILTRPLNGRAPCHYCGQCNRGCRVNANFTSTNVLIGPALTTGRLTLVTNAMAREVTVDKAGRASGVAYVDKTTGSDQHVRARVVVLAASALETARLLLNSKSSAFPSGLANGSGTVGKYITDTTGTDVGGFIPKMMDHVPHNHDGVGGMHLYMPWWLEDQKLDFPRGYHIEVWGGTQVPSYGFGGGIQRYPSGGGYGKQLKDDYRRYYGATVGFSGRGEMIPNDDTYCEIDPRTVDRWGIPVLRFHWKWSDHEYKQVKHMQETFRALIEAMGGEVFSPMPGPERGYGIAAGGVIIHELGGARMGDDPKTSVTNRWCQAHECKNLFLADGAPFVSQADKNPTWTILALSLRTSEHIADLMKRGEL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
171 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.51
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10063868 3300005327 Bacteria 3002
2 Ga0070676_10027734 3300005328 Bacteria 3213
3 Ga0070683_100000496 3300005329 Bacteria 27786
4 Ga0070683_100001098 3300005329 Bacteria 20381
5 Ga0070683_100009054 3300005329 Bacteria 8497
6 Ga0070683_100013474 3300005329 Bacteria 7132
7 Ga0070683_100068690 3300005329 Bacteria 3302
8 Ga0070690_100009920 3300005330 Bacteria 5526
9 Ga0070670_100005903 3300005331 Bacteria 10351
10 Ga0070670_100010229 3300005331 Bacteria 8006
11 Ga0068869_100003211 3300005334 Bacteria 9993
12 Ga0068869_100011746 3300005334 Bacteria 5757
13 Ga0068869_100015327 3300005334 Bacteria 5138
14 Ga0068869_100032775 3300005334 Bacteria 3663
15 Ga0068869_100086524 3300005334 Bacteria 2349
16 Ga0070666_10002725 3300005335 Bacteria 10673
17 Ga0070680_100044939 3300005336 Bacteria 3590
18 Ga0070680_100053426 3300005336 Unclassified 3298
19 Ga0068868_100003471 3300005338 Bacteria 10979
20 Ga0068868_100005053 3300005338 Bacteria 9261
21 Ga0068868_100008104 3300005338 Bacteria 7514
22 Ga0068868_100044042 3300005338 Unclassified 3488
23 Ga0070660_100009323 3300005339 Bacteria 6897
24 Ga0070660_100068794 3300005339 Bacteria 2760
25 Ga0070689_100000550 3300005340 Bacteria 22415
26 Ga0070691_10036812 3300005341 Bacteria 2307
27 Ga0070687_100006094 3300005343 Bacteria 4922
28 Ga0070661_100002953 3300005344 Bacteria 11732
29 Ga0070661_100005979 3300005344 Bacteria 8378
30 Ga0070661_100006808 3300005344 Bacteria 7881
31 Ga0070661_100009772 3300005344 Bacteria 6654
32 Ga0070661_100068299 3300005344 Unclassified 2612
33 Ga0070668_100006081 3300005347 Bacteria 8952
34 Ga0070668_100012100 3300005347 Bacteria 6426
35 Ga0070669_100012871 3300005353 Bacteria 5942
36 Ga0070669_100022835 3300005353 Bacteria 4475
37 Ga0070675_100009201 3300005354 Bacteria 7673
38 Ga0070671_100045357 3300005355 Bacteria 3654
39 Ga0070671_100089295 3300005355 Bacteria 2580
40 Ga0070674_100003574 3300005356 Bacteria 8740
41 Ga0070673_100084581 3300005364 Bacteria 2580
42 Ga0070688_100000197 3300005365 Bacteria 32010
43 Ga0070659_100006718 3300005366 Bacteria 8316
44 Ga0070659_100011058 3300005366 Bacteria 6666
45 Ga0070667_100005223 3300005367 Bacteria 10853
46 Ga0070709_10000899 3300005434 Bacteria 16569
47 Ga0070709_10031441 3300005434 Unclassified 3192
48 Ga0070714_100001358 3300005435 Bacteria 17707
49 Ga0070714_100006555 3300005435 Bacteria 9004
50 Ga0070714_100029396 3300005435 Bacteria 4569
51 Ga0070714_100042616 3300005435 Unclassified 3835
52 Ga0070714_100051489 3300005435 Bacteria 3510
53 Ga0070713_100000134 3300005436 Bacteria 48639
54 Ga0070713_100001365 3300005436 Bacteria 15613
55 Ga0070713_100002354 3300005436 Bacteria 12338
56 Ga0070713_100036781 3300005436 Unclassified 3954
57 Ga0070713_100041168 3300005436 Unclassified 3762
58 Ga0070713_100058279 3300005436 Archaea 3220
59 Ga0070713_100065399 3300005436 Unclassified 3055
60 Ga0070713_100111355 3300005436 Unclassified 2387
61 Ga0070710_10035394 3300005437 Unclassified 2722
62 Ga0070711_100000814 3300005439 Bacteria 16335
63 Ga0070711_100001063 3300005439 Bacteria 14659
64 Ga0070711_100002531 3300005439 Bacteria 10457
65 Ga0070711_100084603 3300005439 Unclassified 2269
66 Ga0070705_100008919 3300005440 Bacteria 4973
67 Ga0070694_100004167 3300005444 Bacteria 8686
68 Ga0070694_100047874 3300005444 Bacteria 2874
69 Ga0070708_100000598 3300005445 Bacteria 27157
70 Ga0070708_100001014 3300005445 Bacteria 21388
71 Ga0070708_100004228 3300005445 Bacteria 11275
72 Ga0070708_100013577 3300005445 Bacteria 6675
73 Ga0070708_100015179 3300005445 Bacteria 6351
74 Ga0070708_100015797 3300005445 Bacteria 6242
75 Ga0070708_100030590 3300005445 Bacteria 4654
76 Ga0070708_100048646 3300005445 Bacteria 3749
77 Ga0070708_100074323 3300005445 Bacteria 3065
78 Ga0070708_100151173 3300005445 Bacteria 2159
79 Ga0070663_100003084 3300005455 Bacteria 9526
80 Ga0070663_100007437 3300005455 Bacteria 6663
81 Ga0070678_100006234 3300005456 Bacteria 6977
82 Ga0070662_100001005 3300005457 Bacteria 17236
83 Ga0070662_100007919 3300005457 Bacteria 6909
84 Ga0070681_10002963 3300005458 Bacteria 15761
85 Ga0070681_10005375 3300005458 Bacteria 12370
86 Ga0068867_100001846 3300005459 Bacteria 14738
87 Ga0068867_100028245 3300005459 Bacteria 4038
88 Ga0070685_10003176 3300005466 Bacteria 8357
89 Ga0070706_100000980 3300005467 Bacteria 31089
90 Ga0070706_100050660 3300005467 Bacteria 3832
91 Ga0070706_100059978 3300005467 Unclassified 3512
92 Ga0070707_100000915 3300005468 Bacteria 29244
93 Ga0070707_100009766 3300005468 Bacteria 8921
94 Ga0070707_100125811 3300005468 Bacteria 2490
95 Ga0070698_100000140 3300005471 Bacteria 65074
96 Ga0070698_100043123 3300005471 Unclassified 4627
97 Ga0070698_100047025 3300005471 Unclassified 4411
98 Ga0070699_100006667 3300005518 Bacteria 10040
99 Ga0070699_100006913 3300005518 Bacteria 9865
100 Ga0070699_100010792 3300005518 Bacteria 7906
101 Ga0070699_100011851 3300005518 Bacteria 7524
102 Ga0070699_100029973 3300005518 Bacteria 4694
103 Ga0070699_100035282 3300005518 Unclassified 4323
104 Ga0070679_100003801 3300005530 Bacteria 13856
105 Ga0070679_100022913 3300005530 Bacteria 6108
106 Ga0070679_100069245 3300005530 Bacteria 3520
107 Ga0070684_100002526 3300005535 Bacteria 13497
108 Ga0070684_100004956 3300005535 Bacteria 10161
109 Ga0070684_100011109 3300005535 Bacteria 7164
110 Ga0070684_100033759 3300005535 Bacteria 4372
111 Ga0070684_100053708 3300005535 Bacteria 3509
112 Ga0070684_100101805 3300005535 Bacteria 2567
113 Ga0070697_100000015 3300005536 Bacteria 143397
114 Ga0070697_100000518 3300005536 Bacteria 29110
115 Ga0070697_100001215 3300005536 Bacteria 19429
116 Ga0070697_100008196 3300005536 Bacteria 8157
117 Ga0070697_100012341 3300005536 Bacteria 6693
118 Ga0070697_100051952 3300005536 Bacteria 3330
119 Ga0070697_100067374 3300005536 Unclassified 2928
120 Ga0068853_100000179 3300005539 Bacteria 44192
121 Ga0068853_100083325 3300005539 Bacteria 2802
122 Ga0068853_100100201 3300005539 Bacteria 2560
123 Ga0070672_100000810 3300005543 Bacteria 18654
124 Ga0070686_100003853 3300005544 Bacteria 8251
125 Ga0070695_100000210 3300005545 Bacteria 28472
126 Ga0070695_100004421 3300005545 Bacteria 8249
127 Ga0070695_100095390 3300005545 Bacteria 1993
128 Ga0070696_100002816 3300005546 Bacteria 11551
129 Ga0070696_100064741 3300005546 Bacteria 2562
130 Ga0070693_100000105 3300005547 Bacteria 37510
131 Ga0070693_100053715 3300005547 Bacteria 2314
132 Ga0070665_100010236 3300005548 Bacteria 9487
133 Ga0070704_100097476 3300005549 Bacteria 2206
134 Ga0068855_100001050 3300005563 Bacteria 34270
135 Ga0068855_100002077 3300005563 Bacteria 24799
136 Ga0068855_100002180 3300005563 Bacteria 24210
137 Ga0068855_100003268 3300005563 Bacteria 19840
138 Ga0068855_100007466 3300005563 Bacteria 13242
139 Ga0068855_100031181 3300005563 Bacteria 6367
140 Ga0068855_100049055 3300005563 Unclassified 4981
141 Ga0068855_100066847 3300005563 Unclassified 4190
142 Ga0068855_100080770 3300005563 Bacteria 3770
143 Ga0070664_100000457 3300005564 Bacteria 30953
144 Ga0070664_100010450 3300005564 Bacteria 7525
145 Ga0070664_100115180 3300005564 Bacteria 2349
146 Ga0068857_100002167 3300005577 Bacteria 15964
147 Ga0068857_100018225 3300005577 Bacteria 6157
148 Ga0068857_100112505 3300005577 Bacteria 2447
149 Ga0068854_100021010 3300005578 Bacteria 4425
150 Ga0068856_100000072 3300005614 Bacteria 95094
151 Ga0068856_100000346 3300005614 Bacteria 50548
152 Ga0068856_100003709 3300005614 Bacteria 15327
153 Ga0068856_100006056 3300005614 Bacteria 11886
154 Ga0068856_100007392 3300005614 Bacteria 10721
155 Ga0068856_100008986 3300005614 Bacteria 9721
156 Ga0068856_100009251 3300005614 Bacteria 9575
157 Ga0068856_100014582 3300005614 Bacteria 7594
158 Ga0068856_100034026 3300005614 Bacteria 4991
159 Ga0068856_100036579 3300005614 Bacteria 4813
160 Ga0068856_100038592 3300005614 Bacteria 4688
161 Ga0068856_100061482 3300005614 Bacteria 3710
162 Ga0068856_100075097 3300005614 Bacteria 3348
163 Ga0068856_100176545 3300005614 Bacteria 2149
164 Ga0070702_100000146 3300005615 Bacteria 22142
165 Ga0068852_100000009 3300005616 Bacteria 149600
166 Ga0068852_100000406 3300005616 Bacteria 28743
167 Ga0068852_100031868 3300005616 Bacteria 4358
168 Ga0068852_100052101 3300005616 Bacteria 3516
169 Ga0068852_100149109 3300005616 Bacteria 2173
170 Ga0068859_100006285 3300005617 Bacteria 12052
171 Ga0068859_100029749 3300005617 Bacteria 5480
172 Ga0068859_100109075 3300005617 Bacteria 2829
173 Ga0068864_100023233 3300005618 Bacteria 5205
174 Ga0068864_100033090 3300005618 Bacteria 4394
175 Ga0068864_100087397 3300005618 Bacteria 2744
176 Ga0068864_100094924 3300005618 Bacteria 2637
177 Ga0068864_100109283 3300005618 Bacteria 2462
178 Ga0068866_10001182 3300005718 Bacteria 11415
179 Ga0068861_100018868 3300005719 Bacteria 4917
180 Ga0068861_100057885 3300005719 Bacteria 2962
181 Ga0068851_10003049 3300005834 Bacteria 7409
182 Ga0068851_10007212 3300005834 Bacteria 5095
183 Ga0068870_10001323 3300005840 Bacteria 9974
184 Ga0068863_100010773 3300005841 Bacteria 8870
185 Ga0068863_100011177 3300005841 Bacteria 8702
186 Ga0068863_100012533 3300005841 Bacteria 8180
187 Ga0068863_100028831 3300005841 Bacteria 5301
188 Ga0068863_100030584 3300005841 Bacteria 5141
189 Ga0068863_100070880 3300005841 Unclassified 3297
190 Ga0068863_100167871 3300005841 Bacteria 2105
191 Ga0068858_100008509 3300005842 Bacteria 9860
192 Ga0068858_100011944 3300005842 Bacteria 8184
193 Ga0068858_100025578 3300005842 Bacteria 5492
194 Ga0068858_100036498 3300005842 Bacteria 4558
195 Ga0068858_100116252 3300005842 Bacteria 2500
196 Ga0068860_100005600 3300005843 Bacteria 12691
197 Ga0068860_100023618 3300005843 Bacteria 5942
198 Ga0068862_100003922 3300005844 Bacteria 12654
199 Ga0068862_100036976 3300005844 Bacteria 4137
200 Ga0070717_10001053 3300006028 Bacteria 18508
201 Ga0070717_10001280 3300006028 Bacteria 17207
202 Ga0070717_10001842 3300006028 Bacteria 14813
203 Ga0070717_10004636 3300006028 Bacteria 9964
204 Ga0070717_10006455 3300006028 Bacteria 8629
205 Ga0070717_10009698 3300006028 Bacteria 7246
206 Ga0070717_10013661 3300006028 Bacteria 6229
207 Ga0070717_10037695 3300006028 Bacteria 3927
208 Ga0070717_10083480 3300006028 Bacteria 2687
209 Ga0070717_10092915 3300006028 Bacteria 2549
210 Ga0070715_10001337 3300006163 Bacteria 7105
211 Ga0070715_10003622 3300006163 Bacteria 4954
212 Ga0070715_10007950 3300006163 Unclassified 3675
213 Ga0070716_100000114 3300006173 Bacteria 31714
214 Ga0070716_100002526 3300006173 Bacteria 8474
215 Ga0070716_100006521 3300006173 Bacteria 5705
216 Ga0070716_100006812 3300006173 Bacteria 5600
217 Ga0070712_100000100 3300006175 Bacteria 43745
218 Ga0070712_100000389 3300006175 Bacteria 25090
219 Ga0070712_100001533 3300006175 Bacteria 14105
220 Ga0070712_100001556 3300006175 Bacteria 14028
221 Ga0070712_100001951 3300006175 Bacteria 12648
222 Ga0070712_100056545 3300006175 Bacteria 2752
223 Ga0097621_100000117 3300006237 Bacteria 45470
224 Ga0097621_100000329 3300006237 Bacteria 32168
225 Ga0097621_100005597 3300006237 Bacteria 8858
226 Ga0097621_100005791 3300006237 Bacteria 8727
227 Ga0097621_100007474 3300006237 Bacteria 7818
228 Ga0097621_100014299 3300006237 Bacteria 5936
229 Ga0097621_100022905 3300006237 Bacteria 4854
230 Ga0097621_100025801 3300006237 Bacteria 4601
231 Ga0097621_100043365 3300006237 Unclassified 3626
232 Ga0097621_100085583 3300006237 Bacteria 2630
233 Ga0068871_100000971 3300006358 Bacteria 19186
234 Ga0068871_100014897 3300006358 Bacteria 5811
235 Ga0068871_100082202 3300006358 Bacteria 2670
236 Ga0068871_100096975 3300006358 Bacteria 2464
237 Ga0068871_100102961 3300006358 Bacteria 2393
238 Ga0075433_10000213 3300006852 Bacteria 32853
239 Ga0075433_10053871 3300006852 Unclassified 3509
240 Ga0075434_100000122 3300006871 Bacteria 45781
241 Ga0075434_100000564 3300006871 Bacteria 28515
242 Ga0075434_100001669 3300006871 Bacteria 18928
243 Ga0075434_100009940 3300006871 Bacteria 8901
244 Ga0075434_100015193 3300006871 Bacteria 7376
245 Ga0075434_100042690 3300006871 Bacteria 4496
246 Ga0068865_100002421 3300006881 Bacteria 11021
247 Ga0068865_100004633 3300006881 Bacteria 8304
248 Ga0068865_100005168 3300006881 Bacteria 7897
249 Ga0075436_100002250 3300006914 Bacteria 13326
250 Ga0075436_100014222 3300006914 Bacteria 5449
251 Ga0075436_100017147 3300006914 Bacteria 4956
252 Ga0075436_100050586 3300006914 Unclassified 2868
253 Ga0097620_100006285 3300006931 Bacteria 12052
254 Ga0097620_100029749 3300006931 Bacteria 5480
255 Ga0097620_100109078 3300006931 Bacteria 2829
256 Ga0075435_100000038 3300007076 Bacteria 67821
257 Ga0075435_100075816 3300007076 Bacteria 2755
258 Ga0075435_100081819 3300007076 Unclassified 2653
259 Ga0099794_10003075 3300007265 Bacteria 6303
260 Ga0099794_10007517 3300007265 Bacteria 4482
261 Ga0099794_10019157 3300007265 Bacteria 3078
262 Ga0099794_10023702 3300007265 Bacteria 2811
263 Ga0099795_10004867 3300007788 Bacteria 3511
264 Ga0105240_10000148 3300009093 Bacteria 142265
265 Ga0105240_10002085 3300009093 Bacteria 32732
266 Ga0105240_10003334 3300009093 Bacteria 24999
267 Ga0105240_10003778 3300009093 Bacteria 23384
268 Ga0105240_10016695 3300009093 Bacteria 9929
269 Ga0105240_10022638 3300009093 Bacteria 8325
270 Ga0105240_10039166 3300009093 Bacteria 6072
271 Ga0105240_10041000 3300009093 Bacteria 5914
272 Ga0105240_10062894 3300009093 Bacteria 4619
273 Ga0105240_10086421 3300009093 Unclassified 3841
274 Ga0105240_10137558 3300009093 Bacteria 2924
275 Ga0105240_10200390 3300009093 Bacteria 2339
276 Ga0105245_10002835 3300009098 Bacteria 15579
277 Ga0105245_10023408 3300009098 Bacteria 5421
278 Ga0105245_10034473 3300009098 Bacteria 4490
279 Ga0105245_10076732 3300009098 Bacteria 3045
280 Ga0105245_10157031 3300009098 Bacteria 2155
281 Ga0105247_10003343 3300009101 Bacteria 10499
282 Ga0114129_10094507 3300009147 Bacteria 4141
283 Ga0114129_10109743 3300009147 Bacteria 3808
284 Ga0105243_10056060 3300009148 Bacteria 3132
285 Ga0105241_10000034 3300009174 Bacteria 115663
286 Ga0105241_10000157 3300009174 Bacteria 49365
287 Ga0105241_10001200 3300009174 Bacteria 19826
288 Ga0105241_10007492 3300009174 Bacteria 8033
289 Ga0105241_10018950 3300009174 Bacteria 5072
290 Ga0105241_10028405 3300009174 Bacteria 4169
291 Ga0105242_10081172 3300009176 Bacteria 2711
292 Ga0105248_10000003 3300009177 Bacteria 1019601
293 Ga0105248_10009349 3300009177 Bacteria 10790
294 Ga0105248_10010236 3300009177 Bacteria 10325
295 Ga0105248_10129135 3300009177 Bacteria 2851
296 Ga0105237_10001511 3300009545 Bacteria 30572
297 Ga0105237_10005226 3300009545 Bacteria 14688
298 Ga0105237_10010821 3300009545 Bacteria 9682
299 Ga0105237_10014822 3300009545 Bacteria 8135
300 Ga0105237_10081703 3300009545 Unclassified 3222
301 Ga0105237_10155290 3300009545 Bacteria 2285
302 Ga0105238_10000121 3300009551 Bacteria 85582
303 Ga0105238_10007714 3300009551 Bacteria 10758
304 Ga0105238_10007802 3300009551 Bacteria 10706
305 Ga0105238_10018538 3300009551 Bacteria 7084
306 Ga0105238_10048974 3300009551 Bacteria 4257
307 Ga0105238_10112641 3300009551 Unclassified 2700
308 Ga0105249_10026101 3300009553 Bacteria 5262
309 Ga0099796_10002143 3300010159 Bacteria 4252
310 Ga0105239_10002108 3300010375 Bacteria 25691
311 Ga0105239_10007899 3300010375 Bacteria 12162
312 Ga0105239_10013560 3300010375 Bacteria 9048
313 Ga0105239_10032944 3300010375 Bacteria 5693
314 Ga0105239_10034893 3300010375 Bacteria 5525
315 Ga0105239_10206745 3300010375 Unclassified 2200
316 Ga0105246_10007094 3300011119 Bacteria 6857
317 Ga0105246_10041358 3300011119 Bacteria 3115
318 Ga0157373_10001145 3300013100 Bacteria 20351
319 Ga0157373_10011714 3300013100 Bacteria 6441
320 Ga0157373_10039559 3300013100 Bacteria 3376
321 Ga0157373_10107230 3300013100 Bacteria 1964
322 Ga0157371_10006441 3300013102 Bacteria 9685
323 Ga0157371_10031814 3300013102 Bacteria 3799
324 Ga0157370_10000059 3300013104 Bacteria 116740
325 Ga0157369_10000035 3300013105 Bacteria 191300
326 Ga0157369_10000468 3300013105 Bacteria 53588
327 Ga0157369_10000617 3300013105 Bacteria 46260
328 Ga0157369_10001957 3300013105 Bacteria 24813
329 Ga0157369_10007147 3300013105 Bacteria 12867
330 Ga0157369_10007485 3300013105 Bacteria 12567
331 Ga0157369_10007497 3300013105 Bacteria 12555
332 Ga0157369_10007988 3300013105 Bacteria 12155
333 Ga0157369_10018975 3300013105 Bacteria 7703
334 Ga0157369_10019328 3300013105 Bacteria 7622
335 Ga0157369_10028070 3300013105 Bacteria 6232
336 Ga0157369_10056407 3300013105 Unclassified 4239
337 Ga0157369_10075426 3300013105 Bacteria 3616
338 Ga0157369_10100117 3300013105 Bacteria 3089
339 Ga0157374_10000294 3300013296 Bacteria 46093
340 Ga0157374_10003048 3300013296 Bacteria 14047
341 Ga0157374_10003917 3300013296 Bacteria 12506
342 Ga0157374_10009405 3300013296 Bacteria 8389
343 Ga0157374_10015000 3300013296 Bacteria 6791
344 Ga0157374_10075570 3300013296 Bacteria 3183
345 Ga0157378_10000217 3300013297 Bacteria 55710
346 Ga0157378_10000250 3300013297 Bacteria 52510
347 Ga0157378_10002396 3300013297 Bacteria 16655
348 Ga0157378_10004037 3300013297 Bacteria 12960
349 Ga0157378_10028879 3300013297 Bacteria 4896
350 Ga0157378_10031278 3300013297 Bacteria 4701
351 Ga0157378_10040910 3300013297 Bacteria 4111
352 Ga0157378_10053830 3300013297 Bacteria 3583
353 Ga0157378_10069112 3300013297 Bacteria 3168
354 Ga0163162_10005493 3300013306 Bacteria 12250
355 Ga0163162_10021857 3300013306 Bacteria 6303
356 Ga0157372_10000049 3300013307 Bacteria 142350
357 Ga0157372_10000504 3300013307 Bacteria 42933
358 Ga0157372_10000951 3300013307 Bacteria 31615
359 Ga0157372_10001326 3300013307 Bacteria 26787
360 Ga0157372_10001767 3300013307 Bacteria 23440
361 Ga0157372_10002380 3300013307 Bacteria 20348
362 Ga0157372_10005533 3300013307 Bacteria 13430
363 Ga0157372_10026556 3300013307 Bacteria 6302
364 Ga0157372_10034155 3300013307 Bacteria 5590
365 Ga0157372_10085623 3300013307 Bacteria 3575
366 Ga0157372_10131718 3300013307 Unclassified 2877
367 Ga0157372_10143191 3300013307 Bacteria 2756
368 Ga0157372_10249514 3300013307 Bacteria 2060
369 Ga0157375_10015850 3300013308 Bacteria 6754
370 Ga0157375_10022219 3300013308 Bacteria 5837
371 Ga0157375_10117734 3300013308 Unclassified 2762
372 Ga0157375_10135046 3300013308 Bacteria 2590
373 Ga0163163_10012152 3300014325 Bacteria 7834
374 Ga0163163_10016663 3300014325 Bacteria 6834
375 Ga0182008_10004291 3300014497 Bacteria 8350
376 Ga0157377_10006030 3300014745 Bacteria 5748
377 Ga0157379_10011316 3300014968 Bacteria 7778
378 Ga0157379_10021319 3300014968 Bacteria 5734
379 Ga0157376_10000023 3300014969 Bacteria 223978
380 Ga0157376_10000828 3300014969 Bacteria 20258
381 Ga0157376_10007328 3300014969 Bacteria 7862
382 Ga0157376_10019767 3300014969 Bacteria 5197
383 Ga0157376_10051629 3300014969 Bacteria 3416
384 Ga0157376_10057382 3300014969 Bacteria 3256
385 Ga0157376_10063234 3300014969 Bacteria 3117
386 Ga0163161_10014818 3300017792 Bacteria 5431
387 Ga0207697_10015086 3300025315 Bacteria 3197
388 Ga0207656_10017038 3300025321 Bacteria 2840
389 Ga0207692_10005505 3300025898 Bacteria 5078
390 Ga0207692_10031103 3300025898 Bacteria 2553
391 Ga0207642_10023834 3300025899 Bacteria 2451
392 Ga0207647_10016743 3300025904 Bacteria 4995
393 Ga0207685_10001246 3300025905 Bacteria 5189
394 Ga0207699_10000496 3300025906 Bacteria 19714
395 Ga0207645_10000471 3300025907 Bacteria 33296
396 Ga0207645_10003288 3300025907 Bacteria 12327
397 Ga0207643_10000375 3300025908 Bacteria 30034
398 Ga0207705_10044818 3300025909 Unclassified 3179
399 Ga0207705_10057727 3300025909 Bacteria 2799
400 Ga0207684_10001117 3300025910 Bacteria 29965
401 Ga0207684_10007311 3300025910 Bacteria 9962
402 Ga0207684_10007842 3300025910 Bacteria 9548
403 Ga0207684_10110009 3300025910 Unclassified 2359
404 Ga0207684_10145399 3300025910 Bacteria 2039
405 Ga0207654_10000029 3300025911 Bacteria 123429
406 Ga0207654_10000097 3300025911 Bacteria 59168
407 Ga0207654_10013372 3300025911 Bacteria 4223
408 Ga0207707_10003501 3300025912 Bacteria 13896
409 Ga0207707_10038050 3300025912 Unclassified 4204
410 Ga0207695_10000096 3300025913 Bacteria 265048
411 Ga0207695_10000105 3300025913 Bacteria 254764
412 Ga0207695_10000461 3300025913 Bacteria 88337
413 Ga0207695_10006004 3300025913 Bacteria 15875
414 Ga0207695_10015608 3300025913 Bacteria 8933
415 Ga0207695_10023604 3300025913 Bacteria 6941
416 Ga0207695_10035449 3300025913 Bacteria 5410
417 Ga0207695_10043213 3300025913 Bacteria 4804
418 Ga0207695_10069900 3300025913 Bacteria 3592
419 Ga0207671_10000390 3300025914 Bacteria 61349
420 Ga0207671_10001421 3300025914 Bacteria 27820
421 Ga0207671_10010795 3300025914 Bacteria 7495
422 Ga0207671_10061085 3300025914 Bacteria 2796
423 Ga0207693_10000034 3300025915 Bacteria 113763
424 Ga0207693_10000164 3300025915 Bacteria 59739
425 Ga0207693_10000275 3300025915 Bacteria 47590
426 Ga0207693_10003136 3300025915 Bacteria 14213
427 Ga0207693_10011260 3300025915 Bacteria 7240
428 Ga0207693_10023128 3300025915 Unclassified 4935
429 Ga0207693_10042748 3300025915 Bacteria 3567
430 Ga0207693_10047262 3300025915 Bacteria 3381
431 Ga0207663_10025097 3300025916 Unclassified 3441
432 Ga0207663_10075238 3300025916 Bacteria 2191
433 Ga0207660_10018437 3300025917 Bacteria 4652
434 Ga0207660_10030633 3300025917 Bacteria 3699
435 Ga0207662_10002575 3300025918 Bacteria 9138
436 Ga0207657_10000254 3300025919 Bacteria 56893
437 Ga0207657_10002735 3300025919 Bacteria 18996
438 Ga0207657_10005257 3300025919 Bacteria 13559
439 Ga0207649_10000233 3300025920 Bacteria 45406
440 Ga0207649_10016237 3300025920 Bacteria 4194
441 Ga0207649_10018077 3300025920 Bacteria 4002
442 Ga0207649_10028858 3300025920 Bacteria 3271
443 Ga0207649_10051043 3300025920 Bacteria 2560
444 Ga0207649_10052436 3300025920 Bacteria 2530
445 Ga0207649_10096657 3300025920 Bacteria 1946
446 Ga0207652_10006558 3300025921 Bacteria 9380
447 Ga0207652_10021150 3300025921 Bacteria 5368
448 Ga0207646_10000471 3300025922 Bacteria 53728
449 Ga0207646_10010305 3300025922 Bacteria 9142
450 Ga0207646_10032934 3300025922 Unclassified 4687
451 Ga0207681_10053553 3300025923 Bacteria 2740
452 Ga0207694_10000104 3300025924 Bacteria 91561
453 Ga0207694_10005650 3300025924 Bacteria 9595
454 Ga0207650_10000107 3300025925 Bacteria 109863
455 Ga0207650_10008720 3300025925 Bacteria 6924
456 Ga0207650_10030113 3300025925 Bacteria 3907
457 Ga0207687_10004264 3300025927 Bacteria 9564
458 Ga0207700_10000111 3300025928 Bacteria 48784
459 Ga0207700_10032088 3300025928 Unclassified 3741
460 Ga0207700_10098057 3300025928 Bacteria 2330
461 Ga0207700_10138713 3300025928 Unclassified 1995
462 Ga0207664_10025215 3300025929 Bacteria 4476
463 Ga0207664_10035263 3300025929 Bacteria 3859
464 Ga0207664_10148565 3300025929 Bacteria 1989
465 Ga0207644_10004657 3300025931 Bacteria 8914
466 Ga0207706_10000238 3300025933 Bacteria 60595
467 Ga0207706_10003488 3300025933 Bacteria 15016
468 Ga0207706_10005861 3300025933 Bacteria 11429
469 Ga0207706_10033194 3300025933 Bacteria 4594
470 Ga0207669_10039321 3300025937 Bacteria 2732
471 Ga0207704_10006270 3300025938 Bacteria 5531
472 Ga0207704_10014847 3300025938 Unclassified 3948
473 Ga0207665_10000040 3300025939 Bacteria 84223
474 Ga0207665_10003529 3300025939 Bacteria 10445
475 Ga0207665_10006116 3300025939 Bacteria 7992
476 Ga0207665_10009881 3300025939 Bacteria 6262
477 Ga0207665_10011614 3300025939 Bacteria 5788
478 Ga0207665_10011903 3300025939 Bacteria 5713
479 Ga0207665_10011970 3300025939 Bacteria 5698
480 Ga0207665_10019746 3300025939 Bacteria 4429
481 Ga0207691_10000751 3300025940 Bacteria 32082
482 Ga0207691_10081386 3300025940 Bacteria 2911
483 Ga0207711_10000013 3300025941 Bacteria 514850
484 Ga0207711_10000708 3300025941 Bacteria 32770
485 Ga0207711_10072624 3300025941 Bacteria 2989
486 Ga0207689_10000105 3300025942 Bacteria 68595
487 Ga0207689_10000713 3300025942 Bacteria 31792
488 Ga0207689_10003153 3300025942 Bacteria 15125
489 Ga0207689_10024883 3300025942 Bacteria 5019
490 Ga0207689_10047852 3300025942 Bacteria 3528
491 Ga0207661_10000138 3300025944 Bacteria 46093
492 Ga0207661_10014752 3300025944 Bacteria 5732
493 Ga0207661_10023158 3300025944 Bacteria 4690
494 Ga0207661_10049937 3300025944 Bacteria 3332
495 Ga0207661_10149111 3300025944 Bacteria 2020
496 Ga0207679_10000058 3300025945 Bacteria 101602
497 Ga0207679_10016880 3300025945 Unclassified 4854
498 Ga0207667_10001323 3300025949 Bacteria 31111
499 Ga0207667_10004082 3300025949 Bacteria 17933
500 Ga0207667_10005768 3300025949 Bacteria 15107
501 Ga0207667_10005835 3300025949 Bacteria 15004
502 Ga0207667_10028895 3300025949 Bacteria 6019
503 Ga0207667_10031572 3300025949 Bacteria 5716
504 Ga0207667_10038955 3300025949 Bacteria 5068
505 Ga0207667_10050227 3300025949 Bacteria 4401
506 Ga0207667_10089642 3300025949 Bacteria 3178
507 Ga0207712_10006914 3300025961 Bacteria 7158
508 Ga0207668_10003703 3300025972 Bacteria 8999
509 Ga0207640_10013067 3300025981 Bacteria 4748
510 Ga0207640_10031274 3300025981 Bacteria 3287
511 Ga0207658_10034607 3300025986 Bacteria 3611
512 Ga0207677_10001114 3300026023 Bacteria 14641
513 Ga0207677_10003786 3300026023 Bacteria 8038
514 Ga0207677_10004408 3300026023 Bacteria 7548
515 Ga0207677_10018639 3300026023 Bacteria 4170
516 Ga0207677_10025030 3300026023 Bacteria 3718
517 Ga0207703_10002099 3300026035 Bacteria 17533
518 Ga0207703_10002661 3300026035 Bacteria 15360
519 Ga0207703_10042648 3300026035 Bacteria 3640
520 Ga0207703_10097565 3300026035 Bacteria 2483
521 Ga0207703_10129058 3300026035 Bacteria 2181
522 Ga0207639_10000147 3300026041 Bacteria 52732
523 Ga0207639_10042714 3300026041 Bacteria 3399
524 Ga0207639_10056976 3300026041 Bacteria 2998
525 Ga0207678_10000256 3300026067 Bacteria 48140
526 Ga0207678_10001492 3300026067 Bacteria 21439
527 Ga0207702_10000436 3300026078 Bacteria 47578
528 Ga0207702_10000679 3300026078 Bacteria 36920
529 Ga0207702_10000860 3300026078 Bacteria 31725
530 Ga0207702_10012416 3300026078 Bacteria 7092
531 Ga0207702_10017930 3300026078 Bacteria 5856
532 Ga0207702_10020318 3300026078 Bacteria 5501
533 Ga0207702_10025887 3300026078 Unclassified 4870
534 Ga0207702_10037829 3300026078 Bacteria 4040
535 Ga0207702_10128335 3300026078 Bacteria 2279
536 Ga0207641_10000163 3300026088 Bacteria 94033
537 Ga0207641_10003212 3300026088 Bacteria 14628
538 Ga0207641_10013835 3300026088 Bacteria 6618
539 Ga0207641_10060386 3300026088 Unclassified 3231
540 Ga0207641_10066043 3300026088 Bacteria 3096
541 Ga0207648_10000604 3300026089 Bacteria 40445
542 Ga0207648_10006028 3300026089 Bacteria 12087
543 Ga0207648_10017106 3300026089 Bacteria 6608
544 Ga0207676_10000142 3300026095 Bacteria 62851
545 Ga0207676_10001489 3300026095 Bacteria 17325
546 Ga0207676_10027492 3300026095 Bacteria 4237
547 Ga0207676_10091999 3300026095 Bacteria 2493
548 Ga0207674_10000336 3300026116 Bacteria 60214
549 Ga0207674_10006617 3300026116 Bacteria 13618
550 Ga0207674_10013044 3300026116 Bacteria 9256
551 Ga0207674_10028182 3300026116 Bacteria 5931
552 Ga0207674_10074895 3300026116 Bacteria 3396
553 Ga0207675_100033596 3300026118 Bacteria 4779
554 Ga0207675_100082153 3300026118 Bacteria 3022
555 Ga0207683_10000078 3300026121 Bacteria 77219
556 Ga0207683_10001600 3300026121 Bacteria 20352
557 Ga0207683_10006753 3300026121 Bacteria 9816
558 Ga0207698_10000020 3300026142 Bacteria 139630
559 Ga0207698_10000316 3300026142 Bacteria 28798
560 Ga0207698_10010630 3300026142 Bacteria 5931
561 Ga0207698_10093894 3300026142 Unclassified 2465
562 Ga0209588_1003163 3300027671 Bacteria 4540
563 Ga0209588_1008523 3300027671 Unclassified 3043
564 Ga0265354_1000067 3300028016 Bacteria 17414
565 Ga0265356_1000027 3300028017 Bacteria 22799
566 Ga0268266_10000276 3300028379 Bacteria 84981
567 Ga0268266_10022928 3300028379 Bacteria 5312
568 Ga0268266_10049729 3300028379 Bacteria 3596
569 Ga0268265_10018167 3300028380 Bacteria 4870
570 Ga0268264_10003435 3300028381 Bacteria 13665
571 Ga0268264_10005525 3300028381 Bacteria 10721
572 Ga0268264_10028085 3300028381 Bacteria 4602
573 Ga0265338_10000633 3300028800 Bacteria 61054
574 Ga0265762_1000402 3300030760 Bacteria 7440
575 Ga0265762_1000913 3300030760 Bacteria 5265
576 Ga0265770_1001056 3300030878 Bacteria 3822
577 Ga0265760_10009661 3300031090 Bacteria 2755
578 Ga0265339_10004676 3300031249 Bacteria 9294
579 Ga0265316_10026823 3300031344 Bacteria 4784
580 Ga0265314_10039621 3300031711 Bacteria 3391
581 Ga0373959_0000161 3300034820 Bacteria 15201
582 Ga0373932_0004078 3300035112 Bacteria 3471
583 Ga0373936_0020305 3300035113 Unclassified 2580
584 Ga0373960_0009799 3300035121 Bacteria 2329
585 Ga0373946_0000567 3300035171 Bacteria 12201
586 Ga0373946_0021182 3300035171 Unclassified 2519
587 Ga0373931_0032592 3300035691 Bacteria 2697
588 Ga0373935_0001647 3300035692 Bacteria 12486
589 Ga0373935_0064068 3300035692 Unclassified 2356
590 Ga0373927_0000203 3300035695 Bacteria 47593
591 Ga0373927_0020898 3300035695 Unclassified 4290
592 Ga0373927_0075539 3300035695 Bacteria 2182
593 Ga0373933_0058870 3300035724 Unclassified 2312
594 Ga0373947_0005482 3300035725 Bacteria 7404
595 Ga0373937_0094651 3300036401 Bacteria 2770
596 Ga0373925_0000172 3300037068 Bacteria 70000
597 Ga0373925_0009682 3300037068 Bacteria 7010
598 Ga0373925_0012233 3300037068 Bacteria 6210
599 Ga0373925_0061770 3300037068 Bacteria 2815
600 Ga0373925_0063691 3300037068 Bacteria 2775
601 Ga0436365_1656802 3300039437 Bacteria 9654
602 Ga0466963_0005652 3300044694 Bacteria 7344
603 Ga0466963_0082063 3300044694 Bacteria 2185
604 Ga0466967_0018480 3300045976 Bacteria 5573
605 Ga0495603_0022592 3300046455 Bacteria 3807
606 Ga0495629_0045788 3300046459 Bacteria 3069
607 Ga0495641_0028581 3300046461 Bacteria 2697
608 Ga0495580_0003809 3300046472 Bacteria 12776
609 Ga0495580_0004417 3300046472 Bacteria 11814
610 Ga0495580_0013349 3300046472 Bacteria 6274
611 Ga0495580_0021204 3300046472 Bacteria 4797
612 Ga0495580_0023451 3300046472 Unclassified 4531
613 Ga0495580_0043095 3300046472 Bacteria 3213
614 Ga0495580_0047984 3300046472 Bacteria 3026
615 Ga0495580_0083390 3300046472 Unclassified 2227
616 Ga0495582_0000277 3300046473 Bacteria 28667
617 Ga0495582_0002058 3300046473 Bacteria 11248
618 Ga0495664_0107868 3300046477 Unclassified 1680
619 Ga0495630_0005254 3300046517 Bacteria 9133
620 Ga0495665_0004469 3300046531 Bacteria 7546
621 Ga0495640_0040545 3300046533 Bacteria 3260
622 Ga0495634_0079352 3300046642 Bacteria 2150
623 Ga0495647_0002757 3300046681 Bacteria 5575
624 Ga0495658_0005438 3300046683 Bacteria 6262
625 Ga0495658_0021957 3300046683 Bacteria 3370
626 Ga0495669_0008161 3300046684 Unclassified 4394
627 Ga0495613_0010773 3300046689 Bacteria 6783
628 Ga0495624_0063174 3300046690 Bacteria 2315
629 Ga0495581_0022292 3300047315 Bacteria 3670
630 Ga0495674_0165823 3300047319 Unclassified 1846
631 Ga0495676_0018164 3300047321 Bacteria 6203
632 Ga0495593_0010495 3300047673 Bacteria 5347
633 Ga0495602_0042183 3300048088 Bacteria 4160
634 Ga0495602_0104809 3300048088 Bacteria 2313
635 Ga0496100_0000958 3300048903 Bacteria 13809
636 Ga0496101_0019396 3300048904 Bacteria 4642
637 Ga0496102_0001575 3300048905 Bacteria 20118
638 Ga0496102_0242480 3300048905 Bacteria 1699
639 Ga0496103_0013534 3300048906 Bacteria 4838
640 Ga0496104_0028148 3300048907 Bacteria 5208
641 Ga0496104_0139053 3300048907 Bacteria 2334
642 Ga0496104_0147163 3300048907 Bacteria 2262
643 Ga0496106_0031226 3300048909 Bacteria 3969
644 Ga0496106_0045641 3300048909 Bacteria 3292
645 Ga0496108_0000082 3300048911 Bacteria 101998
646 Ga0496109_0000148 3300048912 Bacteria 69299
647 Ga0496110_0002311 3300048913 Bacteria 14249
648 Ga0496110_0029670 3300048913 Bacteria 4710
649 Ga0496111_0010400 3300048914 Bacteria 6243
650 Ga0496111_0040939 3300048914 Bacteria 3324
651 Ga0496112_0000093 3300048915 Bacteria 58124
652 Ga0496112_0015242 3300048915 Bacteria 7166
653 Ga0496112_0052940 3300048915 Bacteria 3985
654 Ga0496112_0103558 3300048915 Bacteria 2816
655 Ga0496113_0003134 3300048916 Bacteria 9841
656 Ga0496113_0016718 3300048916 Bacteria 5073
657 Ga0496114_0013547 3300048917 Bacteria 6541
658 Ga0496114_0015725 3300048917 Bacteria 6089
659 Ga0496114_0036562 3300048917 Bacteria 4059
660 Ga0496114_0165154 3300048917 Bacteria 1927
661 Ga0496115_0003600 3300048918 Bacteria 11135
662 Ga0496115_0006608 3300048918 Bacteria 8500
663 Ga0496115_0007549 3300048918 Bacteria 8008
664 Ga0496115_0085588 3300048918 Bacteria 2571
665 Ga0496115_0164938 3300048918 Bacteria 1832
666 Ga0496126_0001121 3300048929 Bacteria 44841
667 nmdc:mga05p37_78294_c1 3300050507 Unclassified 4070
668 nmdc:mga0n895_102_c1 3300050512 Bacteria 50003
669 nmdc:mga0n895_11535_c1 3300050512 Bacteria 7891
670 nmdc:mga0n895_30546_c1 3300050512 Bacteria 5151
671 nmdc:mga0n895_325_c1 3300050512 Bacteria 30724
672 nmdc:mga0n895_44202_c1 3300050512 Bacteria 4344
673 nmdc:mga0n895_8777_c1 3300050512 Bacteria 8790
674 nmdc:mga0rr50_109473_c1 3300050513 Bacteria 2184
675 nmdc:mga0rr50_110_c1 3300050513 Bacteria 20297
676 nmdc:mga0rr50_199197_c1 3300050513 Bacteria 1645
677 nmdc:mga0rr50_87451_c1 3300050513 Unclassified 2419
678 nmdc:mga08x19_1121_c1 3300050514 Bacteria 16708
679 nmdc:mga08x19_23657_c1 3300050514 Unclassified 3812
680 nmdc:mga08x19_27595_c1 3300050514 Unclassified 3551
681 nmdc:mga08x19_29357_c1 3300050514 Bacteria 3449
682 nmdc:mga08x19_3025_c1 3300050514 Bacteria 10111
683 nmdc:mga08x19_90137_c1 3300050514 Bacteria 2023
684 nmdc:mga08x19_9881_c1 3300050514 Bacteria 5721
685 nmdc:mga0a205_131_c1 3300050515 Bacteria 46472
686 nmdc:mga0a205_2453_c1 3300050515 Bacteria 16370
687 Ga0495601_0034117 3300053077 Bacteria 3173

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_199197_c1 nmdc:mga0rr50_199197_c1_234_1622 459
2 3300046477 Ga0495664_0107868 Ga0495664_0107868_144_1670 505
3 3300048918 Ga0496115_0164938 Ga0496115_0164938_245_1795 510
4 3300006852 Ga0075433_10053871 Ga0075433_100538711 514
5 3300048917 Ga0496114_0013547 Ga0496114_0013547_4254_5834 520
6 3300025321 Ga0207656_10017038 Ga0207656_100170381 521
7 3300036401 Ga0373937_0094651 Ga0373937_0094651_1151_2743 528
8 3300047319 Ga0495674_0165823 Ga0495674_0165823_83_1675 528
9 3300048915 Ga0496112_0015242 Ga0496112_0015242_4888_6480 528
10 3300048905 Ga0496102_0242480 Ga0496102_0242480_48_1643 529
11 3300005344 Ga0070661_100009772 Ga0070661_1000097723 537
12 3300050514 nmdc:mga08x19_90137_c1 nmdc:mga08x19_90137_c1_325_1953 538
13 3300006871 Ga0075434_100001669 Ga0075434_1000016695 541
14 3300046642 Ga0495634_0079352 Ga0495634_0079352_474_2108 541
15 3300047321 Ga0495676_0018164 Ga0495676_0018164_44_1678 541
16 3300050512 nmdc:mga0n895_11535_c1 nmdc:mga0n895_11535_c1_4524_6158 541
17 3300050512 nmdc:mga0n895_44202_c1 nmdc:mga0n895_44202_c1_2452_4086 541
18 3300035695 Ga0373927_0075539 Ga0373927_0075539_57_1760 546
19 3300009177 Ga0105248_10000003 Ga0105248_10000003673 557
20 3300025941 Ga0207711_10000013 Ga0207711_10000013249 557
21 3300037068 Ga0373925_0063691 Ga0373925_0063691_716_2419 557
22 3300005440 Ga0070705_100008919 Ga0070705_1000089194 558
23 3300005518 Ga0070699_100010792 Ga0070699_1000107927 558
24 3300005518 Ga0070699_100011851 Ga0070699_1000118515 558
25 3300005545 Ga0070695_100004421 Ga0070695_1000044216 558
26 3300005549 Ga0070704_100097476 Ga0070704_1000974761 558
27 3300006871 Ga0075434_100042690 Ga0075434_1000426904 558
28 3300025910 Ga0207684_10145399 Ga0207684_101453992 558
29 3300025922 Ga0207646_10010305 Ga0207646_100103052 558
30 3300027671 Ga0209588_1003163 Ga0209588_10031633 558
31 3300005445 Ga0070708_100048646 Ga0070708_1000486462 560
32 3300009147 Ga0114129_10109743 Ga0114129_101097433 560
33 3300034820 Ga0373959_0000161 Ga0373959_0000161_6686_8380 560
34 3300048918 Ga0496115_0003600 Ga0496115_0003600_7267_8955 560
35 3300050512 nmdc:mga0n895_8777_c1 nmdc:mga0n895_8777_c1_869_2563 560
36 3300005536 Ga0070697_100051952 Ga0070697_1000519523 561
37 3300005435 Ga0070714_100042616 Ga0070714_1000426163 562
38 3300005435 Ga0070714_100051489 Ga0070714_1000514892 562
39 3300005436 Ga0070713_100041168 Ga0070713_1000411682 562
40 3300006914 Ga0075436_100017147 Ga0075436_1000171474 562
41 3300007076 Ga0075435_100075816 Ga0075435_1000758161 562
42 3300009093 Ga0105240_10022638 Ga0105240_100226384 562
43 3300013307 Ga0157372_10249514 Ga0157372_102495142 562
44 3300025929 Ga0207664_10035263 Ga0207664_100352633 562
45 3300025929 Ga0207664_10148565 Ga0207664_101485652 562
46 3300050513 nmdc:mga0rr50_109473_c1 nmdc:mga0rr50_109473_c1_329_2032 562
47 3300050514 nmdc:mga08x19_29357_c1 nmdc:mga08x19_29357_c1_1620_3323 562
48 3300050514 nmdc:mga08x19_3025_c1 nmdc:mga08x19_3025_c1_4221_5924 562
49 3300005434 Ga0070709_10000899 Ga0070709_100008999 564
50 3300005444 Ga0070694_100004167 Ga0070694_1000041677 564
51 3300005445 Ga0070708_100000598 Ga0070708_10000059815 564
52 3300005445 Ga0070708_100030590 Ga0070708_1000305905 564
53 3300005468 Ga0070707_100009766 Ga0070707_1000097662 564
54 3300005471 Ga0070698_100043123 Ga0070698_1000431233 564
55 3300005518 Ga0070699_100006667 Ga0070699_1000066676 564
56 3300005518 Ga0070699_100029973 Ga0070699_1000299733 564
57 3300005518 Ga0070699_100035282 Ga0070699_1000352822 564
58 3300005530 Ga0070679_100022913 Ga0070679_1000229133 564
59 3300005536 Ga0070697_100000518 Ga0070697_1000005184 564
60 3300005536 Ga0070697_100008196 Ga0070697_1000081966 564
61 3300005545 Ga0070695_100000210 Ga0070695_1000002106 564
62 3300005546 Ga0070696_100002816 Ga0070696_1000028164 564
63 3300005547 Ga0070693_100000105 Ga0070693_10000010515 564
64 3300005563 Ga0068855_100080770 Ga0068855_1000807702 564
65 3300005841 Ga0068863_100010773 Ga0068863_1000107732 564
66 3300006175 Ga0070712_100056545 Ga0070712_1000565452 564
67 3300006237 Ga0097621_100005597 Ga0097621_1000055977 564
68 3300006871 Ga0075434_100009940 Ga0075434_1000099405 564
69 3300007265 Ga0099794_10003075 Ga0099794_100030752 564
70 3300007265 Ga0099794_10007517 Ga0099794_100075172 564
71 3300007265 Ga0099794_10019157 Ga0099794_100191572 564
72 3300007788 Ga0099795_10004867 Ga0099795_100048672 564
73 3300010159 Ga0099796_10002143 Ga0099796_100021433 564
74 3300013105 Ga0157369_10007988 Ga0157369_100079887 564
75 3300013297 Ga0157378_10004037 Ga0157378_100040372 564
76 3300014325 Ga0163163_10016663 Ga0163163_100166638 564
77 3300014968 Ga0157379_10021319 Ga0157379_100213192 564
78 3300014969 Ga0157376_10000023 Ga0157376_10000023102 564
79 3300014969 Ga0157376_10000828 Ga0157376_100008289 564
80 3300025899 Ga0207642_10023834 Ga0207642_100238342 564
81 3300025906 Ga0207699_10000496 Ga0207699_1000049611 564
82 3300025910 Ga0207684_10007842 Ga0207684_100078421 564
83 3300025915 Ga0207693_10042748 Ga0207693_100427482 564
84 3300025921 Ga0207652_10021150 Ga0207652_100211504 564
85 3300025939 Ga0207665_10011614 Ga0207665_100116144 564
86 3300025939 Ga0207665_10011903 Ga0207665_100119034 564
87 3300025949 Ga0207667_10089642 Ga0207667_100896422 564
88 3300026088 Ga0207641_10003212 Ga0207641_100032128 564
89 3300027671 Ga0209588_1008523 Ga0209588_10085231 564
90 3300028016 Ga0265354_1000067 Ga0265354_100006711 564
91 3300028379 Ga0268266_10000276 Ga0268266_1000027661 564
92 3300028381 Ga0268264_10028085 Ga0268264_100280855 564
93 3300030878 Ga0265770_1001056 Ga0265770_10010562 564
94 3300031090 Ga0265760_10009661 Ga0265760_100096612 564
95 3300035171 Ga0373946_0000567 Ga0373946_0000567_4922_6625 564
96 3300035691 Ga0373931_0032592 Ga0373931_0032592_910_2613 564
97 3300035695 Ga0373927_0000203 Ga0373927_0000203_10974_12677 564
98 3300035725 Ga0373947_0005482 Ga0373947_0005482_4150_5853 564
99 3300037068 Ga0373925_0000172 Ga0373925_0000172_1221_2924 564
100 3300039437 Ga0436365_1656802 Ga0436365_1656802_3680_5383 564
101 3300046455 Ga0495603_0022592 Ga0495603_0022592_145_1848 564
102 3300046459 Ga0495629_0045788 Ga0495629_0045788_46_1749 564
103 3300046461 Ga0495641_0028581 Ga0495641_0028581_674_2377 564
104 3300046472 Ga0495580_0021204 Ga0495580_0021204_3041_4744 564
105 3300046472 Ga0495580_0047984 Ga0495580_0047984_44_1747 564
106 3300046473 Ga0495582_0000277 Ga0495582_0000277_12435_14138 564
107 3300046517 Ga0495630_0005254 Ga0495630_0005254_5011_6714 564
108 3300046533 Ga0495640_0040545 Ga0495640_0040545_271_1974 564
109 3300046681 Ga0495647_0002757 Ga0495647_0002757_2489_4192 564
110 3300046683 Ga0495658_0021957 Ga0495658_0021957_614_2317 564
111 3300046689 Ga0495613_0010773 Ga0495613_0010773_681_2384 564
112 3300046690 Ga0495624_0063174 Ga0495624_0063174_90_1793 564
113 3300047315 Ga0495581_0022292 Ga0495581_0022292_1376_3079 564
114 3300047673 Ga0495593_0010495 Ga0495593_0010495_1056_2759 564
115 3300048917 Ga0496114_0036562 Ga0496114_0036562_1559_3262 564
116 3300048917 Ga0496114_0165154 Ga0496114_0165154_127_1830 564
117 3300048918 Ga0496115_0006608 Ga0496115_0006608_789_2492 564
118 3300048918 Ga0496115_0085588 Ga0496115_0085588_778_2481 564
119 3300050514 nmdc:mga08x19_1121_c1 nmdc:mga08x19_1121_c1_9630_11333 564
120 3300005328 Ga0070676_10027734 Ga0070676_100277342 565
121 3300005329 Ga0070683_100000496 Ga0070683_10000049624 565
122 3300005330 Ga0070690_100009920 Ga0070690_1000099203 565
123 3300005331 Ga0070670_100010229 Ga0070670_1000102292 565
124 3300005334 Ga0068869_100003211 Ga0068869_1000032116 565
125 3300005334 Ga0068869_100086524 Ga0068869_1000865241 565
126 3300005338 Ga0068868_100003471 Ga0068868_1000034719 565
127 3300005338 Ga0068868_100008104 Ga0068868_1000081044 565
128 3300005338 Ga0068868_100044042 Ga0068868_1000440422 565
129 3300005339 Ga0070660_100009323 Ga0070660_1000093233 565
130 3300005340 Ga0070689_100000550 Ga0070689_10000055014 565
131 3300005341 Ga0070691_10036812 Ga0070691_100368122 565
132 3300005343 Ga0070687_100006094 Ga0070687_1000060943 565
133 3300005344 Ga0070661_100002953 Ga0070661_1000029533 565
134 3300005344 Ga0070661_100006808 Ga0070661_1000068084 565
135 3300005347 Ga0070668_100012100 Ga0070668_1000121001 565
136 3300005353 Ga0070669_100012871 Ga0070669_1000128712 565
137 3300005354 Ga0070675_100009201 Ga0070675_1000092015 565
138 3300005355 Ga0070671_100045357 Ga0070671_1000453572 565
139 3300005355 Ga0070671_100089295 Ga0070671_1000892952 565
140 3300005356 Ga0070674_100003574 Ga0070674_1000035749 565
141 3300005364 Ga0070673_100084581 Ga0070673_1000845812 565
142 3300005365 Ga0070688_100000197 Ga0070688_10000019720 565
143 3300005366 Ga0070659_100006718 Ga0070659_1000067185 565
144 3300005435 Ga0070714_100001358 Ga0070714_10000135819 565
145 3300005435 Ga0070714_100006555 Ga0070714_1000065557 565
146 3300005436 Ga0070713_100000134 Ga0070713_10000013444 565
147 3300005436 Ga0070713_100001365 Ga0070713_10000136510 565
148 3300005436 Ga0070713_100002354 Ga0070713_1000023547 565
149 3300005436 Ga0070713_100065399 Ga0070713_1000653992 565
150 3300005436 Ga0070713_100111355 Ga0070713_1001113552 565
151 3300005439 Ga0070711_100001063 Ga0070711_1000010635 565
152 3300005439 Ga0070711_100002531 Ga0070711_1000025318 565
153 3300005439 Ga0070711_100084603 Ga0070711_1000846032 565
154 3300005445 Ga0070708_100015797 Ga0070708_1000157974 565
155 3300005445 Ga0070708_100074323 Ga0070708_1000743232 565
156 3300005445 Ga0070708_100151173 Ga0070708_1001511732 565
157 3300005455 Ga0070663_100007437 Ga0070663_1000074376 565
158 3300005456 Ga0070678_100006234 Ga0070678_1000062344 565
159 3300005458 Ga0070681_10002963 Ga0070681_1000296313 565
160 3300005458 Ga0070681_10005375 Ga0070681_100053758 565
161 3300005459 Ga0068867_100001846 Ga0068867_10000184610 565
162 3300005466 Ga0070685_10003176 Ga0070685_100031765 565
163 3300005467 Ga0070706_100059978 Ga0070706_1000599783 565
164 3300005468 Ga0070707_100125811 Ga0070707_1001258112 565
165 3300005471 Ga0070698_100047025 Ga0070698_1000470252 565
166 3300005530 Ga0070679_100003801 Ga0070679_10000380110 565
167 3300005539 Ga0068853_100083325 Ga0068853_1000833252 565
168 3300005543 Ga0070672_100000810 Ga0070672_10000081010 565
169 3300005544 Ga0070686_100003853 Ga0070686_1000038533 565
170 3300005563 Ga0068855_100001050 Ga0068855_10000105025 565
171 3300005563 Ga0068855_100007466 Ga0068855_1000074667 565
172 3300005563 Ga0068855_100031181 Ga0068855_1000311815 565
173 3300005563 Ga0068855_100049055 Ga0068855_1000490552 565
174 3300005564 Ga0070664_100000457 Ga0070664_10000045722 565
175 3300005564 Ga0070664_100115180 Ga0070664_1001151801 565
176 3300005577 Ga0068857_100002167 Ga0068857_10000216711 565
177 3300005578 Ga0068854_100021010 Ga0068854_1000210103 565
178 3300005614 Ga0068856_100000072 Ga0068856_10000007211 565
179 3300005614 Ga0068856_100000346 Ga0068856_10000034639 565
180 3300005614 Ga0068856_100003709 Ga0068856_10000370914 565
181 3300005614 Ga0068856_100006056 Ga0068856_1000060567 565
182 3300005614 Ga0068856_100014582 Ga0068856_1000145822 565
183 3300005614 Ga0068856_100061482 Ga0068856_1000614822 565
184 3300005614 Ga0068856_100176545 Ga0068856_1001765451 565
185 3300005615 Ga0070702_100000146 Ga0070702_10000014614 565
186 3300005616 Ga0068852_100149109 Ga0068852_1001491092 565
187 3300005617 Ga0068859_100029749 Ga0068859_1000297493 565
188 3300005617 Ga0068859_100109075 Ga0068859_1001090754 565
189 3300005618 Ga0068864_100087397 Ga0068864_1000873972 565
190 3300005618 Ga0068864_100094924 Ga0068864_1000949243 565
191 3300005718 Ga0068866_10001182 Ga0068866_100011825 565
192 3300005719 Ga0068861_100018868 Ga0068861_1000188682 565
193 3300005834 Ga0068851_10007212 Ga0068851_100072122 565
194 3300005840 Ga0068870_10001323 Ga0068870_100013239 565
195 3300005841 Ga0068863_100028831 Ga0068863_1000288314 565
196 3300005841 Ga0068863_100030584 Ga0068863_1000305842 565
197 3300005841 Ga0068863_100070880 Ga0068863_1000708802 565
198 3300005842 Ga0068858_100008509 Ga0068858_1000085096 565
199 3300005842 Ga0068858_100011944 Ga0068858_10001194411 565
200 3300005842 Ga0068858_100036498 Ga0068858_1000364983 565
201 3300005842 Ga0068858_100116252 Ga0068858_1001162521 565
202 3300005843 Ga0068860_100023618 Ga0068860_1000236182 565
203 3300005844 Ga0068862_100003922 Ga0068862_1000039226 565
204 3300006028 Ga0070717_10001053 Ga0070717_1000105317 565
205 3300006028 Ga0070717_10001280 Ga0070717_100012808 565
206 3300006028 Ga0070717_10006455 Ga0070717_100064553 565
207 3300006028 Ga0070717_10009698 Ga0070717_100096988 565
208 3300006028 Ga0070717_10013661 Ga0070717_100136615 565
209 3300006028 Ga0070717_10037695 Ga0070717_100376951 565
210 3300006028 Ga0070717_10083480 Ga0070717_100834801 565
211 3300006028 Ga0070717_10092915 Ga0070717_100929151 565
212 3300006163 Ga0070715_10001337 Ga0070715_100013374 565
213 3300006173 Ga0070716_100002526 Ga0070716_1000025269 565
214 3300006173 Ga0070716_100006812 Ga0070716_1000068124 565
215 3300006175 Ga0070712_100000100 Ga0070712_1000001008 565
216 3300006175 Ga0070712_100001556 Ga0070712_10000155613 565
217 3300006175 Ga0070712_100001951 Ga0070712_1000019515 565
218 3300006237 Ga0097621_100000117 Ga0097621_10000011719 565
219 3300006237 Ga0097621_100000329 Ga0097621_1000003292 565
220 3300006237 Ga0097621_100005791 Ga0097621_1000057918 565
221 3300006237 Ga0097621_100014299 Ga0097621_1000142993 565
222 3300006237 Ga0097621_100085583 Ga0097621_1000855832 565
223 3300006358 Ga0068871_100000971 Ga0068871_10000097114 565
224 3300006358 Ga0068871_100014897 Ga0068871_1000148975 565
225 3300006871 Ga0075434_100000564 Ga0075434_10000056415 565
226 3300006881 Ga0068865_100002421 Ga0068865_1000024212 565
227 3300006881 Ga0068865_100004633 Ga0068865_1000046336 565
228 3300006914 Ga0075436_100002250 Ga0075436_1000022504 565
229 3300006914 Ga0075436_100050586 Ga0075436_1000505862 565
230 3300006931 Ga0097620_100029749 Ga0097620_1000297493 565
231 3300006931 Ga0097620_100109078 Ga0097620_1001090782 565
232 3300007076 Ga0075435_100081819 Ga0075435_1000818192 565
233 3300009093 Ga0105240_10041000 Ga0105240_100410006 565
234 3300009093 Ga0105240_10062894 Ga0105240_100628942 565
235 3300009093 Ga0105240_10137558 Ga0105240_101375582 565
236 3300009093 Ga0105240_10200390 Ga0105240_102003902 565
237 3300009098 Ga0105245_10002835 Ga0105245_100028357 565
238 3300009098 Ga0105245_10023408 Ga0105245_100234082 565
239 3300009174 Ga0105241_10001200 Ga0105241_1000120015 565
240 3300009176 Ga0105242_10081172 Ga0105242_100811722 565
241 3300009177 Ga0105248_10009349 Ga0105248_100093496 565
242 3300009545 Ga0105237_10005226 Ga0105237_1000522612 565
243 3300009545 Ga0105237_10010821 Ga0105237_100108219 565
244 3300009545 Ga0105237_10014822 Ga0105237_100148225 565
245 3300009551 Ga0105238_10007802 Ga0105238_100078026 565
246 3300010375 Ga0105239_10002108 Ga0105239_100021087 565
247 3300010375 Ga0105239_10034893 Ga0105239_100348935 565
248 3300013100 Ga0157373_10001145 Ga0157373_1000114516 565
249 3300013100 Ga0157373_10011714 Ga0157373_100117144 565
250 3300013102 Ga0157371_10006441 Ga0157371_1000644110 565
251 3300013105 Ga0157369_10000468 Ga0157369_1000046842 565
252 3300013105 Ga0157369_10007147 Ga0157369_1000714710 565
253 3300013105 Ga0157369_10007497 Ga0157369_100074974 565
254 3300013105 Ga0157369_10019328 Ga0157369_100193282 565
255 3300013105 Ga0157369_10056407 Ga0157369_100564072 565
256 3300013105 Ga0157369_10075426 Ga0157369_100754261 565
257 3300013296 Ga0157374_10000294 Ga0157374_1000029440 565
258 3300013296 Ga0157374_10003048 Ga0157374_100030485 565
259 3300013296 Ga0157374_10009405 Ga0157374_100094055 565
260 3300013297 Ga0157378_10000217 Ga0157378_1000021745 565
261 3300013297 Ga0157378_10000250 Ga0157378_1000025043 565
262 3300013297 Ga0157378_10002396 Ga0157378_1000239613 565
263 3300013297 Ga0157378_10040910 Ga0157378_100409103 565
264 3300013297 Ga0157378_10053830 Ga0157378_100538305 565
265 3300013306 Ga0163162_10021857 Ga0163162_100218573 565
266 3300013307 Ga0157372_10000504 Ga0157372_1000050419 565
267 3300013307 Ga0157372_10000951 Ga0157372_100009516 565
268 3300013307 Ga0157372_10001326 Ga0157372_100013265 565
269 3300013307 Ga0157372_10005533 Ga0157372_1000553311 565
270 3300013307 Ga0157372_10026556 Ga0157372_100265562 565
271 3300013307 Ga0157372_10034155 Ga0157372_100341553 565
272 3300013307 Ga0157372_10131718 Ga0157372_101317182 565
273 3300013308 Ga0157375_10015850 Ga0157375_100158505 565
274 3300013308 Ga0157375_10135046 Ga0157375_101350462 565
275 3300014325 Ga0163163_10012152 Ga0163163_100121522 565
276 3300014745 Ga0157377_10006030 Ga0157377_100060305 565
277 3300014968 Ga0157379_10011316 Ga0157379_100113162 565
278 3300014969 Ga0157376_10019767 Ga0157376_100197672 565
279 3300025898 Ga0207692_10005505 Ga0207692_100055054 565
280 3300025898 Ga0207692_10031103 Ga0207692_100311032 565
281 3300025905 Ga0207685_10001246 Ga0207685_100012463 565
282 3300025907 Ga0207645_10000471 Ga0207645_1000047114 565
283 3300025908 Ga0207643_10000375 Ga0207643_100003756 565
284 3300025910 Ga0207684_10110009 Ga0207684_101100092 565
285 3300025912 Ga0207707_10003501 Ga0207707_100035014 565
286 3300025912 Ga0207707_10038050 Ga0207707_100380503 565
287 3300025913 Ga0207695_10006004 Ga0207695_1000600411 565
288 3300025913 Ga0207695_10043213 Ga0207695_100432132 565
289 3300025915 Ga0207693_10000164 Ga0207693_100001648 565
290 3300025915 Ga0207693_10000275 Ga0207693_1000027510 565
291 3300025915 Ga0207693_10011260 Ga0207693_100112605 565
292 3300025915 Ga0207693_10023128 Ga0207693_100231282 565
293 3300025915 Ga0207693_10047262 Ga0207693_100472622 565
294 3300025916 Ga0207663_10025097 Ga0207663_100250973 565
295 3300025918 Ga0207662_10002575 Ga0207662_100025753 565
296 3300025919 Ga0207657_10005257 Ga0207657_100052575 565
297 3300025920 Ga0207649_10000233 Ga0207649_1000023323 565
298 3300025920 Ga0207649_10051043 Ga0207649_100510432 565
299 3300025921 Ga0207652_10006558 Ga0207652_100065585 565
300 3300025924 Ga0207694_10005650 Ga0207694_100056502 565
301 3300025925 Ga0207650_10000107 Ga0207650_1000010753 565
302 3300025925 Ga0207650_10008720 Ga0207650_100087204 565
303 3300025928 Ga0207700_10000111 Ga0207700_1000011125 565
304 3300025928 Ga0207700_10032088 Ga0207700_100320884 565
305 3300025928 Ga0207700_10098057 Ga0207700_100980572 565
306 3300025928 Ga0207700_10138713 Ga0207700_101387131 565
307 3300025929 Ga0207664_10025215 Ga0207664_100252153 565
308 3300025931 Ga0207644_10004657 Ga0207644_100046574 565
309 3300025933 Ga0207706_10000238 Ga0207706_1000023814 565
310 3300025937 Ga0207669_10039321 Ga0207669_100393212 565
311 3300025938 Ga0207704_10014847 Ga0207704_100148473 565
312 3300025939 Ga0207665_10003529 Ga0207665_100035294 565
313 3300025939 Ga0207665_10009881 Ga0207665_100098812 565
314 3300025939 Ga0207665_10011970 Ga0207665_100119707 565
315 3300025940 Ga0207691_10000751 Ga0207691_1000075117 565
316 3300025942 Ga0207689_10000105 Ga0207689_1000010553 565
317 3300025942 Ga0207689_10003153 Ga0207689_100031533 565
318 3300025944 Ga0207661_10000138 Ga0207661_1000013824 565
319 3300025944 Ga0207661_10023158 Ga0207661_100231585 565
320 3300025944 Ga0207661_10149111 Ga0207661_101491112 565
321 3300025945 Ga0207679_10000058 Ga0207679_1000005844 565
322 3300025945 Ga0207679_10016880 Ga0207679_100168802 565
323 3300025949 Ga0207667_10004082 Ga0207667_100040826 565
324 3300025949 Ga0207667_10038955 Ga0207667_100389556 565
325 3300025949 Ga0207667_10050227 Ga0207667_100502272 565
326 3300025981 Ga0207640_10031274 Ga0207640_100312742 565
327 3300026023 Ga0207677_10001114 Ga0207677_1000111411 565
328 3300026023 Ga0207677_10004408 Ga0207677_100044084 565
329 3300026023 Ga0207677_10025030 Ga0207677_100250302 565
330 3300026035 Ga0207703_10002099 Ga0207703_1000209917 565
331 3300026035 Ga0207703_10002661 Ga0207703_1000266113 565
332 3300026035 Ga0207703_10042648 Ga0207703_100426483 565
333 3300026041 Ga0207639_10056976 Ga0207639_100569761 565
334 3300026067 Ga0207678_10001492 Ga0207678_1000149219 565
335 3300026078 Ga0207702_10000436 Ga0207702_1000043613 565
336 3300026078 Ga0207702_10000679 Ga0207702_1000067922 565
337 3300026078 Ga0207702_10012416 Ga0207702_100124165 565
338 3300026078 Ga0207702_10017930 Ga0207702_100179303 565
339 3300026078 Ga0207702_10020318 Ga0207702_100203182 565
340 3300026078 Ga0207702_10037829 Ga0207702_100378293 565
341 3300026078 Ga0207702_10128335 Ga0207702_101283351 565
342 3300026088 Ga0207641_10000163 Ga0207641_1000016333 565
343 3300026088 Ga0207641_10060386 Ga0207641_100603863 565
344 3300026089 Ga0207648_10000604 Ga0207648_1000060425 565
345 3300026089 Ga0207648_10017106 Ga0207648_100171061 565
346 3300026095 Ga0207676_10000142 Ga0207676_1000014245 565
347 3300026095 Ga0207676_10001489 Ga0207676_100014896 565
348 3300026116 Ga0207674_10000336 Ga0207674_1000033639 565
349 3300026116 Ga0207674_10028182 Ga0207674_100281824 565
350 3300026118 Ga0207675_100033596 Ga0207675_1000335962 565
351 3300026121 Ga0207683_10001600 Ga0207683_1000160014 565
352 3300026142 Ga0207698_10093894 Ga0207698_100938942 565
353 3300028017 Ga0265356_1000027 Ga0265356_100002718 565
354 3300028380 Ga0268265_10018167 Ga0268265_100181673 565
355 3300028381 Ga0268264_10003435 Ga0268264_100034356 565
356 3300028800 Ga0265338_10000633 Ga0265338_1000063332 565
357 3300030760 Ga0265762_1000402 Ga0265762_10004026 565
358 3300030760 Ga0265762_1000913 Ga0265762_10009133 565
359 3300031249 Ga0265339_10004676 Ga0265339_100046763 565
360 3300031711 Ga0265314_10039621 Ga0265314_100396212 565
361 3300035113 Ga0373936_0020305 Ga0373936_0020305_771_2474 565
362 3300035171 Ga0373946_0021182 Ga0373946_0021182_216_1919 565
363 3300035692 Ga0373935_0001647 Ga0373935_0001647_5648_7351 565
364 3300035692 Ga0373935_0064068 Ga0373935_0064068_478_2181 565
365 3300035695 Ga0373927_0020898 Ga0373927_0020898_2289_3992 565
366 3300035724 Ga0373933_0058870 Ga0373933_0058870_524_2227 565
367 3300037068 Ga0373925_0009682 Ga0373925_0009682_3162_4865 565
368 3300037068 Ga0373925_0012233 Ga0373925_0012233_2163_3866 565
369 3300044694 Ga0466963_0082063 Ga0466963_0082063_171_1874 565
370 3300046472 Ga0495580_0003809 Ga0495580_0003809_9429_11132 565
371 3300046472 Ga0495580_0004417 Ga0495580_0004417_3495_5198 565
372 3300046472 Ga0495580_0023451 Ga0495580_0023451_659_2362 565
373 3300046472 Ga0495580_0043095 Ga0495580_0043095_345_2048 565
374 3300046473 Ga0495582_0002058 Ga0495582_0002058_1401_3104 565
375 3300046531 Ga0495665_0004469 Ga0495665_0004469_2516_4219 565
376 3300046683 Ga0495658_0005438 Ga0495658_0005438_4158_5861 565
377 3300046684 Ga0495669_0008161 Ga0495669_0008161_31_1734 565
378 3300048088 Ga0495602_0042183 Ga0495602_0042183_306_2009 565
379 3300048911 Ga0496108_0000082 Ga0496108_0000082_65102_66805 565
380 3300048912 Ga0496109_0000148 Ga0496109_0000148_45191_46894 565
381 3300048913 Ga0496110_0002311 Ga0496110_0002311_8481_10184 565
382 3300048914 Ga0496111_0010400 Ga0496111_0010400_3122_4825 565
383 3300048915 Ga0496112_0000093 Ga0496112_0000093_53628_55331 565
384 3300048915 Ga0496112_0052940 Ga0496112_0052940_1468_3171 565
385 3300048915 Ga0496112_0103558 Ga0496112_0103558_258_1961 565
386 3300048916 Ga0496113_0003134 Ga0496113_0003134_7516_9219 565
387 3300050512 nmdc:mga0n895_325_c1 nmdc:mga0n895_325_c1_13443_15155 565
388 3300050513 nmdc:mga0rr50_87451_c1 nmdc:mga0rr50_87451_c1_469_2181 565
389 3300050514 nmdc:mga08x19_23657_c1 nmdc:mga08x19_23657_c1_1340_3043 565
390 3300050514 nmdc:mga08x19_9881_c1 nmdc:mga08x19_9881_c1_2454_4157 565
391 3300050515 nmdc:mga0a205_2453_c1 nmdc:mga0a205_2453_c1_9538_11250 565
392 3300053077 Ga0495601_0034117 Ga0495601_0034117_371_2074 565
393 3300005329 Ga0070683_100009054 Ga0070683_1000090545 566
394 3300005334 Ga0068869_100032775 Ga0068869_1000327753 566
395 3300005335 Ga0070666_10002725 Ga0070666_100027255 566
396 3300005336 Ga0070680_100053426 Ga0070680_1000534262 566
397 3300005339 Ga0070660_100068794 Ga0070660_1000687941 566
398 3300005344 Ga0070661_100005979 Ga0070661_1000059795 566
399 3300005347 Ga0070668_100006081 Ga0070668_1000060817 566
400 3300005353 Ga0070669_100022835 Ga0070669_1000228353 566
401 3300005366 Ga0070659_100011058 Ga0070659_1000110584 566
402 3300005367 Ga0070667_100005223 Ga0070667_1000052236 566
403 3300005434 Ga0070709_10031441 Ga0070709_100314412 566
404 3300005435 Ga0070714_100029396 Ga0070714_1000293963 566
405 3300005436 Ga0070713_100036781 Ga0070713_1000367812 566
406 3300005436 Ga0070713_100058279 Ga0070713_1000582791 566
407 3300005437 Ga0070710_10035394 Ga0070710_100353943 566
408 3300005439 Ga0070711_100000814 Ga0070711_1000008142 566
409 3300005444 Ga0070694_100047874 Ga0070694_1000478742 566
410 3300005445 Ga0070708_100001014 Ga0070708_10000101410 566
411 3300005445 Ga0070708_100004228 Ga0070708_1000042286 566
412 3300005445 Ga0070708_100013577 Ga0070708_1000135775 566
413 3300005455 Ga0070663_100003084 Ga0070663_1000030845 566
414 3300005457 Ga0070662_100001005 Ga0070662_10000100510 566
415 3300005459 Ga0068867_100028245 Ga0068867_1000282451 566
416 3300005467 Ga0070706_100000980 Ga0070706_10000098027 566
417 3300005468 Ga0070707_100000915 Ga0070707_1000009153 566
418 3300005471 Ga0070698_100000140 Ga0070698_10000014043 566
419 3300005518 Ga0070699_100006913 Ga0070699_1000069136 566
420 3300005535 Ga0070684_100011109 Ga0070684_1000111095 566
421 3300005536 Ga0070697_100000015 Ga0070697_100000015114 566
422 3300005536 Ga0070697_100001215 Ga0070697_1000012157 566
423 3300005536 Ga0070697_100012341 Ga0070697_1000123417 566
424 3300005545 Ga0070695_100095390 Ga0070695_1000953902 566
425 3300005546 Ga0070696_100064741 Ga0070696_1000647412 566
426 3300005547 Ga0070693_100053715 Ga0070693_1000537152 566
427 3300005548 Ga0070665_100010236 Ga0070665_1000102365 566
428 3300005564 Ga0070664_100010450 Ga0070664_1000104505 566
429 3300005577 Ga0068857_100112505 Ga0068857_1001125052 566
430 3300005614 Ga0068856_100008986 Ga0068856_1000089863 566
431 3300005614 Ga0068856_100075097 Ga0068856_1000750973 566
432 3300005616 Ga0068852_100031868 Ga0068852_1000318683 566
433 3300005617 Ga0068859_100006285 Ga0068859_1000062854 566
434 3300005618 Ga0068864_100033090 Ga0068864_1000330901 566
435 3300005618 Ga0068864_100109283 Ga0068864_1001092832 566
436 3300005719 Ga0068861_100057885 Ga0068861_1000578852 566
437 3300005834 Ga0068851_10003049 Ga0068851_100030495 566
438 3300005841 Ga0068863_100011177 Ga0068863_1000111776 566
439 3300005841 Ga0068863_100167871 Ga0068863_1001678712 566
440 3300005842 Ga0068858_100025578 Ga0068858_1000255783 566
441 3300005844 Ga0068862_100036976 Ga0068862_1000369762 566
442 3300006028 Ga0070717_10004636 Ga0070717_100046364 566
443 3300006163 Ga0070715_10003622 Ga0070715_100036222 566
444 3300006163 Ga0070715_10007950 Ga0070715_100079503 566
445 3300006173 Ga0070716_100000114 Ga0070716_1000001143 566
446 3300006173 Ga0070716_100006521 Ga0070716_1000065213 566
447 3300006175 Ga0070712_100000389 Ga0070712_10000038916 566
448 3300006175 Ga0070712_100001533 Ga0070712_1000015334 566
449 3300006237 Ga0097621_100007474 Ga0097621_1000074747 566
450 3300006237 Ga0097621_100022905 Ga0097621_1000229053 566
451 3300006237 Ga0097621_100043365 Ga0097621_1000433653 566
452 3300006358 Ga0068871_100102961 Ga0068871_1001029612 566
453 3300006852 Ga0075433_10000213 Ga0075433_1000021328 566
454 3300006871 Ga0075434_100000122 Ga0075434_10000012220 566
455 3300006871 Ga0075434_100015193 Ga0075434_1000151934 566
456 3300006881 Ga0068865_100005168 Ga0068865_1000051684 566
457 3300006914 Ga0075436_100014222 Ga0075436_1000142224 566
458 3300006931 Ga0097620_100006285 Ga0097620_1000062857 566
459 3300007076 Ga0075435_100000038 Ga0075435_10000003819 566
460 3300007265 Ga0099794_10023702 Ga0099794_100237022 566
461 3300009093 Ga0105240_10016695 Ga0105240_100166955 566
462 3300009098 Ga0105245_10157031 Ga0105245_101570312 566
463 3300009101 Ga0105247_10003343 Ga0105247_100033434 566
464 3300009147 Ga0114129_10094507 Ga0114129_100945073 566
465 3300009148 Ga0105243_10056060 Ga0105243_100560603 566
466 3300009174 Ga0105241_10018950 Ga0105241_100189503 566
467 3300009545 Ga0105237_10155290 Ga0105237_101552902 566
468 3300009551 Ga0105238_10007714 Ga0105238_100077147 566
469 3300009553 Ga0105249_10026101 Ga0105249_100261012 566
470 3300010375 Ga0105239_10206745 Ga0105239_102067452 566
471 3300013100 Ga0157373_10039559 Ga0157373_100395592 566
472 3300013102 Ga0157371_10031814 Ga0157371_100318143 566
473 3300013105 Ga0157369_10028070 Ga0157369_100280702 566
474 3300013296 Ga0157374_10003917 Ga0157374_100039177 566
475 3300013296 Ga0157374_10015000 Ga0157374_100150005 566
476 3300013297 Ga0157378_10028879 Ga0157378_100288793 566
477 3300013297 Ga0157378_10031278 Ga0157378_100312782 566
478 3300013306 Ga0163162_10005493 Ga0163162_100054937 566
479 3300013307 Ga0157372_10143191 Ga0157372_101431912 566
480 3300014497 Ga0182008_10004291 Ga0182008_100042913 566
481 3300014969 Ga0157376_10051629 Ga0157376_100516293 566
482 3300014969 Ga0157376_10057382 Ga0157376_100573822 566
483 3300025907 Ga0207645_10003288 Ga0207645_100032883 566
484 3300025909 Ga0207705_10044818 Ga0207705_100448182 566
485 3300025910 Ga0207684_10001117 Ga0207684_1000111715 566
486 3300025910 Ga0207684_10007311 Ga0207684_100073117 566
487 3300025914 Ga0207671_10010795 Ga0207671_100107953 566
488 3300025915 Ga0207693_10000034 Ga0207693_1000003450 566
489 3300025915 Ga0207693_10003136 Ga0207693_100031366 566
490 3300025916 Ga0207663_10075238 Ga0207663_100752382 566
491 3300025917 Ga0207660_10018437 Ga0207660_100184373 566
492 3300025919 Ga0207657_10000254 Ga0207657_100002543 566
493 3300025919 Ga0207657_10002735 Ga0207657_1000273515 566
494 3300025920 Ga0207649_10018077 Ga0207649_100180773 566
495 3300025920 Ga0207649_10096657 Ga0207649_100966571 566
496 3300025922 Ga0207646_10000471 Ga0207646_1000047117 566
497 3300025923 Ga0207681_10053553 Ga0207681_100535532 566
498 3300025927 Ga0207687_10004264 Ga0207687_100042644 566
499 3300025933 Ga0207706_10003488 Ga0207706_100034888 566
500 3300025933 Ga0207706_10033194 Ga0207706_100331943 566
501 3300025938 Ga0207704_10006270 Ga0207704_100062704 566
502 3300025939 Ga0207665_10000040 Ga0207665_1000004042 566
503 3300025939 Ga0207665_10006116 Ga0207665_100061165 566
504 3300025939 Ga0207665_10019746 Ga0207665_100197462 566
505 3300025941 Ga0207711_10000708 Ga0207711_100007084 566
506 3300025942 Ga0207689_10024883 Ga0207689_100248835 566
507 3300025949 Ga0207667_10005768 Ga0207667_100057687 566
508 3300025961 Ga0207712_10006914 Ga0207712_100069142 566
509 3300025972 Ga0207668_10003703 Ga0207668_100037034 566
510 3300025981 Ga0207640_10013067 Ga0207640_100130672 566
511 3300025986 Ga0207658_10034607 Ga0207658_100346072 566
512 3300026023 Ga0207677_10018639 Ga0207677_100186393 566
513 3300026035 Ga0207703_10129058 Ga0207703_101290582 566
514 3300026067 Ga0207678_10000256 Ga0207678_100002568 566
515 3300026088 Ga0207641_10066043 Ga0207641_100660432 566
516 3300026089 Ga0207648_10006028 Ga0207648_100060287 566
517 3300026118 Ga0207675_100082153 Ga0207675_1000821532 566
518 3300026121 Ga0207683_10006753 Ga0207683_100067537 566
519 3300026142 Ga0207698_10010630 Ga0207698_100106304 566
520 3300028379 Ga0268266_10022928 Ga0268266_100229284 566
521 3300035112 Ga0373932_0004078 Ga0373932_0004078_816_2522 566
522 3300035121 Ga0373960_0009799 Ga0373960_0009799_484_2190 566
523 3300037068 Ga0373925_0061770 Ga0373925_0061770_463_2169 566
524 3300046472 Ga0495580_0013349 Ga0495580_0013349_4473_6179 566
525 3300048903 Ga0496100_0000958 Ga0496100_0000958_7348_9054 566
526 3300048904 Ga0496101_0019396 Ga0496101_0019396_1785_3491 566
527 3300048905 Ga0496102_0001575 Ga0496102_0001575_6083_7789 566
528 3300048906 Ga0496103_0013534 Ga0496103_0013534_2166_3872 566
529 3300048907 Ga0496104_0028148 Ga0496104_0028148_1893_3599 566
530 3300048907 Ga0496104_0139053 Ga0496104_0139053_371_2077 566
531 3300048907 Ga0496104_0147163 Ga0496104_0147163_465_2171 566
532 3300048909 Ga0496106_0031226 Ga0496106_0031226_122_1828 566
533 3300048909 Ga0496106_0045641 Ga0496106_0045641_1568_3274 566
534 3300048913 Ga0496110_0029670 Ga0496110_0029670_2207_3913 566
535 3300048914 Ga0496111_0040939 Ga0496111_0040939_1412_3118 566
536 3300048916 Ga0496113_0016718 Ga0496113_0016718_1806_3512 566
537 3300048917 Ga0496114_0015725 Ga0496114_0015725_2676_4382 566
538 3300048929 Ga0496126_0001121 Ga0496126_0001121_37430_39136 566
539 3300050507 nmdc:mga05p37_78294_c1 nmdc:mga05p37_78294_c1_59_1768 566
540 3300050512 nmdc:mga0n895_102_c1 nmdc:mga0n895_102_c1_33137_34843 566
541 3300050512 nmdc:mga0n895_30546_c1 nmdc:mga0n895_30546_c1_421_2130 566
542 3300050513 nmdc:mga0rr50_110_c1 nmdc:mga0rr50_110_c1_983_2689 566
543 3300050514 nmdc:mga08x19_27595_c1 nmdc:mga08x19_27595_c1_1356_3062 566
544 3300050515 nmdc:mga0a205_131_c1 nmdc:mga0a205_131_c1_43999_45705 566
545 3300005445 Ga0070708_100015179 Ga0070708_1000151795 567
546 3300005467 Ga0070706_100050660 Ga0070706_1000506602 567
547 3300005536 Ga0070697_100067374 Ga0070697_1000673742 567
548 3300025922 Ga0207646_10032934 Ga0207646_100329343 567
549 3300031344 Ga0265316_10026823 Ga0265316_100268232 573
550 3300005329 Ga0070683_100001098 Ga0070683_10000109815 574
551 3300005329 Ga0070683_100013474 Ga0070683_1000134744 574
552 3300005329 Ga0070683_100068690 Ga0070683_1000686902 574
553 3300005331 Ga0070670_100005903 Ga0070670_1000059034 574
554 3300005334 Ga0068869_100011746 Ga0068869_1000117464 574
555 3300005334 Ga0068869_100015327 Ga0068869_1000153274 574
556 3300005336 Ga0070680_100044939 Ga0070680_1000449393 574
557 3300005338 Ga0068868_100005053 Ga0068868_1000050536 574
558 3300005457 Ga0070662_100007919 Ga0070662_1000079192 574
559 3300005530 Ga0070679_100069245 Ga0070679_1000692452 574
560 3300005535 Ga0070684_100002526 Ga0070684_1000025264 574
561 3300005535 Ga0070684_100004956 Ga0070684_1000049566 574
562 3300005535 Ga0070684_100033759 Ga0070684_1000337592 574
563 3300005535 Ga0070684_100053708 Ga0070684_1000537082 574
564 3300005535 Ga0070684_100101805 Ga0070684_1001018053 574
565 3300005539 Ga0068853_100000179 Ga0068853_1000001799 574
566 3300005539 Ga0068853_100100201 Ga0068853_1001002011 574
567 3300005563 Ga0068855_100002077 Ga0068855_1000020773 574
568 3300005563 Ga0068855_100002180 Ga0068855_10000218014 574
569 3300005563 Ga0068855_100003268 Ga0068855_10000326818 574
570 3300005563 Ga0068855_100066847 Ga0068855_1000668472 574
571 3300005577 Ga0068857_100018225 Ga0068857_1000182252 574
572 3300005614 Ga0068856_100007392 Ga0068856_1000073927 574
573 3300005614 Ga0068856_100009251 Ga0068856_1000092516 574
574 3300005614 Ga0068856_100034026 Ga0068856_1000340263 574
575 3300005614 Ga0068856_100036579 Ga0068856_1000365792 574
576 3300005614 Ga0068856_100038592 Ga0068856_1000385922 574
577 3300005616 Ga0068852_100000009 Ga0068852_10000000981 574
578 3300005616 Ga0068852_100000406 Ga0068852_1000004067 574
579 3300005616 Ga0068852_100052101 Ga0068852_1000521014 574
580 3300005618 Ga0068864_100023233 Ga0068864_1000232332 574
581 3300005841 Ga0068863_100012533 Ga0068863_1000125334 574
582 3300005843 Ga0068860_100005600 Ga0068860_1000056008 574
583 3300006028 Ga0070717_10001842 Ga0070717_1000184211 574
584 3300006237 Ga0097621_100025801 Ga0097621_1000258013 574
585 3300006358 Ga0068871_100082202 Ga0068871_1000822022 574
586 3300006358 Ga0068871_100096975 Ga0068871_1000969751 574
587 3300009093 Ga0105240_10000148 Ga0105240_1000014885 574
588 3300009093 Ga0105240_10002085 Ga0105240_1000208518 574
589 3300009093 Ga0105240_10003334 Ga0105240_1000333414 574
590 3300009093 Ga0105240_10003778 Ga0105240_1000377813 574
591 3300009093 Ga0105240_10086421 Ga0105240_100864214 574
592 3300009098 Ga0105245_10034473 Ga0105245_100344732 574
593 3300009098 Ga0105245_10076732 Ga0105245_100767322 574
594 3300009174 Ga0105241_10000034 Ga0105241_1000003463 574
595 3300009174 Ga0105241_10000157 Ga0105241_1000015723 574
596 3300009174 Ga0105241_10007492 Ga0105241_100074923 574
597 3300009174 Ga0105241_10028405 Ga0105241_100284054 574
598 3300009177 Ga0105248_10010236 Ga0105248_100102365 574
599 3300009177 Ga0105248_10129135 Ga0105248_101291353 574
600 3300009545 Ga0105237_10001511 Ga0105237_1000151112 574
601 3300009545 Ga0105237_10081703 Ga0105237_100817032 574
602 3300009551 Ga0105238_10000121 Ga0105238_1000012116 574
603 3300009551 Ga0105238_10018538 Ga0105238_100185386 574
604 3300009551 Ga0105238_10048974 Ga0105238_100489744 574
605 3300009551 Ga0105238_10112641 Ga0105238_101126412 574
606 3300010375 Ga0105239_10007899 Ga0105239_100078993 574
607 3300010375 Ga0105239_10013560 Ga0105239_100135606 574
608 3300010375 Ga0105239_10032944 Ga0105239_100329443 574
609 3300011119 Ga0105246_10007094 Ga0105246_100070946 574
610 3300011119 Ga0105246_10041358 Ga0105246_100413583 574
611 3300013104 Ga0157370_10000059 Ga0157370_1000005964 574
612 3300013105 Ga0157369_10000035 Ga0157369_1000003589 574
613 3300013105 Ga0157369_10000617 Ga0157369_1000061716 574
614 3300013105 Ga0157369_10001957 Ga0157369_1000195710 574
615 3300013105 Ga0157369_10007485 Ga0157369_1000748511 574
616 3300013105 Ga0157369_10018975 Ga0157369_100189753 574
617 3300013296 Ga0157374_10075570 Ga0157374_100755703 574
618 3300013297 Ga0157378_10069112 Ga0157378_100691122 574
619 3300013307 Ga0157372_10000049 Ga0157372_1000004983 574
620 3300013307 Ga0157372_10001767 Ga0157372_1000176712 574
621 3300013307 Ga0157372_10002380 Ga0157372_100023805 574
622 3300013307 Ga0157372_10085623 Ga0157372_100856232 574
623 3300013308 Ga0157375_10022219 Ga0157375_100222194 574
624 3300013308 Ga0157375_10117734 Ga0157375_101177342 574
625 3300014969 Ga0157376_10007328 Ga0157376_100073283 574
626 3300014969 Ga0157376_10063234 Ga0157376_100632342 574
627 3300017792 Ga0163161_10014818 Ga0163161_100148182 574
628 3300025315 Ga0207697_10015086 Ga0207697_100150861 574
629 3300025904 Ga0207647_10016743 Ga0207647_100167434 574
630 3300025909 Ga0207705_10057727 Ga0207705_100577272 574
631 3300025911 Ga0207654_10000029 Ga0207654_1000002981 574
632 3300025911 Ga0207654_10000097 Ga0207654_1000009723 574
633 3300025911 Ga0207654_10013372 Ga0207654_100133723 574
634 3300025913 Ga0207695_10000096 Ga0207695_10000096204 574
635 3300025913 Ga0207695_10000105 Ga0207695_10000105110 574
636 3300025913 Ga0207695_10000461 Ga0207695_1000046119 574
637 3300025913 Ga0207695_10023604 Ga0207695_100236043 574
638 3300025913 Ga0207695_10035449 Ga0207695_100354494 574
639 3300025913 Ga0207695_10069900 Ga0207695_100699004 574
640 3300025914 Ga0207671_10000390 Ga0207671_1000039024 574
641 3300025914 Ga0207671_10001421 Ga0207671_1000142116 574
642 3300025914 Ga0207671_10061085 Ga0207671_100610852 574
643 3300025917 Ga0207660_10030633 Ga0207660_100306333 574
644 3300025920 Ga0207649_10016237 Ga0207649_100162371 574
645 3300025920 Ga0207649_10052436 Ga0207649_100524362 574
646 3300025924 Ga0207694_10000104 Ga0207694_1000010423 574
647 3300025925 Ga0207650_10030113 Ga0207650_100301132 574
648 3300025933 Ga0207706_10005861 Ga0207706_100058613 574
649 3300025940 Ga0207691_10081386 Ga0207691_100813862 574
650 3300025941 Ga0207711_10072624 Ga0207711_100726242 574
651 3300025942 Ga0207689_10000713 Ga0207689_100007134 574
652 3300025942 Ga0207689_10047852 Ga0207689_100478522 574
653 3300025944 Ga0207661_10014752 Ga0207661_100147526 574
654 3300025944 Ga0207661_10049937 Ga0207661_100499372 574
655 3300025949 Ga0207667_10001323 Ga0207667_1000132328 574
656 3300025949 Ga0207667_10005835 Ga0207667_100058358 574
657 3300025949 Ga0207667_10028895 Ga0207667_100288952 574
658 3300025949 Ga0207667_10031572 Ga0207667_100315722 574
659 3300026023 Ga0207677_10003786 Ga0207677_100037866 574
660 3300026035 Ga0207703_10097565 Ga0207703_100975652 574
661 3300026041 Ga0207639_10000147 Ga0207639_1000014715 574
662 3300026041 Ga0207639_10042714 Ga0207639_100427142 574
663 3300026078 Ga0207702_10000860 Ga0207702_1000086011 574
664 3300026078 Ga0207702_10025887 Ga0207702_100258872 574
665 3300026088 Ga0207641_10013835 Ga0207641_100138356 574
666 3300026095 Ga0207676_10027492 Ga0207676_100274924 574
667 3300026095 Ga0207676_10091999 Ga0207676_100919992 574
668 3300026116 Ga0207674_10006617 Ga0207674_100066176 574
669 3300026116 Ga0207674_10013044 Ga0207674_100130444 574
670 3300026116 Ga0207674_10074895 Ga0207674_100748952 574
671 3300026121 Ga0207683_10000078 Ga0207683_1000007821 574
672 3300026142 Ga0207698_10000020 Ga0207698_1000002076 574
673 3300026142 Ga0207698_10000316 Ga0207698_1000031616 574
674 3300028379 Ga0268266_10049729 Ga0268266_100497292 574
675 3300028381 Ga0268264_10005525 Ga0268264_100055253 574
676 3300044694 Ga0466963_0005652 Ga0466963_0005652_3703_5427 574
677 3300045976 Ga0466967_0018480 Ga0466967_0018480_2318_4042 574
678 3300046472 Ga0495580_0083390 Ga0495580_0083390_283_2025 574
679 3300048088 Ga0495602_0104809 Ga0495602_0104809_34_1776 574
680 3300048918 Ga0496115_0007549 Ga0496115_0007549_4026_5768 574
681 3300009093 Ga0105240_10039166 Ga0105240_100391664 586
682 3300013100 Ga0157373_10107230 Ga0157373_101072302 587
683 3300013105 Ga0157369_10100117 Ga0157369_101001172 587
684 3300005344 Ga0070661_100068299 Ga0070661_1000682992 594
685 3300025913 Ga0207695_10015608 Ga0207695_100156087 594
686 3300025920 Ga0207649_10028858 Ga0207649_100288583 594
687 3300005327 Ga0070658_10063868 Ga0070658_100638682 595

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

15

52

0.95

PF00732

GMC_oxred_N

GMC oxidoreductase

200

326

0.91

PF05199

GMC_oxred_C

GMC oxidoreductase

426

552

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9885 31 63
6gnd-assembly1.cif.gz_G crystal structure of the complex of a ferredoxin-flavin thioredoxin reductase and a thioredoxin from clostridium acetobutylicum at 2.9 a resolution 0.9784 30 60
3f8d-assembly2.cif.gz_D structure of sulfolobus solfataricus thioredoxin reductase mutant c147a 0.9712 32 60
3f8r-assembly2.cif.gz_D crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules 0.9677 32 60
6gnd-assembly2.cif.gz_E-2 crystal structure of the complex of a ferredoxin-flavin thioredoxin reductase and a thioredoxin from clostridium acetobutylicum at 2.9 a resolution 0.9663 30 60
ID Description Score Start End Superfamily
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9872 34 63 3.50.50.60
2x3nA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9831 30 63 3.50.50.60
af_I6XF25_1_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9811 33 62 3.40.50.720
4zn0A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9788 31 61 3.50.50.60
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9786 33 63 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3D6R3-F1-model_v4 GMC family oxidoreductase 0.9464 136 471 GO:0016614
GO:0050660
AF-A0A2V9XAK7-F1-model_v4 GMC family oxidoreductase 0.9438 208 363 GO:0016614
GO:0050660
AF-A0A2V7EGS5-F1-model_v4 GMC family oxidoreductase 0.939 148 302 GO:0016614
GO:0050660
AF-A0A2V9GLD4-F1-model_v4 Glucose-methanol-choline oxidoreductase N-terminal domain-containing protein 0.9383 30 352 GO:0016614
GO:0050660
AF-A0A1Q7ZHG1-F1-model_v4 GMC family oxidoreductase 0.9357 98 527 GO:0016614
GO:0050660

Feature Viewer

pLDDT pTM Quality
76.69 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map