F475272
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 687 | 227 | 687 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0073628|Ga0466972_0073628_236_793 |
| Length | 185 |
| Sequence | VSVAEAAHRPARTGRAAALWIAFLVVIAAGVGLAWAGAGALRPEVTSSGLQFRTIKAGKGEVIHQDDAAMIDYIGTLDDGTVFDTSQNHGGAQPFTMGAVFPGFAEAMARMQEGGRYRFTMPPRLAFGNKPPPQGFPANSNLTFEVQVQKVVRGGAALMGAGPAPQQPPQGDQSMPPEQMEQMAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 138 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 144 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 164 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 165 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 166 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 167 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 168 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 171 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 206 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 207 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 208 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 213 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 214 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 215 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 216 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 217 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 218 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 219 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 220 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 221 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.4 |
| Metatranscriptomes | 1.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 4.95 |
| Rhizosphere | 94.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1011162 | 3300001904 | Bacteria | 1464 |
| 2 | JGI24740J21852_10011466 | 3300001979 | Bacteria | 3372 |
| 3 | JGI24740J21852_10027078 | 3300001979 | Bacteria | 1912 |
| 4 | JGI24740J21852_10032137 | 3300001979 | Bacteria | 1682 |
| 5 | JGI24739J22299_10006645 | 3300001989 | Bacteria | 4354 |
| 6 | JGI24737J22298_10005144 | 3300001990 | Bacteria | 4528 |
| 7 | JGI24735J21928_10004145 | 3300002067 | Bacteria | 4895 |
| 8 | JGI24735J21928_10018977 | 3300002067 | Bacteria | 2118 |
| 9 | rootH2_10095679 | 3300003320 | Bacteria | 1437 |
| 10 | rootH1_10146668 | 3300003323 | Bacteria | 1574 |
| 11 | Ga0070658_10014069 | 3300005327 | Bacteria | 6425 |
| 12 | Ga0070658_10095418 | 3300005327 | Bacteria | 2455 |
| 13 | Ga0070658_10115125 | 3300005327 | Bacteria | 2230 |
| 14 | Ga0070658_10190689 | 3300005327 | Bacteria | 1727 |
| 15 | Ga0070658_10382658 | 3300005327 | Bacteria | 1207 |
| 16 | Ga0070658_10453259 | 3300005327 | Bacteria | 1105 |
| 17 | Ga0070658_10457148 | 3300005327 | Bacteria | 1100 |
| 18 | Ga0070658_10475136 | 3300005327 | Bacteria | 1078 |
| 19 | Ga0070658_10603367 | 3300005327 | Bacteria | 951 |
| 20 | Ga0070676_10396100 | 3300005328 | Bacteria | 960 |
| 21 | Ga0070683_100009832 | 3300005329 | Bacteria | 8195 |
| 22 | Ga0070683_100014717 | 3300005329 | Bacteria | 6852 |
| 23 | Ga0070683_100034868 | 3300005329 | Bacteria | 4599 |
| 24 | Ga0070683_100093133 | 3300005329 | Bacteria | 2830 |
| 25 | Ga0070683_100430693 | 3300005329 | Bacteria | 1258 |
| 26 | Ga0070683_100788728 | 3300005329 | Bacteria | 911 |
| 27 | Ga0070690_100208589 | 3300005330 | Bacteria | 1363 |
| 28 | Ga0070690_100604591 | 3300005330 | Bacteria | 833 |
| 29 | Ga0070670_100037964 | 3300005331 | Bacteria | 4142 |
| 30 | Ga0070670_100140991 | 3300005331 | Bacteria | 2084 |
| 31 | Ga0070670_100309142 | 3300005331 | Bacteria | 1383 |
| 32 | Ga0070677_10359569 | 3300005333 | Unclassified | 756 |
| 33 | Ga0068869_100646279 | 3300005334 | Bacteria | 897 |
| 34 | Ga0070666_10002971 | 3300005335 | Bacteria | 10286 |
| 35 | Ga0070666_10053690 | 3300005335 | Bacteria | 2718 |
| 36 | Ga0070666_10241481 | 3300005335 | Bacteria | 1277 |
| 37 | Ga0070680_100001257 | 3300005336 | Bacteria | 18304 |
| 38 | Ga0070680_100145622 | 3300005336 | Bacteria | 1987 |
| 39 | Ga0070680_100233016 | 3300005336 | Bacteria | 1555 |
| 40 | Ga0070680_100341447 | 3300005336 | Bacteria | 1272 |
| 41 | Ga0070682_100062528 | 3300005337 | Bacteria | 2358 |
| 42 | Ga0070682_100240793 | 3300005337 | Bacteria | 1298 |
| 43 | Ga0070682_100297181 | 3300005337 | Bacteria | 1183 |
| 44 | Ga0070682_100590144 | 3300005337 | Bacteria | 875 |
| 45 | Ga0070682_100676506 | 3300005337 | Bacteria | 825 |
| 46 | Ga0068868_100012920 | 3300005338 | Bacteria | 6109 |
| 47 | Ga0068868_100074382 | 3300005338 | Bacteria | 2713 |
| 48 | Ga0068868_100335976 | 3300005338 | Bacteria | 1291 |
| 49 | Ga0070660_100029369 | 3300005339 | Bacteria | 4120 |
| 50 | Ga0070660_100036347 | 3300005339 | Bacteria | 3730 |
| 51 | Ga0070660_100046930 | 3300005339 | Bacteria | 3312 |
| 52 | Ga0070660_100057029 | 3300005339 | Bacteria | 3024 |
| 53 | Ga0070660_100060814 | 3300005339 | Bacteria | 2932 |
| 54 | Ga0070660_100082500 | 3300005339 | Bacteria | 2524 |
| 55 | Ga0070660_100192238 | 3300005339 | Bacteria | 1653 |
| 56 | Ga0070660_100599932 | 3300005339 | Bacteria | 921 |
| 57 | Ga0070660_100777800 | 3300005339 | Bacteria | 804 |
| 58 | Ga0070660_100860822 | 3300005339 | Bacteria | 763 |
| 59 | Ga0070660_100864870 | 3300005339 | Bacteria | 762 |
| 60 | Ga0070691_10003582 | 3300005341 | Bacteria | 7010 |
| 61 | Ga0070661_100033437 | 3300005344 | Bacteria | 3724 |
| 62 | Ga0070661_100057595 | 3300005344 | Bacteria | 2847 |
| 63 | Ga0070661_100115944 | 3300005344 | Bacteria | 2003 |
| 64 | Ga0070661_100119212 | 3300005344 | Bacteria | 1975 |
| 65 | Ga0070661_100125604 | 3300005344 | Bacteria | 1924 |
| 66 | Ga0070661_100132596 | 3300005344 | Bacteria | 1872 |
| 67 | Ga0070661_100255546 | 3300005344 | Bacteria | 1353 |
| 68 | Ga0070661_100425149 | 3300005344 | Bacteria | 1053 |
| 69 | Ga0070661_100430133 | 3300005344 | Bacteria | 1047 |
| 70 | Ga0070661_100663233 | 3300005344 | Bacteria | 847 |
| 71 | Ga0070661_100765250 | 3300005344 | Bacteria | 790 |
| 72 | Ga0070692_10006534 | 3300005345 | Bacteria | 5069 |
| 73 | Ga0070692_10013273 | 3300005345 | Bacteria | 3836 |
| 74 | Ga0070692_10072159 | 3300005345 | Bacteria | 1841 |
| 75 | Ga0070692_10107622 | 3300005345 | Bacteria | 1537 |
| 76 | Ga0070675_100222134 | 3300005354 | Bacteria | 1645 |
| 77 | Ga0070675_100354570 | 3300005354 | Bacteria | 1301 |
| 78 | Ga0070671_100024137 | 3300005355 | Bacteria | 4977 |
| 79 | Ga0070671_100079772 | 3300005355 | Bacteria | 2736 |
| 80 | Ga0070671_100223230 | 3300005355 | Bacteria | 1598 |
| 81 | Ga0070671_100479706 | 3300005355 | Bacteria | 1068 |
| 82 | Ga0070674_100198542 | 3300005356 | Bacteria | 1547 |
| 83 | Ga0070674_100218520 | 3300005356 | Bacteria | 1481 |
| 84 | Ga0070674_100263739 | 3300005356 | Bacteria | 1358 |
| 85 | Ga0070674_100402675 | 3300005356 | Bacteria | 1118 |
| 86 | Ga0070673_100000526 | 3300005364 | Bacteria | 20563 |
| 87 | Ga0070673_100075965 | 3300005364 | Bacteria | 2711 |
| 88 | Ga0070673_100230514 | 3300005364 | Bacteria | 1606 |
| 89 | Ga0070673_100895869 | 3300005364 | Bacteria | 822 |
| 90 | Ga0070659_100033445 | 3300005366 | Bacteria | 3993 |
| 91 | Ga0070659_100033606 | 3300005366 | Bacteria | 3984 |
| 92 | Ga0070659_100045336 | 3300005366 | Bacteria | 3444 |
| 93 | Ga0070659_100083906 | 3300005366 | Bacteria | 2547 |
| 94 | Ga0070659_100381841 | 3300005366 | Bacteria | 1187 |
| 95 | Ga0070659_100420236 | 3300005366 | Bacteria | 1131 |
| 96 | Ga0070659_100443303 | 3300005366 | Bacteria | 1100 |
| 97 | Ga0070659_100475719 | 3300005366 | Bacteria | 1062 |
| 98 | Ga0070659_100775901 | 3300005366 | Bacteria | 832 |
| 99 | Ga0070659_100897391 | 3300005366 | Bacteria | 774 |
| 100 | Ga0070667_100013712 | 3300005367 | Bacteria | 6698 |
| 101 | Ga0070667_100053826 | 3300005367 | Bacteria | 3397 |
| 102 | Ga0070667_100056858 | 3300005367 | Bacteria | 3305 |
| 103 | Ga0070667_100405460 | 3300005367 | Bacteria | 1241 |
| 104 | Ga0070714_100224928 | 3300005435 | Bacteria | 1726 |
| 105 | Ga0070714_100450504 | 3300005435 | Bacteria | 1222 |
| 106 | Ga0070714_100715804 | 3300005435 | Bacteria | 966 |
| 107 | Ga0070714_100754447 | 3300005435 | Bacteria | 941 |
| 108 | Ga0070714_101482018 | 3300005435 | Bacteria | 663 |
| 109 | Ga0070713_100604964 | 3300005436 | Unclassified | 1042 |
| 110 | Ga0070663_100025115 | 3300005455 | Bacteria | 4020 |
| 111 | Ga0070663_100053289 | 3300005455 | Bacteria | 2887 |
| 112 | Ga0070663_100078053 | 3300005455 | Bacteria | 2426 |
| 113 | Ga0070663_100397770 | 3300005455 | Bacteria | 1125 |
| 114 | Ga0070663_100720413 | 3300005455 | Bacteria | 849 |
| 115 | Ga0070678_100026409 | 3300005456 | Bacteria | 3925 |
| 116 | Ga0070678_100031044 | 3300005456 | Bacteria | 3680 |
| 117 | Ga0070678_100185955 | 3300005456 | Bacteria | 1705 |
| 118 | Ga0070662_100028447 | 3300005457 | Bacteria | 3889 |
| 119 | Ga0070662_100031341 | 3300005457 | Bacteria | 3731 |
| 120 | Ga0070662_100359996 | 3300005457 | Bacteria | 1193 |
| 121 | Ga0070662_100689245 | 3300005457 | Bacteria | 864 |
| 122 | Ga0070681_10074936 | 3300005458 | Bacteria | 3344 |
| 123 | Ga0070681_10135295 | 3300005458 | Bacteria | 2395 |
| 124 | Ga0070681_10190802 | 3300005458 | Bacteria | 1968 |
| 125 | Ga0070681_10421602 | 3300005458 | Bacteria | 1246 |
| 126 | Ga0070681_10956825 | 3300005458 | Bacteria | 775 |
| 127 | Ga0068867_100173257 | 3300005459 | Bacteria | 1710 |
| 128 | Ga0068867_100224100 | 3300005459 | Bacteria | 1517 |
| 129 | Ga0070685_10175839 | 3300005466 | Bacteria | 1374 |
| 130 | Ga0070679_100038807 | 3300005530 | Bacteria | 4735 |
| 131 | Ga0070679_100089715 | 3300005530 | Bacteria | 3061 |
| 132 | Ga0070679_100624713 | 3300005530 | Bacteria | 1020 |
| 133 | Ga0070679_101081056 | 3300005530 | Bacteria | 747 |
| 134 | Ga0070684_100002671 | 3300005535 | Bacteria | 13167 |
| 135 | Ga0070684_100034298 | 3300005535 | Bacteria | 4338 |
| 136 | Ga0070684_100043830 | 3300005535 | Bacteria | 3865 |
| 137 | Ga0070684_100131444 | 3300005535 | Bacteria | 2258 |
| 138 | Ga0070684_100958225 | 3300005535 | Bacteria | 802 |
| 139 | Ga0068853_100041268 | 3300005539 | Bacteria | 3940 |
| 140 | Ga0068853_100043066 | 3300005539 | Bacteria | 3862 |
| 141 | Ga0068853_100136876 | 3300005539 | Bacteria | 2196 |
| 142 | Ga0068853_100182314 | 3300005539 | Bacteria | 1904 |
| 143 | Ga0068853_100430520 | 3300005539 | Bacteria | 1238 |
| 144 | Ga0068853_100468473 | 3300005539 | Bacteria | 1186 |
| 145 | Ga0068853_101021086 | 3300005539 | Bacteria | 796 |
| 146 | Ga0070672_100047900 | 3300005543 | Bacteria | 3318 |
| 147 | Ga0070672_100363492 | 3300005543 | Bacteria | 1235 |
| 148 | Ga0070672_100387372 | 3300005543 | Bacteria | 1196 |
| 149 | Ga0070672_100563974 | 3300005543 | Bacteria | 989 |
| 150 | Ga0070672_101433130 | 3300005543 | Bacteria | 618 |
| 151 | Ga0070686_100608762 | 3300005544 | Bacteria | 862 |
| 152 | Ga0070686_100744368 | 3300005544 | Bacteria | 786 |
| 153 | Ga0070665_100040150 | 3300005548 | Bacteria | 4704 |
| 154 | Ga0070665_100659351 | 3300005548 | Bacteria | 1059 |
| 155 | Ga0068855_100025356 | 3300005563 | Bacteria | 7095 |
| 156 | Ga0068855_100112774 | 3300005563 | Bacteria | 3120 |
| 157 | Ga0068855_100115015 | 3300005563 | Bacteria | 3084 |
| 158 | Ga0068855_100136178 | 3300005563 | Bacteria | 2802 |
| 159 | Ga0068855_100394981 | 3300005563 | Bacteria | 1516 |
| 160 | Ga0068855_100725812 | 3300005563 | Bacteria | 1061 |
| 161 | Ga0070664_100006591 | 3300005564 | Bacteria | 9361 |
| 162 | Ga0070664_100055897 | 3300005564 | Bacteria | 3353 |
| 163 | Ga0070664_100113509 | 3300005564 | Bacteria | 2366 |
| 164 | Ga0070664_100336421 | 3300005564 | Bacteria | 1370 |
| 165 | Ga0070664_100349063 | 3300005564 | Bacteria | 1345 |
| 166 | Ga0070664_100816447 | 3300005564 | Bacteria | 872 |
| 167 | Ga0070664_100821839 | 3300005564 | Bacteria | 869 |
| 168 | Ga0070664_101036703 | 3300005564 | Bacteria | 771 |
| 169 | Ga0068857_100031248 | 3300005577 | Bacteria | 4705 |
| 170 | Ga0068857_100039427 | 3300005577 | Bacteria | 4184 |
| 171 | Ga0068857_100200012 | 3300005577 | Bacteria | 1821 |
| 172 | Ga0068857_101122619 | 3300005577 | Bacteria | 760 |
| 173 | Ga0068854_100033977 | 3300005578 | Bacteria | 3558 |
| 174 | Ga0068854_100083539 | 3300005578 | Bacteria | 2361 |
| 175 | Ga0068854_100106600 | 3300005578 | Bacteria | 2108 |
| 176 | Ga0068854_100557858 | 3300005578 | Bacteria | 972 |
| 177 | Ga0068856_100008253 | 3300005614 | Bacteria | 10152 |
| 178 | Ga0068856_100251514 | 3300005614 | Bacteria | 1782 |
| 179 | Ga0068856_100274052 | 3300005614 | Bacteria | 1703 |
| 180 | Ga0068856_100900673 | 3300005614 | Archaea | 903 |
| 181 | Ga0068856_100976439 | 3300005614 | Bacteria | 865 |
| 182 | Ga0068856_101130044 | 3300005614 | Bacteria | 800 |
| 183 | Ga0068856_101393909 | 3300005614 | Bacteria | 715 |
| 184 | Ga0068852_100013451 | 3300005616 | Bacteria | 6265 |
| 185 | Ga0068852_100030542 | 3300005616 | Bacteria | 4437 |
| 186 | Ga0068852_100031074 | 3300005616 | Bacteria | 4402 |
| 187 | Ga0068852_100125836 | 3300005616 | Bacteria | 2353 |
| 188 | Ga0068852_100187856 | 3300005616 | Bacteria | 1947 |
| 189 | Ga0068852_100221775 | 3300005616 | Bacteria | 1798 |
| 190 | Ga0068852_100244841 | 3300005616 | Bacteria | 1715 |
| 191 | Ga0068852_100279679 | 3300005616 | Bacteria | 1608 |
| 192 | Ga0068852_100445873 | 3300005616 | Bacteria | 1280 |
| 193 | Ga0068852_100812574 | 3300005616 | Bacteria | 949 |
| 194 | Ga0068852_101128342 | 3300005616 | Bacteria | 804 |
| 195 | Ga0068852_101629976 | 3300005616 | Bacteria | 668 |
| 196 | Ga0068859_100221584 | 3300005617 | Bacteria | 1979 |
| 197 | Ga0068859_100437124 | 3300005617 | Bacteria | 1404 |
| 198 | Ga0068859_100914628 | 3300005617 | Bacteria | 962 |
| 199 | Ga0068864_100038826 | 3300005618 | Bacteria | 4067 |
| 200 | Ga0068864_100758205 | 3300005618 | Bacteria | 951 |
| 201 | Ga0068866_10061662 | 3300005718 | Bacteria | 1948 |
| 202 | Ga0068851_10008280 | 3300005834 | Bacteria | 4802 |
| 203 | Ga0068851_10013866 | 3300005834 | Bacteria | 3818 |
| 204 | Ga0068851_10283083 | 3300005834 | Bacteria | 949 |
| 205 | Ga0068851_10314946 | 3300005834 | Bacteria | 903 |
| 206 | Ga0068851_10383426 | 3300005834 | Bacteria | 824 |
| 207 | Ga0068863_100145598 | 3300005841 | Bacteria | 2266 |
| 208 | Ga0068858_100013510 | 3300005842 | Bacteria | 7704 |
| 209 | Ga0068858_100019414 | 3300005842 | Bacteria | 6356 |
| 210 | Ga0068858_100069226 | 3300005842 | Bacteria | 3271 |
| 211 | Ga0068858_101088491 | 3300005842 | Bacteria | 784 |
| 212 | Ga0068860_100205460 | 3300005843 | Bacteria | 1910 |
| 213 | Ga0068862_100028027 | 3300005844 | Bacteria | 4743 |
| 214 | Ga0081539_10071515 | 3300005985 | Bacteria | 1857 |
| 215 | Ga0097621_100174739 | 3300006237 | Bacteria | 1853 |
| 216 | Ga0097621_100524608 | 3300006237 | Bacteria | 1075 |
| 217 | Ga0097621_101112956 | 3300006237 | Bacteria | 742 |
| 218 | Ga0068871_100716564 | 3300006358 | Bacteria | 917 |
| 219 | Ga0068865_100124170 | 3300006881 | Bacteria | 1924 |
| 220 | Ga0068865_101045468 | 3300006881 | Bacteria | 717 |
| 221 | Ga0097620_100221567 | 3300006931 | Bacteria | 1979 |
| 222 | Ga0097620_100437147 | 3300006931 | Bacteria | 1404 |
| 223 | Ga0097620_100914616 | 3300006931 | Bacteria | 962 |
| 224 | Ga0105250_10008228 | 3300009092 | Bacteria | 4440 |
| 225 | Ga0105245_10611651 | 3300009098 | Bacteria | 1117 |
| 226 | Ga0105247_10092011 | 3300009101 | Bacteria | 1927 |
| 227 | Ga0105241_10503243 | 3300009174 | Bacteria | 1081 |
| 228 | Ga0105248_10001135 | 3300009177 | Bacteria | 29633 |
| 229 | Ga0105248_10019178 | 3300009177 | Bacteria | 7567 |
| 230 | Ga0105248_10201147 | 3300009177 | Bacteria | 2244 |
| 231 | Ga0105248_11141514 | 3300009177 | Bacteria | 881 |
| 232 | Ga0105249_10089043 | 3300009553 | Bacteria | 2884 |
| 233 | Ga0157373_10014974 | 3300013100 | Bacteria | 5675 |
| 234 | Ga0157373_10438077 | 3300013100 | Bacteria | 939 |
| 235 | Ga0157373_10518954 | 3300013100 | Bacteria | 862 |
| 236 | Ga0157373_10748786 | 3300013100 | Bacteria | 718 |
| 237 | Ga0157371_10078304 | 3300013102 | Bacteria | 2342 |
| 238 | Ga0157370_10055585 | 3300013104 | Bacteria | 3770 |
| 239 | Ga0157370_10114252 | 3300013104 | Bacteria | 2522 |
| 240 | Ga0157370_10892455 | 3300013104 | Bacteria | 807 |
| 241 | Ga0157369_10127638 | 3300013105 | Bacteria | 2696 |
| 242 | Ga0157369_10175882 | 3300013105 | Bacteria | 2253 |
| 243 | Ga0157369_10872117 | 3300013105 | Bacteria | 924 |
| 244 | Ga0157369_10881274 | 3300013105 | Bacteria | 918 |
| 245 | Ga0157374_10222841 | 3300013296 | Bacteria | 1851 |
| 246 | Ga0157374_10947297 | 3300013296 | Bacteria | 879 |
| 247 | Ga0157374_11024352 | 3300013296 | Bacteria | 845 |
| 248 | Ga0163162_10089421 | 3300013306 | Bacteria | 3160 |
| 249 | Ga0163162_11228716 | 3300013306 | Bacteria | 851 |
| 250 | Ga0157372_10698367 | 3300013307 | Bacteria | 1181 |
| 251 | Ga0157372_10886448 | 3300013307 | Bacteria | 1035 |
| 252 | Ga0157372_11139254 | 3300013307 | Bacteria | 902 |
| 253 | Ga0157372_11880512 | 3300013307 | Bacteria | 688 |
| 254 | Ga0157375_11130288 | 3300013308 | Bacteria | 918 |
| 255 | Ga0163163_10000735 | 3300014325 | Bacteria | 27886 |
| 256 | Ga0157380_11236428 | 3300014326 | Bacteria | 792 |
| 257 | Ga0182008_10538462 | 3300014497 | Bacteria | 647 |
| 258 | Ga0157379_10012216 | 3300014968 | Bacteria | 7500 |
| 259 | Ga0157379_10330763 | 3300014968 | Bacteria | 1392 |
| 260 | Ga0157376_10338846 | 3300014969 | Bacteria | 1435 |
| 261 | Ga0197907_11114687 | 3300020069 | Bacteria | 855 |
| 262 | Ga0206352_10095400 | 3300020078 | Bacteria | 1198 |
| 263 | Ga0206354_10226857 | 3300020081 | Bacteria | 1335 |
| 264 | Ga0206354_11230177 | 3300020081 | Bacteria | 748 |
| 265 | Ga0206353_11563947 | 3300020082 | Bacteria | 2096 |
| 266 | Ga0213875_10011498 | 3300021388 | Bacteria | 4402 |
| 267 | Ga0207697_10084026 | 3300025315 | Bacteria | 1343 |
| 268 | Ga0207656_10008268 | 3300025321 | Bacteria | 3821 |
| 269 | Ga0207656_10038801 | 3300025321 | Bacteria | 2011 |
| 270 | Ga0207656_10239381 | 3300025321 | Bacteria | 886 |
| 271 | Ga0207656_10302101 | 3300025321 | Bacteria | 792 |
| 272 | Ga0207680_10008315 | 3300025903 | Bacteria | 5085 |
| 273 | Ga0207680_10200759 | 3300025903 | Bacteria | 1359 |
| 274 | Ga0207680_10284731 | 3300025903 | Bacteria | 1149 |
| 275 | Ga0207680_10331744 | 3300025903 | Bacteria | 1065 |
| 276 | Ga0207647_10010648 | 3300025904 | Bacteria | 6483 |
| 277 | Ga0207647_10030159 | 3300025904 | Bacteria | 3502 |
| 278 | Ga0207647_10108722 | 3300025904 | Bacteria | 1640 |
| 279 | Ga0207647_10118329 | 3300025904 | Bacteria | 1563 |
| 280 | Ga0207647_10218361 | 3300025904 | Bacteria | 1099 |
| 281 | Ga0207645_10038053 | 3300025907 | Bacteria | 3086 |
| 282 | Ga0207645_10216303 | 3300025907 | Bacteria | 1262 |
| 283 | Ga0207705_10000493 | 3300025909 | Bacteria | 33656 |
| 284 | Ga0207705_10004262 | 3300025909 | Bacteria | 10832 |
| 285 | Ga0207705_10028284 | 3300025909 | Bacteria | 3996 |
| 286 | Ga0207705_10057414 | 3300025909 | Bacteria | 2807 |
| 287 | Ga0207705_10095986 | 3300025909 | Bacteria | 2176 |
| 288 | Ga0207654_10442327 | 3300025911 | Bacteria | 910 |
| 289 | Ga0207707_10017647 | 3300025912 | Bacteria | 6225 |
| 290 | Ga0207707_10039480 | 3300025912 | Bacteria | 4125 |
| 291 | Ga0207707_10606412 | 3300025912 | Bacteria | 926 |
| 292 | Ga0207695_10154693 | 3300025913 | Bacteria | 2229 |
| 293 | Ga0207671_10024193 | 3300025914 | Bacteria | 4570 |
| 294 | Ga0207671_10028319 | 3300025914 | Bacteria | 4186 |
| 295 | Ga0207660_10003208 | 3300025917 | Bacteria | 10700 |
| 296 | Ga0207660_10045526 | 3300025917 | Bacteria | 3091 |
| 297 | Ga0207660_10054697 | 3300025917 | Bacteria | 2849 |
| 298 | Ga0207660_10189837 | 3300025917 | Bacteria | 1599 |
| 299 | Ga0207657_10009734 | 3300025919 | Bacteria | 9638 |
| 300 | Ga0207657_10015926 | 3300025919 | Bacteria | 7264 |
| 301 | Ga0207657_10017883 | 3300025919 | Bacteria | 6784 |
| 302 | Ga0207657_10039647 | 3300025919 | Bacteria | 4184 |
| 303 | Ga0207657_10052428 | 3300025919 | Bacteria | 3540 |
| 304 | Ga0207657_10072347 | 3300025919 | Bacteria | 2917 |
| 305 | Ga0207657_10084906 | 3300025919 | Bacteria | 2653 |
| 306 | Ga0207657_10091364 | 3300025919 | Bacteria | 2539 |
| 307 | Ga0207657_10121371 | 3300025919 | Bacteria | 2150 |
| 308 | Ga0207657_10174931 | 3300025919 | Bacteria | 1738 |
| 309 | Ga0207657_10240584 | 3300025919 | Bacteria | 1445 |
| 310 | Ga0207649_10012535 | 3300025920 | Bacteria | 4707 |
| 311 | Ga0207649_10049759 | 3300025920 | Bacteria | 2590 |
| 312 | Ga0207649_10054438 | 3300025920 | Bacteria | 2490 |
| 313 | Ga0207649_10081183 | 3300025920 | Bacteria | 2099 |
| 314 | Ga0207649_10189677 | 3300025920 | Bacteria | 1445 |
| 315 | Ga0207649_10194158 | 3300025920 | Bacteria | 1430 |
| 316 | Ga0207649_10224026 | 3300025920 | Bacteria | 1341 |
| 317 | Ga0207649_10227042 | 3300025920 | Bacteria | 1333 |
| 318 | Ga0207649_10340610 | 3300025920 | Bacteria | 1107 |
| 319 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 320 | Ga0207652_10009794 | 3300025921 | Bacteria | 7714 |
| 321 | Ga0207652_10579561 | 3300025921 | Bacteria | 1007 |
| 322 | Ga0207694_10024170 | 3300025924 | Bacteria | 4614 |
| 323 | Ga0207694_10569298 | 3300025924 | Bacteria | 952 |
| 324 | Ga0207650_10005864 | 3300025925 | Bacteria | 8386 |
| 325 | Ga0207650_10052898 | 3300025925 | Bacteria | 3009 |
| 326 | Ga0207659_10163770 | 3300025926 | Bacteria | 1748 |
| 327 | Ga0207687_10399981 | 3300025927 | Bacteria | 1129 |
| 328 | Ga0207687_10406899 | 3300025927 | Bacteria | 1120 |
| 329 | Ga0207700_11114265 | 3300025928 | Bacteria | 706 |
| 330 | Ga0207700_11267147 | 3300025928 | Unclassified | 657 |
| 331 | Ga0207664_10434529 | 3300025929 | Bacteria | 1170 |
| 332 | Ga0207664_10647739 | 3300025929 | Bacteria | 949 |
| 333 | Ga0207644_10000614 | 3300025931 | Bacteria | 22677 |
| 334 | Ga0207644_10006207 | 3300025931 | Bacteria | 7793 |
| 335 | Ga0207644_10017567 | 3300025931 | Bacteria | 4835 |
| 336 | Ga0207644_10051182 | 3300025931 | Bacteria | 2964 |
| 337 | Ga0207644_10092846 | 3300025931 | Bacteria | 2252 |
| 338 | Ga0207644_10629129 | 3300025931 | Bacteria | 892 |
| 339 | Ga0207690_10004475 | 3300025932 | Bacteria | 8254 |
| 340 | Ga0207690_10029270 | 3300025932 | Bacteria | 3499 |
| 341 | Ga0207690_10292984 | 3300025932 | Bacteria | 1271 |
| 342 | Ga0207690_10678778 | 3300025932 | Bacteria | 846 |
| 343 | Ga0207706_10068152 | 3300025933 | Bacteria | 3131 |
| 344 | Ga0207706_10078243 | 3300025933 | Bacteria | 2908 |
| 345 | Ga0207706_10078803 | 3300025933 | Bacteria | 2897 |
| 346 | Ga0207706_10308681 | 3300025933 | Bacteria | 1378 |
| 347 | Ga0207669_10145946 | 3300025937 | Bacteria | 1650 |
| 348 | Ga0207669_10157753 | 3300025937 | Bacteria | 1598 |
| 349 | Ga0207704_10535421 | 3300025938 | Bacteria | 950 |
| 350 | Ga0207704_10566616 | 3300025938 | Bacteria | 925 |
| 351 | Ga0207691_10021942 | 3300025940 | Bacteria | 6024 |
| 352 | Ga0207691_10031381 | 3300025940 | Bacteria | 4960 |
| 353 | Ga0207691_10200721 | 3300025940 | Bacteria | 1736 |
| 354 | Ga0207691_10202556 | 3300025940 | Bacteria | 1727 |
| 355 | Ga0207691_10301247 | 3300025940 | Bacteria | 1377 |
| 356 | Ga0207711_10000617 | 3300025941 | Bacteria | 35805 |
| 357 | Ga0207711_10006917 | 3300025941 | Bacteria | 9525 |
| 358 | Ga0207711_10007240 | 3300025941 | Bacteria | 9299 |
| 359 | Ga0207711_10011304 | 3300025941 | Bacteria | 7417 |
| 360 | Ga0207711_10020622 | 3300025941 | Bacteria | 5500 |
| 361 | Ga0207711_10033837 | 3300025941 | Bacteria | 4326 |
| 362 | Ga0207711_10045504 | 3300025941 | Bacteria | 3750 |
| 363 | Ga0207711_10062395 | 3300025941 | Bacteria | 3215 |
| 364 | Ga0207711_10167201 | 3300025941 | Bacteria | 1994 |
| 365 | Ga0207661_10009979 | 3300025944 | Bacteria | 6823 |
| 366 | Ga0207661_10013875 | 3300025944 | Bacteria | 5888 |
| 367 | Ga0207661_10074814 | 3300025944 | Bacteria | 2777 |
| 368 | Ga0207661_10084310 | 3300025944 | Bacteria | 2631 |
| 369 | Ga0207661_10223204 | 3300025944 | Bacteria | 1666 |
| 370 | Ga0207661_10357131 | 3300025944 | Bacteria | 1319 |
| 371 | Ga0207679_10197601 | 3300025945 | Bacteria | 1677 |
| 372 | Ga0207667_10004710 | 3300025949 | Bacteria | 16697 |
| 373 | Ga0207667_10049976 | 3300025949 | Bacteria | 4413 |
| 374 | Ga0207667_10056357 | 3300025949 | Bacteria | 4129 |
| 375 | Ga0207667_10087521 | 3300025949 | Bacteria | 3222 |
| 376 | Ga0207667_10139171 | 3300025949 | Bacteria | 2499 |
| 377 | Ga0207667_10151223 | 3300025949 | Bacteria | 2389 |
| 378 | Ga0207651_10029038 | 3300025960 | Bacteria | 3498 |
| 379 | Ga0207651_10070728 | 3300025960 | Bacteria | 2470 |
| 380 | Ga0207651_10136569 | 3300025960 | Bacteria | 1887 |
| 381 | Ga0207651_10501556 | 3300025960 | Bacteria | 1049 |
| 382 | Ga0207651_10522805 | 3300025960 | Bacteria | 1028 |
| 383 | Ga0207640_10109202 | 3300025981 | Bacteria | 1957 |
| 384 | Ga0207640_10880080 | 3300025981 | Bacteria | 781 |
| 385 | Ga0207640_11408518 | 3300025981 | Unclassified | 625 |
| 386 | Ga0207658_10084342 | 3300025986 | Bacteria | 2444 |
| 387 | Ga0207658_10392824 | 3300025986 | Bacteria | 1217 |
| 388 | Ga0207658_10588695 | 3300025986 | Bacteria | 998 |
| 389 | Ga0207677_10006373 | 3300026023 | Bacteria | 6471 |
| 390 | Ga0207677_10371048 | 3300026023 | Bacteria | 1205 |
| 391 | Ga0207677_10484598 | 3300026023 | Bacteria | 1066 |
| 392 | Ga0207703_10249409 | 3300026035 | Bacteria | 1599 |
| 393 | Ga0207639_10000923 | 3300026041 | Bacteria | 19909 |
| 394 | Ga0207639_10001159 | 3300026041 | Bacteria | 17877 |
| 395 | Ga0207639_10006431 | 3300026041 | Bacteria | 7988 |
| 396 | Ga0207639_10049640 | 3300026041 | Bacteria | 3183 |
| 397 | Ga0207639_10112941 | 3300026041 | Bacteria | 2218 |
| 398 | Ga0207639_10278547 | 3300026041 | Bacteria | 1470 |
| 399 | Ga0207639_10542721 | 3300026041 | Bacteria | 1067 |
| 400 | Ga0207678_10001315 | 3300026067 | Bacteria | 22977 |
| 401 | Ga0207678_10015007 | 3300026067 | Bacteria | 6816 |
| 402 | Ga0207678_10017638 | 3300026067 | Bacteria | 6266 |
| 403 | Ga0207702_10002063 | 3300026078 | Bacteria | 19455 |
| 404 | Ga0207702_10037780 | 3300026078 | Bacteria | 4043 |
| 405 | Ga0207702_10082186 | 3300026078 | Bacteria | 2800 |
| 406 | Ga0207702_10207176 | 3300026078 | Bacteria | 1821 |
| 407 | Ga0207702_10299371 | 3300026078 | Bacteria | 1526 |
| 408 | Ga0207702_10896867 | 3300026078 | Bacteria | 878 |
| 409 | Ga0207641_10003063 | 3300026088 | Bacteria | 15070 |
| 410 | Ga0207648_10059945 | 3300026089 | Bacteria | 3319 |
| 411 | Ga0207676_10001223 | 3300026095 | Bacteria | 19146 |
| 412 | Ga0207674_10019569 | 3300026116 | Bacteria | 7331 |
| 413 | Ga0207674_10095577 | 3300026116 | Bacteria | 2957 |
| 414 | Ga0207674_10118695 | 3300026116 | Bacteria | 2615 |
| 415 | Ga0207674_10137434 | 3300026116 | Bacteria | 2405 |
| 416 | Ga0207674_10189915 | 3300026116 | Bacteria | 2004 |
| 417 | Ga0207674_10609387 | 3300026116 | Bacteria | 1055 |
| 418 | Ga0207683_10049845 | 3300026121 | Bacteria | 3666 |
| 419 | Ga0207683_10473012 | 3300026121 | Bacteria | 1156 |
| 420 | Ga0207683_10554350 | 3300026121 | Bacteria | 1063 |
| 421 | Ga0207698_10000896 | 3300026142 | Bacteria | 17309 |
| 422 | Ga0207698_10006766 | 3300026142 | Bacteria | 7163 |
| 423 | Ga0207698_10008977 | 3300026142 | Bacteria | 6344 |
| 424 | Ga0207698_10115877 | 3300026142 | Bacteria | 2257 |
| 425 | Ga0207698_10325580 | 3300026142 | Bacteria | 1441 |
| 426 | Ga0207698_10414127 | 3300026142 | Bacteria | 1291 |
| 427 | Ga0207698_10490829 | 3300026142 | Bacteria | 1193 |
| 428 | Ga0207698_11253623 | 3300026142 | Bacteria | 756 |
| 429 | Ga0207698_12010683 | 3300026142 | Unclassified | 592 |
| 430 | Ga0268266_10319165 | 3300028379 | Bacteria | 1453 |
| 431 | Ga0268266_10744688 | 3300028379 | Bacteria | 945 |
| 432 | Ga0268265_10179851 | 3300028380 | Bacteria | 1816 |
| 433 | Ga0268264_10203575 | 3300028381 | Bacteria | 1812 |
| 434 | Ga0307405_10347022 | 3300031731 | Bacteria | 1143 |
| 435 | Ga0307413_10251110 | 3300031824 | Bacteria | 1312 |
| 436 | Ga0307413_10501615 | 3300031824 | Bacteria | 974 |
| 437 | Ga0307410_10102566 | 3300031852 | Bacteria | 2053 |
| 438 | Ga0307410_10144957 | 3300031852 | Bacteria | 1761 |
| 439 | Ga0307410_10158828 | 3300031852 | Bacteria | 1691 |
| 440 | Ga0307406_10421097 | 3300031901 | Bacteria | 1064 |
| 441 | Ga0307407_10015582 | 3300031903 | Bacteria | 3764 |
| 442 | Ga0307407_10085950 | 3300031903 | Bacteria | 1915 |
| 443 | Ga0307412_10061430 | 3300031911 | Bacteria | 2526 |
| 444 | Ga0307412_10260600 | 3300031911 | Bacteria | 1351 |
| 445 | Ga0307412_10696304 | 3300031911 | Bacteria | 871 |
| 446 | Ga0307409_100031807 | 3300031995 | Bacteria | 3815 |
| 447 | Ga0307409_100149142 | 3300031995 | Bacteria | 2028 |
| 448 | Ga0307416_100004552 | 3300032002 | Bacteria | 8377 |
| 449 | Ga0307416_100030216 | 3300032002 | Bacteria | 4062 |
| 450 | Ga0307416_100276544 | 3300032002 | Bacteria | 1652 |
| 451 | Ga0307416_101247515 | 3300032002 | Bacteria | 849 |
| 452 | Ga0307414_10179571 | 3300032004 | Bacteria | 1701 |
| 453 | Ga0307414_10209728 | 3300032004 | Bacteria | 1591 |
| 454 | Ga0307414_10366977 | 3300032004 | Bacteria | 1240 |
| 455 | Ga0307411_10026146 | 3300032005 | Bacteria | 3510 |
| 456 | Ga0307411_10071637 | 3300032005 | Bacteria | 2350 |
| 457 | Ga0307411_10158493 | 3300032005 | Bacteria | 1691 |
| 458 | Ga0307411_10632101 | 3300032005 | Bacteria | 924 |
| 459 | Ga0307415_100016305 | 3300032126 | Bacteria | 4426 |
| 460 | Ga0307415_100159749 | 3300032126 | Bacteria | 1745 |
| 461 | Ga0307415_100179507 | 3300032126 | Bacteria | 1659 |
| 462 | Ga0307415_100784867 | 3300032126 | Bacteria | 868 |
| 463 | Ga0373923_0027553 | 3300035111 | Bacteria | 2268 |
| 464 | Ga0373923_0330748 | 3300035111 | Bacteria | 725 |
| 465 | Ga0373936_0353480 | 3300035113 | Unclassified | 669 |
| 466 | Ga0373941_0173760 | 3300035115 | Bacteria | 804 |
| 467 | Ga0373954_0033151 | 3300035118 | Bacteria | 2389 |
| 468 | Ga0373943_0016672 | 3300035170 | Bacteria | 3353 |
| 469 | Ga0373943_0148768 | 3300035170 | Bacteria | 1267 |
| 470 | Ga0373946_0066336 | 3300035171 | Bacteria | 1547 |
| 471 | Ga0373955_0002727 | 3300035172 | Bacteria | 7737 |
| 472 | Ga0373931_1027412 | 3300035691 | Unclassified | 559 |
| 473 | Ga0373935_0018058 | 3300035692 | Bacteria | 4288 |
| 474 | Ga0373927_0093144 | 3300035695 | Bacteria | 1957 |
| 475 | Ga0373947_0316112 | 3300035725 | Bacteria | 1043 |
| 476 | Ga0373937_0010753 | 3300036401 | Bacteria | 8007 |
| 477 | Ga0373937_0222036 | 3300036401 | Bacteria | 1779 |
| 478 | Ga0373925_0010397 | 3300037068 | Bacteria | 6751 |
| 479 | Ga0373925_0332683 | 3300037068 | Bacteria | 1231 |
| 480 | Ga0395899_0014277 | 3300037312 | Bacteria | 6064 |
| 481 | Ga0395899_0072949 | 3300037312 | Bacteria | 2511 |
| 482 | Ga0395899_0084671 | 3300037312 | Bacteria | 2305 |
| 483 | Ga0395899_0118898 | 3300037312 | Bacteria | 1895 |
| 484 | Ga0395899_0130064 | 3300037312 | Bacteria | 1798 |
| 485 | Ga0395899_0139822 | 3300037312 | Unclassified | 1723 |
| 486 | Ga0395899_0147116 | 3300037312 | Bacteria | 1672 |
| 487 | Ga0395899_0306411 | 3300037312 | Bacteria | 1073 |
| 488 | Ga0395899_0375049 | 3300037312 | Bacteria | 946 |
| 489 | Ga0395899_0403037 | 3300037312 | Bacteria | 904 |
| 490 | Ga0395899_0411002 | 3300037312 | Bacteria | 893 |
| 491 | Ga0395899_0434941 | 3300037312 | Bacteria | 862 |
| 492 | Ga0395899_0660779 | 3300037312 | Bacteria | 659 |
| 493 | Ga0395900_0001779 | 3300037418 | Bacteria | 24718 |
| 494 | Ga0395900_0003085 | 3300037418 | Bacteria | 18103 |
| 495 | Ga0395900_0009276 | 3300037418 | Bacteria | 10089 |
| 496 | Ga0395900_0010484 | 3300037418 | Bacteria | 9479 |
| 497 | Ga0395900_0033740 | 3300037418 | Bacteria | 5267 |
| 498 | Ga0395900_0040236 | 3300037418 | Bacteria | 4817 |
| 499 | Ga0395900_0041814 | 3300037418 | Bacteria | 4723 |
| 500 | Ga0395900_0060815 | 3300037418 | Bacteria | 3885 |
| 501 | Ga0395900_0073712 | 3300037418 | Bacteria | 3510 |
| 502 | Ga0395900_0149524 | 3300037418 | Bacteria | 2386 |
| 503 | Ga0395900_0198322 | 3300037418 | Bacteria | 2032 |
| 504 | Ga0395900_0265514 | 3300037418 | Bacteria | 1712 |
| 505 | Ga0395900_0546719 | 3300037418 | Bacteria | 1103 |
| 506 | Ga0395900_0675836 | 3300037418 | Bacteria | 967 |
| 507 | Ga0395900_0679881 | 3300037418 | Bacteria | 964 |
| 508 | Ga0395900_0754379 | 3300037418 | Bacteria | 903 |
| 509 | Ga0395900_0778836 | 3300037418 | Bacteria | 885 |
| 510 | Ga0395900_1468576 | 3300037418 | Unclassified | 594 |
| 511 | Ga0395898_0011721 | 3300037466 | Bacteria | 9089 |
| 512 | Ga0395898_0021270 | 3300037466 | Bacteria | 6579 |
| 513 | Ga0395898_0052037 | 3300037466 | Bacteria | 4002 |
| 514 | Ga0395898_0142823 | 3300037466 | Bacteria | 2292 |
| 515 | Ga0395898_0154726 | 3300037466 | Bacteria | 2193 |
| 516 | Ga0395898_0277996 | 3300037466 | Bacteria | 1597 |
| 517 | Ga0395898_0379279 | 3300037466 | Bacteria | 1348 |
| 518 | Ga0395898_0500232 | 3300037466 | Bacteria | 1156 |
| 519 | Ga0395898_0986595 | 3300037466 | Bacteria | 778 |
| 520 | Ga0395905_0000104 | 3300037471 | Bacteria | 141965 |
| 521 | Ga0395905_0004102 | 3300037471 | Bacteria | 15259 |
| 522 | Ga0395905_0008256 | 3300037471 | Bacteria | 10285 |
| 523 | Ga0395905_0023579 | 3300037471 | Bacteria | 5813 |
| 524 | Ga0395905_0029447 | 3300037471 | Bacteria | 5172 |
| 525 | Ga0395905_0034571 | 3300037471 | Bacteria | 4746 |
| 526 | Ga0395905_0036894 | 3300037471 | Bacteria | 4591 |
| 527 | Ga0395905_0037718 | 3300037471 | Bacteria | 4535 |
| 528 | Ga0395905_0045504 | 3300037471 | Bacteria | 4116 |
| 529 | Ga0395905_0085043 | 3300037471 | Bacteria | 2964 |
| 530 | Ga0395905_0086007 | 3300037471 | Bacteria | 2946 |
| 531 | Ga0395905_0094163 | 3300037471 | Bacteria | 2810 |
| 532 | Ga0395905_0208860 | 3300037471 | Bacteria | 1830 |
| 533 | Ga0395905_0244205 | 3300037471 | Bacteria | 1677 |
| 534 | Ga0395905_0282967 | 3300037471 | Bacteria | 1544 |
| 535 | Ga0395905_0423000 | 3300037471 | Bacteria | 1228 |
| 536 | Ga0395905_0478805 | 3300037471 | Bacteria | 1144 |
| 537 | Ga0395905_0517012 | 3300037471 | Bacteria | 1094 |
| 538 | Ga0395905_0569978 | 3300037471 | Bacteria | 1033 |
| 539 | Ga0395905_0647674 | 3300037471 | Bacteria | 958 |
| 540 | Ga0395905_0700970 | 3300037471 | Bacteria | 915 |
| 541 | Ga0395905_0729105 | 3300037471 | Bacteria | 893 |
| 542 | Ga0395905_1142279 | 3300037471 | Bacteria | 682 |
| 543 | Ga0436364_1387927 | 3300037853 | Bacteria | 27679 |
| 544 | Ga0395901_0000589 | 3300038443 | Bacteria | 42319 |
| 545 | Ga0395901_0000782 | 3300038443 | Bacteria | 35570 |
| 546 | Ga0395901_0103175 | 3300038443 | Bacteria | 2992 |
| 547 | Ga0395901_0113729 | 3300038443 | Bacteria | 2842 |
| 548 | Ga0395901_0131734 | 3300038443 | Bacteria | 2627 |
| 549 | Ga0395901_0247424 | 3300038443 | Bacteria | 1858 |
| 550 | Ga0395901_0262712 | 3300038443 | Bacteria | 1796 |
| 551 | Ga0395901_0296008 | 3300038443 | Bacteria | 1678 |
| 552 | Ga0395901_0358393 | 3300038443 | Bacteria | 1504 |
| 553 | Ga0395901_0492497 | 3300038443 | Bacteria | 1249 |
| 554 | Ga0395901_0514093 | 3300038443 | Bacteria | 1217 |
| 555 | Ga0395901_0827968 | 3300038443 | Bacteria | 912 |
| 556 | Ga0395901_0905836 | 3300038443 | Bacteria | 863 |
| 557 | Ga0439465_0022888 | 3300041413 | Bacteria | 1964 |
| 558 | Ga0439432_024907 | 3300042006 | Bacteria | 1965 |
| 559 | Ga0439449_0043119 | 3300042007 | Bacteria | 1675 |
| 560 | Ga0439458_0000590 | 3300042157 | Bacteria | 9358 |
| 561 | Ga0466972_0005975 | 3300044658 | Bacteria | 6113 |
| 562 | Ga0466972_0057561 | 3300044658 | Bacteria | 1867 |
| 563 | Ga0466972_0073628 | 3300044658 | Bacteria | 1628 |
| 564 | Ga0466972_0316434 | 3300044658 | Bacteria | 729 |
| 565 | Ga0466965_0156053 | 3300044683 | Bacteria | 1195 |
| 566 | Ga0466961_0149153 | 3300044693 | Bacteria | 1461 |
| 567 | Ga0466961_0307191 | 3300044693 | Bacteria | 968 |
| 568 | Ga0466961_0329009 | 3300044693 | Bacteria | 931 |
| 569 | Ga0466961_0490775 | 3300044693 | Bacteria | 742 |
| 570 | Ga0466963_0010178 | 3300044694 | Bacteria | 5686 |
| 571 | Ga0466963_0010200 | 3300044694 | Bacteria | 5681 |
| 572 | Ga0466963_0073140 | 3300044694 | Bacteria | 2310 |
| 573 | Ga0466963_0246625 | 3300044694 | Bacteria | 1253 |
| 574 | Ga0466963_0304119 | 3300044694 | Bacteria | 1122 |
| 575 | Ga0466963_0422153 | 3300044694 | Bacteria | 940 |
| 576 | Ga0466963_0581271 | 3300044694 | Bacteria | 791 |
| 577 | Ga0466964_0151035 | 3300044706 | Bacteria | 1077 |
| 578 | Ga0466964_0155698 | 3300044706 | Bacteria | 1063 |
| 579 | Ga0466971_0018356 | 3300044719 | Bacteria | 3098 |
| 580 | Ga0466971_0213122 | 3300044719 | Bacteria | 914 |
| 581 | Ga0466971_0310596 | 3300044719 | Bacteria | 758 |
| 582 | Ga0466968_0246394 | 3300044735 | Bacteria | 848 |
| 583 | Ga0466957_0039900 | 3300044842 | Bacteria | 2834 |
| 584 | Ga0466957_0113584 | 3300044842 | Bacteria | 1720 |
| 585 | Ga0466957_0184562 | 3300044842 | Bacteria | 1363 |
| 586 | Ga0466957_0274535 | 3300044842 | Bacteria | 1126 |
| 587 | Ga0466957_0346149 | 3300044842 | Bacteria | 1007 |
| 588 | Ga0466957_0390324 | 3300044842 | Bacteria | 950 |
| 589 | Ga0466957_0588571 | 3300044842 | Bacteria | 778 |
| 590 | Ga0466957_0653508 | 3300044842 | Bacteria | 739 |
| 591 | Ga0466960_0047367 | 3300044901 | Bacteria | 2061 |
| 592 | Ga0466959_0219829 | 3300045049 | Bacteria | 1318 |
| 593 | Ga0466959_0480705 | 3300045049 | Bacteria | 841 |
| 594 | Ga0466958_0014825 | 3300045836 | Bacteria | 4456 |
| 595 | Ga0466958_0028552 | 3300045836 | Bacteria | 3308 |
| 596 | Ga0466958_0032340 | 3300045836 | Bacteria | 3112 |
| 597 | Ga0466958_0202812 | 3300045836 | Bacteria | 1262 |
| 598 | Ga0466958_0217883 | 3300045836 | Bacteria | 1217 |
| 599 | Ga0466958_0282868 | 3300045836 | Bacteria | 1063 |
| 600 | Ga0466967_0006997 | 3300045976 | Bacteria | 8072 |
| 601 | Ga0466967_0020005 | 3300045976 | Bacteria | 5398 |
| 602 | Ga0466967_0088576 | 3300045976 | Bacteria | 2809 |
| 603 | Ga0466967_0096507 | 3300045976 | Bacteria | 2696 |
| 604 | Ga0466967_0131886 | 3300045976 | Bacteria | 2320 |
| 605 | Ga0466967_0210613 | 3300045976 | Bacteria | 1843 |
| 606 | Ga0466967_0247910 | 3300045976 | Bacteria | 1700 |
| 607 | Ga0466967_0249305 | 3300045976 | Bacteria | 1696 |
| 608 | Ga0466967_0263869 | 3300045976 | Bacteria | 1648 |
| 609 | Ga0466967_0297358 | 3300045976 | Bacteria | 1552 |
| 610 | Ga0466967_0813755 | 3300045976 | Bacteria | 928 |
| 611 | Ga0466967_0820870 | 3300045976 | Bacteria | 923 |
| 612 | Ga0466967_0893570 | 3300045976 | Bacteria | 883 |
| 613 | Ga0466967_1531166 | 3300045976 | Bacteria | 664 |
| 614 | Ga0495650_0152204 | 3300046471 | Bacteria | 830 |
| 615 | Ga0495631_0230384 | 3300046518 | Unclassified | 790 |
| 616 | Ga0495663_0011260 | 3300046525 | Bacteria | 2490 |
| 617 | Ga0495663_0031760 | 3300046525 | Bacteria | 1570 |
| 618 | Ga0495621_0000972 | 3300046539 | Bacteria | 7305 |
| 619 | Ga0495633_0113394 | 3300046558 | Bacteria | 1257 |
| 620 | Ga0495668_0011856 | 3300046616 | Bacteria | 5196 |
| 621 | Ga0495623_0019538 | 3300046679 | Bacteria | 4378 |
| 622 | Ga0495647_0348113 | 3300046681 | Bacteria | 674 |
| 623 | Ga0495669_0057703 | 3300046684 | Bacteria | 1752 |
| 624 | Ga0495669_0387596 | 3300046684 | Bacteria | 676 |
| 625 | Ga0495670_0000071 | 3300046691 | Bacteria | 45180 |
| 626 | Ga0495677_0087929 | 3300047445 | Bacteria | 1169 |
| 627 | Ga0495602_0091257 | 3300048088 | Bacteria | 2527 |
| 628 | Ga0496101_0010849 | 3300048904 | Bacteria | 6027 |
| 629 | Ga0496101_0457142 | 3300048904 | Bacteria | 1007 |
| 630 | Ga0496102_0346638 | 3300048905 | Bacteria | 1398 |
| 631 | Ga0496102_0366584 | 3300048905 | Bacteria | 1356 |
| 632 | Ga0496104_0137509 | 3300048907 | Bacteria | 2347 |
| 633 | Ga0496105_0182962 | 3300048908 | Bacteria | 1715 |
| 634 | Ga0496106_0082568 | 3300048909 | Bacteria | 2470 |
| 635 | Ga0496106_0130672 | 3300048909 | Bacteria | 1969 |
| 636 | Ga0496107_0002900 | 3300048910 | Bacteria | 11331 |
| 637 | Ga0496107_0011494 | 3300048910 | Bacteria | 6167 |
| 638 | Ga0496107_0131555 | 3300048910 | Bacteria | 1847 |
| 639 | Ga0496108_0045905 | 3300048911 | Bacteria | 3649 |
| 640 | Ga0496108_0515020 | 3300048911 | Bacteria | 1044 |
| 641 | Ga0496109_0046481 | 3300048912 | Bacteria | 3943 |
| 642 | Ga0496109_0061186 | 3300048912 | Bacteria | 3441 |
| 643 | Ga0496109_0068968 | 3300048912 | Bacteria | 3241 |
| 644 | Ga0496109_0467267 | 3300048912 | Bacteria | 1191 |
| 645 | Ga0496109_0794783 | 3300048912 | Bacteria | 884 |
| 646 | Ga0496110_0025175 | 3300048913 | Bacteria | 5083 |
| 647 | Ga0496110_0033905 | 3300048913 | Bacteria | 4418 |
| 648 | Ga0496110_0042482 | 3300048913 | Bacteria | 3968 |
| 649 | Ga0496110_0184234 | 3300048913 | Bacteria | 1896 |
| 650 | Ga0496110_0881018 | 3300048913 | Bacteria | 801 |
| 651 | Ga0496111_0002376 | 3300048914 | Bacteria | 11340 |
| 652 | Ga0496111_0029259 | 3300048914 | Bacteria | 3911 |
| 653 | Ga0496112_0040418 | 3300048915 | Bacteria | 4559 |
| 654 | Ga0496112_0068145 | 3300048915 | Bacteria | 3514 |
| 655 | Ga0496112_0143489 | 3300048915 | Bacteria | 2356 |
| 656 | Ga0496112_0443531 | 3300048915 | Bacteria | 1236 |
| 657 | Ga0496113_0010921 | 3300048916 | Bacteria | 6028 |
| 658 | Ga0496113_0011965 | 3300048916 | Bacteria | 5816 |
| 659 | Ga0496113_0054432 | 3300048916 | Bacteria | 2996 |
| 660 | Ga0496114_0058951 | 3300048917 | Bacteria | 3206 |
| 661 | Ga0496115_0088057 | 3300048918 | Bacteria | 2534 |
| 662 | Ga0501202_058311 | 3300049652 | Bacteria | 868 |
| 663 | Ga0501207_019395 | 3300049654 | Bacteria | 1078 |
| 664 | Ga0501217_067111 | 3300049661 | Bacteria | 969 |
| 665 | Ga0501223_035357 | 3300049663 | Bacteria | 972 |
| 666 | Ga0501233_005985 | 3300049668 | Bacteria | 2272 |
| 667 | Ga0501235_008407 | 3300049669 | Bacteria | 2252 |
| 668 | Ga0501239_006071 | 3300049672 | Bacteria | 1232 |
| 669 | Ga0501247_027531 | 3300049677 | Bacteria | 763 |
| 670 | Ga0501249_018314 | 3300049679 | Bacteria | 1514 |
| 671 | Ga0501258_004127 | 3300049687 | Bacteria | 1362 |
| 672 | Ga0501221_009102 | 3300049704 | Bacteria | 1738 |
| 673 | Ga0501229_020960 | 3300049706 | Bacteria | 866 |
| 674 | Ga0501268_000532 | 3300049765 | Bacteria | 4191 |
| 675 | Ga0501272_001757 | 3300049769 | Bacteria | 2098 |
| 676 | Ga0501273_010041 | 3300049770 | Bacteria | 1158 |
| 677 | Ga0500658_0000036 | 3300053134 | Bacteria | 85304 |
| 678 | Ga0587066_046458 | 3300059490 | Bacteria | 838 |
| 679 | Ga0587080_010228 | 3300059503 | Bacteria | 1380 |
| 680 | Ga0587090_010448 | 3300059510 | Unclassified | 1287 |
| 681 | Ga0587128_026224 | 3300059630 | Bacteria | 933 |
| 682 | Ga0587075_016693 | 3300059644 | Bacteria | 1047 |
| 683 | Ga0587079_075714 | 3300059647 | Bacteria | 760 |
| 684 | Ga0466962_0006344 | 3300061719 | Bacteria | 5677 |
| 685 | Ga0466962_0015820 | 3300061719 | Bacteria | 3640 |
| 686 | Ga0466962_0120036 | 3300061719 | Bacteria | 1268 |
| 687 | Ga0466962_0330471 | 3300061719 | Unclassified | 757 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025927 | Ga0207687_10406899 | Ga0207687_104068992 | 118 |
| 2 | 3300005335 | Ga0070666_10053690 | Ga0070666_100536903 | 134 |
| 3 | 3300025941 | Ga0207711_10007240 | Ga0207711_100072408 | 134 |
| 4 | 3300025941 | Ga0207711_10020622 | Ga0207711_100206223 | 134 |
| 5 | 3300025903 | Ga0207680_10331744 | Ga0207680_103317442 | 138 |
| 6 | 3300025907 | Ga0207645_10038053 | Ga0207645_100380532 | 138 |
| 7 | 3300025921 | Ga0207652_10579561 | Ga0207652_105795612 | 138 |
| 8 | 3300025931 | Ga0207644_10629129 | Ga0207644_106291292 | 138 |
| 9 | 3300025933 | Ga0207706_10308681 | Ga0207706_103086812 | 138 |
| 10 | 3300026142 | Ga0207698_10325580 | Ga0207698_103255801 | 138 |
| 11 | 3300025941 | Ga0207711_10006917 | Ga0207711_100069175 | 147 |
| 12 | 3300048904 | Ga0496101_0010849 | Ga0496101_0010849_5481_6005 | 147 |
| 13 | 3300025931 | Ga0207644_10017567 | Ga0207644_100175675 | 149 |
| 14 | 3300048909 | Ga0496106_0130672 | Ga0496106_0130672_178_702 | 149 |
| 15 | 3300048910 | Ga0496107_0002900 | Ga0496107_0002900_3212_3736 | 149 |
| 16 | 3300048917 | Ga0496114_0058951 | Ga0496114_0058951_1932_2456 | 149 |
| 17 | 3300048918 | Ga0496115_0088057 | Ga0496115_0088057_812_1336 | 149 |
| 18 | 3300005334 | Ga0068869_100646279 | Ga0068869_1006462791 | 150 |
| 19 | 3300005338 | Ga0068868_100074382 | Ga0068868_1000743823 | 150 |
| 20 | 3300005355 | Ga0070671_100223230 | Ga0070671_1002232302 | 150 |
| 21 | 3300005356 | Ga0070674_100198542 | Ga0070674_1001985422 | 150 |
| 22 | 3300005356 | Ga0070674_100263739 | Ga0070674_1002637392 | 150 |
| 23 | 3300005364 | Ga0070673_100230514 | Ga0070673_1002305142 | 150 |
| 24 | 3300005367 | Ga0070667_100056858 | Ga0070667_1000568585 | 150 |
| 25 | 3300005543 | Ga0070672_100563974 | Ga0070672_1005639742 | 150 |
| 26 | 3300005617 | Ga0068859_100437124 | Ga0068859_1004371242 | 150 |
| 27 | 3300005718 | Ga0068866_10061662 | Ga0068866_100616622 | 150 |
| 28 | 3300005842 | Ga0068858_100013510 | Ga0068858_1000135103 | 150 |
| 29 | 3300006931 | Ga0097620_100437147 | Ga0097620_1004371472 | 150 |
| 30 | 3300009098 | Ga0105245_10611651 | Ga0105245_106116512 | 150 |
| 31 | 3300025904 | Ga0207647_10010648 | Ga0207647_100106482 | 150 |
| 32 | 3300025927 | Ga0207687_10399981 | Ga0207687_103999812 | 150 |
| 33 | 3300025931 | Ga0207644_10051182 | Ga0207644_100511824 | 150 |
| 34 | 3300025937 | Ga0207669_10157753 | Ga0207669_101577532 | 150 |
| 35 | 3300025940 | Ga0207691_10200721 | Ga0207691_102007212 | 150 |
| 36 | 3300025940 | Ga0207691_10301247 | Ga0207691_103012471 | 150 |
| 37 | 3300025960 | Ga0207651_10136569 | Ga0207651_101365693 | 150 |
| 38 | 3300025960 | Ga0207651_10501556 | Ga0207651_105015562 | 150 |
| 39 | 3300026023 | Ga0207677_10006373 | Ga0207677_100063738 | 150 |
| 40 | 3300026023 | Ga0207677_10484598 | Ga0207677_104845982 | 150 |
| 41 | 3300036401 | Ga0373937_0222036 | Ga0373937_0222036_709_1236 | 150 |
| 42 | 3300037312 | Ga0395899_0147116 | Ga0395899_0147116_822_1376 | 150 |
| 43 | 3300037418 | Ga0395900_0073712 | Ga0395900_0073712_512_1066 | 150 |
| 44 | 3300037466 | Ga0395898_0277996 | Ga0395898_0277996_479_1033 | 150 |
| 45 | 3300038443 | Ga0395901_0296008 | Ga0395901_0296008_728_1282 | 150 |
| 46 | 3300046518 | Ga0495631_0230384 | Ga0495631_0230384_225_752 | 150 |
| 47 | 3300046525 | Ga0495663_0031760 | Ga0495663_0031760_41_568 | 150 |
| 48 | 3300046539 | Ga0495621_0000972 | Ga0495621_0000972_1946_2473 | 150 |
| 49 | 3300046558 | Ga0495633_0113394 | Ga0495633_0113394_161_688 | 150 |
| 50 | 3300046691 | Ga0495670_0000071 | Ga0495670_0000071_33132_33659 | 150 |
| 51 | 3300048912 | Ga0496109_0794783 | Ga0496109_0794783_19_546 | 150 |
| 52 | 3300005328 | Ga0070676_10396100 | Ga0070676_103961001 | 151 |
| 53 | 3300005330 | Ga0070690_100604591 | Ga0070690_1006045912 | 151 |
| 54 | 3300005335 | Ga0070666_10241481 | Ga0070666_102414812 | 151 |
| 55 | 3300005338 | Ga0068868_100335976 | Ga0068868_1003359762 | 151 |
| 56 | 3300005354 | Ga0070675_100354570 | Ga0070675_1003545702 | 151 |
| 57 | 3300005356 | Ga0070674_100402675 | Ga0070674_1004026752 | 151 |
| 58 | 3300005364 | Ga0070673_100895869 | Ga0070673_1008958692 | 151 |
| 59 | 3300005367 | Ga0070667_100405460 | Ga0070667_1004054602 | 151 |
| 60 | 3300005456 | Ga0070678_100031044 | Ga0070678_1000310442 | 151 |
| 61 | 3300005457 | Ga0070662_100359996 | Ga0070662_1003599962 | 151 |
| 62 | 3300005543 | Ga0070672_100387372 | Ga0070672_1003873722 | 151 |
| 63 | 3300005548 | Ga0070665_100040150 | Ga0070665_1000401502 | 151 |
| 64 | 3300005616 | Ga0068852_101629976 | Ga0068852_1016299761 | 151 |
| 65 | 3300006237 | Ga0097621_101112956 | Ga0097621_1011129561 | 151 |
| 66 | 3300009177 | Ga0105248_11141514 | Ga0105248_111415142 | 151 |
| 67 | 3300014969 | Ga0157376_10338846 | Ga0157376_103388462 | 151 |
| 68 | 3300025903 | Ga0207680_10200759 | Ga0207680_102007592 | 151 |
| 69 | 3300025907 | Ga0207645_10216303 | Ga0207645_102163032 | 151 |
| 70 | 3300025940 | Ga0207691_10202556 | Ga0207691_102025562 | 151 |
| 71 | 3300025941 | Ga0207711_10033837 | Ga0207711_100338375 | 151 |
| 72 | 3300025960 | Ga0207651_10029038 | Ga0207651_100290382 | 151 |
| 73 | 3300025986 | Ga0207658_10392824 | Ga0207658_103928242 | 151 |
| 74 | 3300026023 | Ga0207677_10371048 | Ga0207677_103710482 | 151 |
| 75 | 3300026121 | Ga0207683_10554350 | Ga0207683_105543502 | 151 |
| 76 | 3300028379 | Ga0268266_10319165 | Ga0268266_103191652 | 151 |
| 77 | 3300045836 | Ga0466958_0028552 | Ga0466958_0028552_128_661 | 151 |
| 78 | 3300045976 | Ga0466967_0006997 | Ga0466967_0006997_1581_2114 | 151 |
| 79 | 3300046471 | Ga0495650_0152204 | Ga0495650_0152204_211_726 | 151 |
| 80 | 3300046616 | Ga0495668_0011856 | Ga0495668_0011856_3294_3809 | 151 |
| 81 | 3300053134 | Ga0500658_0000036 | Ga0500658_0000036_37924_38439 | 151 |
| 82 | 3300061719 | Ga0466962_0120036 | Ga0466962_0120036_440_973 | 151 |
| 83 | 3300003323 | rootH1_10146668 | rootH1_101466682 | 152 |
| 84 | 3300005331 | Ga0070670_100037964 | Ga0070670_1000379642 | 152 |
| 85 | 3300005333 | Ga0070677_10359569 | Ga0070677_103595692 | 152 |
| 86 | 3300005339 | Ga0070660_100599932 | Ga0070660_1005999321 | 152 |
| 87 | 3300005354 | Ga0070675_100222134 | Ga0070675_1002221342 | 152 |
| 88 | 3300005355 | Ga0070671_100479706 | Ga0070671_1004797062 | 152 |
| 89 | 3300005356 | Ga0070674_100218520 | Ga0070674_1002185203 | 152 |
| 90 | 3300005366 | Ga0070659_100420236 | Ga0070659_1004202361 | 152 |
| 91 | 3300005456 | Ga0070678_100185955 | Ga0070678_1001859552 | 152 |
| 92 | 3300005459 | Ga0068867_100224100 | Ga0068867_1002241002 | 152 |
| 93 | 3300005543 | Ga0070672_100047900 | Ga0070672_1000479002 | 152 |
| 94 | 3300005616 | Ga0068852_100445873 | Ga0068852_1004458732 | 152 |
| 95 | 3300005617 | Ga0068859_100221584 | Ga0068859_1002215842 | 152 |
| 96 | 3300005842 | Ga0068858_100069226 | Ga0068858_1000692265 | 152 |
| 97 | 3300005842 | Ga0068858_101088491 | Ga0068858_1010884911 | 152 |
| 98 | 3300006881 | Ga0068865_100124170 | Ga0068865_1001241703 | 152 |
| 99 | 3300006931 | Ga0097620_100221567 | Ga0097620_1002215673 | 152 |
| 100 | 3300009092 | Ga0105250_10008228 | Ga0105250_100082282 | 152 |
| 101 | 3300009101 | Ga0105247_10092011 | Ga0105247_100920113 | 152 |
| 102 | 3300009177 | Ga0105248_10001135 | Ga0105248_1000113512 | 152 |
| 103 | 3300009553 | Ga0105249_10089043 | Ga0105249_100890434 | 152 |
| 104 | 3300013306 | Ga0163162_10089421 | Ga0163162_100894214 | 152 |
| 105 | 3300013308 | Ga0157375_11130288 | Ga0157375_111302881 | 152 |
| 106 | 3300014325 | Ga0163163_10000735 | Ga0163163_1000073534 | 152 |
| 107 | 3300014326 | Ga0157380_11236428 | Ga0157380_112364282 | 152 |
| 108 | 3300014968 | Ga0157379_10012216 | Ga0157379_100122164 | 152 |
| 109 | 3300025925 | Ga0207650_10052898 | Ga0207650_100528982 | 152 |
| 110 | 3300025926 | Ga0207659_10163770 | Ga0207659_101637702 | 152 |
| 111 | 3300025933 | Ga0207706_10068152 | Ga0207706_100681524 | 152 |
| 112 | 3300025937 | Ga0207669_10145946 | Ga0207669_101459462 | 152 |
| 113 | 3300025938 | Ga0207704_10566616 | Ga0207704_105666161 | 152 |
| 114 | 3300025940 | Ga0207691_10031381 | Ga0207691_100313817 | 152 |
| 115 | 3300025941 | Ga0207711_10062395 | Ga0207711_100623952 | 152 |
| 116 | 3300026089 | Ga0207648_10059945 | Ga0207648_100599453 | 152 |
| 117 | 3300026121 | Ga0207683_10473012 | Ga0207683_104730122 | 152 |
| 118 | 3300026142 | Ga0207698_12010683 | Ga0207698_120106831 | 152 |
| 119 | 3300031852 | Ga0307410_10144957 | Ga0307410_101449572 | 152 |
| 120 | 3300031903 | Ga0307407_10085950 | Ga0307407_100859502 | 152 |
| 121 | 3300031995 | Ga0307409_100031807 | Ga0307409_1000318073 | 152 |
| 122 | 3300032005 | Ga0307411_10071637 | Ga0307411_100716374 | 152 |
| 123 | 3300037471 | Ga0395905_0036894 | Ga0395905_0036894_2167_2664 | 152 |
| 124 | 3300037471 | Ga0395905_0423000 | Ga0395905_0423000_613_1119 | 152 |
| 125 | 3300037471 | Ga0395905_0700970 | Ga0395905_0700970_266_763 | 152 |
| 126 | 3300037471 | Ga0395905_1142279 | Ga0395905_1142279_151_657 | 152 |
| 127 | 3300044694 | Ga0466963_0010178 | Ga0466963_0010178_4622_5143 | 152 |
| 128 | 3300044706 | Ga0466964_0155698 | Ga0466964_0155698_87_608 | 152 |
| 129 | 3300044842 | Ga0466957_0390324 | Ga0466957_0390324_237_758 | 152 |
| 130 | 3300045976 | Ga0466967_0247910 | Ga0466967_0247910_450_971 | 152 |
| 131 | 3300047445 | Ga0495677_0087929 | Ga0495677_0087929_411_944 | 152 |
| 132 | 3300048911 | Ga0496108_0045905 | Ga0496108_0045905_2409_2909 | 152 |
| 133 | 3300048912 | Ga0496109_0046481 | Ga0496109_0046481_1251_1751 | 152 |
| 134 | 3300001979 | JGI24740J21852_10032137 | JGI24740J21852_100321372 | 153 |
| 135 | 3300003320 | rootH2_10095679 | rootH2_100956793 | 153 |
| 136 | 3300005327 | Ga0070658_10603367 | Ga0070658_106033672 | 153 |
| 137 | 3300005329 | Ga0070683_100014717 | Ga0070683_1000147178 | 153 |
| 138 | 3300005331 | Ga0070670_100140991 | Ga0070670_1001409912 | 153 |
| 139 | 3300005336 | Ga0070680_100001257 | Ga0070680_1000012573 | 153 |
| 140 | 3300005339 | Ga0070660_100029369 | Ga0070660_1000293692 | 153 |
| 141 | 3300005367 | Ga0070667_100053826 | Ga0070667_1000538264 | 153 |
| 142 | 3300005435 | Ga0070714_101482018 | Ga0070714_1014820181 | 153 |
| 143 | 3300005455 | Ga0070663_100078053 | Ga0070663_1000780534 | 153 |
| 144 | 3300005530 | Ga0070679_100038807 | Ga0070679_1000388076 | 153 |
| 145 | 3300005539 | Ga0068853_100136876 | Ga0068853_1001368763 | 153 |
| 146 | 3300005543 | Ga0070672_101433130 | Ga0070672_1014331301 | 153 |
| 147 | 3300005563 | Ga0068855_100025356 | Ga0068855_1000253568 | 153 |
| 148 | 3300005614 | Ga0068856_100274052 | Ga0068856_1002740522 | 153 |
| 149 | 3300005614 | Ga0068856_100976439 | Ga0068856_1009764392 | 153 |
| 150 | 3300005616 | Ga0068852_100244841 | Ga0068852_1002448412 | 153 |
| 151 | 3300005834 | Ga0068851_10314946 | Ga0068851_103149461 | 153 |
| 152 | 3300005843 | Ga0068860_100205460 | Ga0068860_1002054603 | 153 |
| 153 | 3300009177 | Ga0105248_10019178 | Ga0105248_100191782 | 153 |
| 154 | 3300013104 | Ga0157370_10114252 | Ga0157370_101142521 | 153 |
| 155 | 3300014968 | Ga0157379_10330763 | Ga0157379_103307632 | 153 |
| 156 | 3300020069 | Ga0197907_11114687 | Ga0197907_111146872 | 153 |
| 157 | 3300020081 | Ga0206354_10226857 | Ga0206354_102268573 | 153 |
| 158 | 3300020082 | Ga0206353_11563947 | Ga0206353_115639472 | 153 |
| 159 | 3300025321 | Ga0207656_10239381 | Ga0207656_102393811 | 153 |
| 160 | 3300025904 | Ga0207647_10108722 | Ga0207647_101087222 | 153 |
| 161 | 3300025909 | Ga0207705_10000493 | Ga0207705_1000049318 | 153 |
| 162 | 3300025917 | Ga0207660_10054697 | Ga0207660_100546973 | 153 |
| 163 | 3300025919 | Ga0207657_10017883 | Ga0207657_100178832 | 153 |
| 164 | 3300025921 | Ga0207652_10000034 | Ga0207652_10000034130 | 153 |
| 165 | 3300025928 | Ga0207700_11114265 | Ga0207700_111142651 | 153 |
| 166 | 3300025941 | Ga0207711_10000617 | Ga0207711_1000061730 | 153 |
| 167 | 3300025944 | Ga0207661_10009979 | Ga0207661_100099792 | 153 |
| 168 | 3300025949 | Ga0207667_10049976 | Ga0207667_100499766 | 153 |
| 169 | 3300025986 | Ga0207658_10084342 | Ga0207658_100843423 | 153 |
| 170 | 3300026041 | Ga0207639_10112941 | Ga0207639_101129413 | 153 |
| 171 | 3300026041 | Ga0207639_10278547 | Ga0207639_102785472 | 153 |
| 172 | 3300026067 | Ga0207678_10017638 | Ga0207678_100176382 | 153 |
| 173 | 3300026142 | Ga0207698_10006766 | Ga0207698_100067661 | 153 |
| 174 | 3300026142 | Ga0207698_10414127 | Ga0207698_104141272 | 153 |
| 175 | 3300028381 | Ga0268264_10203575 | Ga0268264_102035752 | 153 |
| 176 | 3300031824 | Ga0307413_10501615 | Ga0307413_105016152 | 153 |
| 177 | 3300031852 | Ga0307410_10158828 | Ga0307410_101588282 | 153 |
| 178 | 3300031911 | Ga0307412_10696304 | Ga0307412_106963041 | 153 |
| 179 | 3300032002 | Ga0307416_100276544 | Ga0307416_1002765442 | 153 |
| 180 | 3300032002 | Ga0307416_101247515 | Ga0307416_1012475152 | 153 |
| 181 | 3300032004 | Ga0307414_10179571 | Ga0307414_101795713 | 153 |
| 182 | 3300032004 | Ga0307414_10366977 | Ga0307414_103669772 | 153 |
| 183 | 3300032005 | Ga0307411_10158493 | Ga0307411_101584932 | 153 |
| 184 | 3300032005 | Ga0307411_10632101 | Ga0307411_106321012 | 153 |
| 185 | 3300032126 | Ga0307415_100179507 | Ga0307415_1001795072 | 153 |
| 186 | 3300035115 | Ga0373941_0173760 | Ga0373941_0173760_18_530 | 153 |
| 187 | 3300035691 | Ga0373931_1027412 | Ga0373931_1027412_19_531 | 153 |
| 188 | 3300037312 | Ga0395899_0084671 | Ga0395899_0084671_1312_1857 | 153 |
| 189 | 3300037418 | Ga0395900_0010484 | Ga0395900_0010484_867_1409 | 153 |
| 190 | 3300037418 | Ga0395900_0040236 | Ga0395900_0040236_191_736 | 153 |
| 191 | 3300037418 | Ga0395900_0546719 | Ga0395900_0546719_396_899 | 153 |
| 192 | 3300037466 | Ga0395898_0142823 | Ga0395898_0142823_271_840 | 153 |
| 193 | 3300037471 | Ga0395905_0085043 | Ga0395905_0085043_356_898 | 153 |
| 194 | 3300037471 | Ga0395905_0086007 | Ga0395905_0086007_191_736 | 153 |
| 195 | 3300037471 | Ga0395905_0094163 | Ga0395905_0094163_1304_1849 | 153 |
| 196 | 3300038443 | Ga0395901_0113729 | Ga0395901_0113729_2095_2634 | 153 |
| 197 | 3300038443 | Ga0395901_0492497 | Ga0395901_0492497_250_753 | 153 |
| 198 | 3300038443 | Ga0395901_0514093 | Ga0395901_0514093_464_1009 | 153 |
| 199 | 3300042006 | Ga0439432_024907 | Ga0439432_024907_951_1454 | 153 |
| 200 | 3300044658 | Ga0466972_0316434 | Ga0466972_0316434_38_589 | 153 |
| 201 | 3300044842 | Ga0466957_0588571 | Ga0466957_0588571_106_657 | 153 |
| 202 | 3300045836 | Ga0466958_0217883 | Ga0466958_0217883_428_979 | 153 |
| 203 | 3300045976 | Ga0466967_0131886 | Ga0466967_0131886_1566_2096 | 153 |
| 204 | 3300045976 | Ga0466967_0263869 | Ga0466967_0263869_507_1058 | 153 |
| 205 | 3300048913 | Ga0496110_0184234 | Ga0496110_0184234_581_1081 | 153 |
| 206 | 3300049652 | Ga0501202_058311 | Ga0501202_058311_64_567 | 153 |
| 207 | 3300049654 | Ga0501207_019395 | Ga0501207_019395_338_841 | 153 |
| 208 | 3300049661 | Ga0501217_067111 | Ga0501217_067111_448_951 | 153 |
| 209 | 3300049663 | Ga0501223_035357 | Ga0501223_035357_193_696 | 153 |
| 210 | 3300049669 | Ga0501235_008407 | Ga0501235_008407_1162_1665 | 153 |
| 211 | 3300049672 | Ga0501239_006071 | Ga0501239_006071_122_625 | 153 |
| 212 | 3300049687 | Ga0501258_004127 | Ga0501258_004127_498_1001 | 153 |
| 213 | 3300049704 | Ga0501221_009102 | Ga0501221_009102_456_959 | 153 |
| 214 | 3300049706 | Ga0501229_020960 | Ga0501229_020960_19_522 | 153 |
| 215 | 3300049765 | Ga0501268_000532 | Ga0501268_000532_668_1171 | 153 |
| 216 | 3300001904 | JGI24736J21556_1011162 | JGI24736J21556_10111622 | 154 |
| 217 | 3300001979 | JGI24740J21852_10011466 | JGI24740J21852_100114662 | 154 |
| 218 | 3300001979 | JGI24740J21852_10027078 | JGI24740J21852_100270782 | 154 |
| 219 | 3300001989 | JGI24739J22299_10006645 | JGI24739J22299_100066454 | 154 |
| 220 | 3300001990 | JGI24737J22298_10005144 | JGI24737J22298_100051444 | 154 |
| 221 | 3300002067 | JGI24735J21928_10004145 | JGI24735J21928_100041457 | 154 |
| 222 | 3300002067 | JGI24735J21928_10018977 | JGI24735J21928_100189773 | 154 |
| 223 | 3300005327 | Ga0070658_10014069 | Ga0070658_100140698 | 154 |
| 224 | 3300005327 | Ga0070658_10095418 | Ga0070658_100954182 | 154 |
| 225 | 3300005327 | Ga0070658_10115125 | Ga0070658_101151252 | 154 |
| 226 | 3300005327 | Ga0070658_10190689 | Ga0070658_101906893 | 154 |
| 227 | 3300005327 | Ga0070658_10382658 | Ga0070658_103826582 | 154 |
| 228 | 3300005327 | Ga0070658_10453259 | Ga0070658_104532592 | 154 |
| 229 | 3300005327 | Ga0070658_10457148 | Ga0070658_104571481 | 154 |
| 230 | 3300005327 | Ga0070658_10475136 | Ga0070658_104751362 | 154 |
| 231 | 3300005329 | Ga0070683_100009832 | Ga0070683_1000098329 | 154 |
| 232 | 3300005329 | Ga0070683_100034868 | Ga0070683_1000348683 | 154 |
| 233 | 3300005329 | Ga0070683_100093133 | Ga0070683_1000931334 | 154 |
| 234 | 3300005329 | Ga0070683_100430693 | Ga0070683_1004306932 | 154 |
| 235 | 3300005329 | Ga0070683_100788728 | Ga0070683_1007887282 | 154 |
| 236 | 3300005330 | Ga0070690_100208589 | Ga0070690_1002085891 | 154 |
| 237 | 3300005331 | Ga0070670_100309142 | Ga0070670_1003091422 | 154 |
| 238 | 3300005335 | Ga0070666_10002971 | Ga0070666_100029715 | 154 |
| 239 | 3300005336 | Ga0070680_100145622 | Ga0070680_1001456223 | 154 |
| 240 | 3300005336 | Ga0070680_100233016 | Ga0070680_1002330163 | 154 |
| 241 | 3300005336 | Ga0070680_100341447 | Ga0070680_1003414472 | 154 |
| 242 | 3300005337 | Ga0070682_100062528 | Ga0070682_1000625283 | 154 |
| 243 | 3300005337 | Ga0070682_100240793 | Ga0070682_1002407932 | 154 |
| 244 | 3300005337 | Ga0070682_100297181 | Ga0070682_1002971812 | 154 |
| 245 | 3300005337 | Ga0070682_100590144 | Ga0070682_1005901442 | 154 |
| 246 | 3300005337 | Ga0070682_100676506 | Ga0070682_1006765061 | 154 |
| 247 | 3300005338 | Ga0068868_100012920 | Ga0068868_1000129202 | 154 |
| 248 | 3300005339 | Ga0070660_100036347 | Ga0070660_1000363475 | 154 |
| 249 | 3300005339 | Ga0070660_100046930 | Ga0070660_1000469303 | 154 |
| 250 | 3300005339 | Ga0070660_100057029 | Ga0070660_1000570293 | 154 |
| 251 | 3300005339 | Ga0070660_100060814 | Ga0070660_1000608143 | 154 |
| 252 | 3300005339 | Ga0070660_100082500 | Ga0070660_1000825002 | 154 |
| 253 | 3300005339 | Ga0070660_100192238 | Ga0070660_1001922382 | 154 |
| 254 | 3300005339 | Ga0070660_100777800 | Ga0070660_1007778002 | 154 |
| 255 | 3300005339 | Ga0070660_100860822 | Ga0070660_1008608221 | 154 |
| 256 | 3300005339 | Ga0070660_100864870 | Ga0070660_1008648702 | 154 |
| 257 | 3300005341 | Ga0070691_10003582 | Ga0070691_100035823 | 154 |
| 258 | 3300005344 | Ga0070661_100033437 | Ga0070661_1000334373 | 154 |
| 259 | 3300005344 | Ga0070661_100057595 | Ga0070661_1000575952 | 154 |
| 260 | 3300005344 | Ga0070661_100115944 | Ga0070661_1001159442 | 154 |
| 261 | 3300005344 | Ga0070661_100119212 | Ga0070661_1001192122 | 154 |
| 262 | 3300005344 | Ga0070661_100125604 | Ga0070661_1001256042 | 154 |
| 263 | 3300005344 | Ga0070661_100132596 | Ga0070661_1001325962 | 154 |
| 264 | 3300005344 | Ga0070661_100255546 | Ga0070661_1002555462 | 154 |
| 265 | 3300005344 | Ga0070661_100425149 | Ga0070661_1004251492 | 154 |
| 266 | 3300005344 | Ga0070661_100430133 | Ga0070661_1004301332 | 154 |
| 267 | 3300005344 | Ga0070661_100663233 | Ga0070661_1006632331 | 154 |
| 268 | 3300005344 | Ga0070661_100765250 | Ga0070661_1007652502 | 154 |
| 269 | 3300005345 | Ga0070692_10006534 | Ga0070692_100065347 | 154 |
| 270 | 3300005345 | Ga0070692_10013273 | Ga0070692_100132733 | 154 |
| 271 | 3300005345 | Ga0070692_10072159 | Ga0070692_100721592 | 154 |
| 272 | 3300005345 | Ga0070692_10107622 | Ga0070692_101076222 | 154 |
| 273 | 3300005355 | Ga0070671_100024137 | Ga0070671_1000241371 | 154 |
| 274 | 3300005355 | Ga0070671_100079772 | Ga0070671_1000797721 | 154 |
| 275 | 3300005364 | Ga0070673_100000526 | Ga0070673_1000005262 | 154 |
| 276 | 3300005364 | Ga0070673_100075965 | Ga0070673_1000759652 | 154 |
| 277 | 3300005366 | Ga0070659_100033445 | Ga0070659_1000334454 | 154 |
| 278 | 3300005366 | Ga0070659_100033606 | Ga0070659_1000336065 | 154 |
| 279 | 3300005366 | Ga0070659_100045336 | Ga0070659_1000453365 | 154 |
| 280 | 3300005366 | Ga0070659_100083906 | Ga0070659_1000839064 | 154 |
| 281 | 3300005366 | Ga0070659_100381841 | Ga0070659_1003818411 | 154 |
| 282 | 3300005366 | Ga0070659_100443303 | Ga0070659_1004433032 | 154 |
| 283 | 3300005366 | Ga0070659_100475719 | Ga0070659_1004757192 | 154 |
| 284 | 3300005366 | Ga0070659_100775901 | Ga0070659_1007759012 | 154 |
| 285 | 3300005366 | Ga0070659_100897391 | Ga0070659_1008973911 | 154 |
| 286 | 3300005367 | Ga0070667_100013712 | Ga0070667_1000137128 | 154 |
| 287 | 3300005435 | Ga0070714_100224928 | Ga0070714_1002249282 | 154 |
| 288 | 3300005435 | Ga0070714_100450504 | Ga0070714_1004505042 | 154 |
| 289 | 3300005435 | Ga0070714_100715804 | Ga0070714_1007158042 | 154 |
| 290 | 3300005435 | Ga0070714_100754447 | Ga0070714_1007544471 | 154 |
| 291 | 3300005436 | Ga0070713_100604964 | Ga0070713_1006049641 | 154 |
| 292 | 3300005455 | Ga0070663_100025115 | Ga0070663_1000251154 | 154 |
| 293 | 3300005455 | Ga0070663_100053289 | Ga0070663_1000532892 | 154 |
| 294 | 3300005455 | Ga0070663_100397770 | Ga0070663_1003977702 | 154 |
| 295 | 3300005455 | Ga0070663_100720413 | Ga0070663_1007204132 | 154 |
| 296 | 3300005456 | Ga0070678_100026409 | Ga0070678_1000264093 | 154 |
| 297 | 3300005457 | Ga0070662_100028447 | Ga0070662_1000284474 | 154 |
| 298 | 3300005457 | Ga0070662_100031341 | Ga0070662_1000313412 | 154 |
| 299 | 3300005457 | Ga0070662_100689245 | Ga0070662_1006892451 | 154 |
| 300 | 3300005458 | Ga0070681_10074936 | Ga0070681_100749364 | 154 |
| 301 | 3300005458 | Ga0070681_10135295 | Ga0070681_101352954 | 154 |
| 302 | 3300005458 | Ga0070681_10190802 | Ga0070681_101908022 | 154 |
| 303 | 3300005458 | Ga0070681_10421602 | Ga0070681_104216022 | 154 |
| 304 | 3300005458 | Ga0070681_10956825 | Ga0070681_109568251 | 154 |
| 305 | 3300005459 | Ga0068867_100173257 | Ga0068867_1001732572 | 154 |
| 306 | 3300005466 | Ga0070685_10175839 | Ga0070685_101758392 | 154 |
| 307 | 3300005530 | Ga0070679_100089715 | Ga0070679_1000897153 | 154 |
| 308 | 3300005530 | Ga0070679_100624713 | Ga0070679_1006247132 | 154 |
| 309 | 3300005530 | Ga0070679_101081056 | Ga0070679_1010810561 | 154 |
| 310 | 3300005535 | Ga0070684_100002671 | Ga0070684_10000267113 | 154 |
| 311 | 3300005535 | Ga0070684_100034298 | Ga0070684_1000342985 | 154 |
| 312 | 3300005535 | Ga0070684_100043830 | Ga0070684_1000438305 | 154 |
| 313 | 3300005535 | Ga0070684_100131444 | Ga0070684_1001314442 | 154 |
| 314 | 3300005535 | Ga0070684_100958225 | Ga0070684_1009582251 | 154 |
| 315 | 3300005539 | Ga0068853_100041268 | Ga0068853_1000412684 | 154 |
| 316 | 3300005539 | Ga0068853_100043066 | Ga0068853_1000430662 | 154 |
| 317 | 3300005539 | Ga0068853_100182314 | Ga0068853_1001823142 | 154 |
| 318 | 3300005539 | Ga0068853_100430520 | Ga0068853_1004305202 | 154 |
| 319 | 3300005539 | Ga0068853_100468473 | Ga0068853_1004684733 | 154 |
| 320 | 3300005539 | Ga0068853_101021086 | Ga0068853_1010210862 | 154 |
| 321 | 3300005543 | Ga0070672_100363492 | Ga0070672_1003634922 | 154 |
| 322 | 3300005544 | Ga0070686_100608762 | Ga0070686_1006087621 | 154 |
| 323 | 3300005544 | Ga0070686_100744368 | Ga0070686_1007443681 | 154 |
| 324 | 3300005548 | Ga0070665_100659351 | Ga0070665_1006593512 | 154 |
| 325 | 3300005563 | Ga0068855_100112774 | Ga0068855_1001127743 | 154 |
| 326 | 3300005563 | Ga0068855_100115015 | Ga0068855_1001150152 | 154 |
| 327 | 3300005563 | Ga0068855_100136178 | Ga0068855_1001361784 | 154 |
| 328 | 3300005563 | Ga0068855_100394981 | Ga0068855_1003949812 | 154 |
| 329 | 3300005563 | Ga0068855_100725812 | Ga0068855_1007258122 | 154 |
| 330 | 3300005564 | Ga0070664_100006591 | Ga0070664_1000065912 | 154 |
| 331 | 3300005564 | Ga0070664_100055897 | Ga0070664_1000558972 | 154 |
| 332 | 3300005564 | Ga0070664_100113509 | Ga0070664_1001135094 | 154 |
| 333 | 3300005564 | Ga0070664_100336421 | Ga0070664_1003364213 | 154 |
| 334 | 3300005564 | Ga0070664_100349063 | Ga0070664_1003490632 | 154 |
| 335 | 3300005564 | Ga0070664_100816447 | Ga0070664_1008164471 | 154 |
| 336 | 3300005564 | Ga0070664_100821839 | Ga0070664_1008218391 | 154 |
| 337 | 3300005564 | Ga0070664_101036703 | Ga0070664_1010367032 | 154 |
| 338 | 3300005577 | Ga0068857_100031248 | Ga0068857_1000312484 | 154 |
| 339 | 3300005577 | Ga0068857_100039427 | Ga0068857_1000394273 | 154 |
| 340 | 3300005577 | Ga0068857_100200012 | Ga0068857_1002000122 | 154 |
| 341 | 3300005577 | Ga0068857_101122619 | Ga0068857_1011226192 | 154 |
| 342 | 3300005578 | Ga0068854_100033977 | Ga0068854_1000339775 | 154 |
| 343 | 3300005578 | Ga0068854_100083539 | Ga0068854_1000835392 | 154 |
| 344 | 3300005578 | Ga0068854_100106600 | Ga0068854_1001066002 | 154 |
| 345 | 3300005578 | Ga0068854_100557858 | Ga0068854_1005578582 | 154 |
| 346 | 3300005614 | Ga0068856_100008253 | Ga0068856_10000825310 | 154 |
| 347 | 3300005614 | Ga0068856_100251514 | Ga0068856_1002515142 | 154 |
| 348 | 3300005614 | Ga0068856_100900673 | Ga0068856_1009006732 | 154 |
| 349 | 3300005614 | Ga0068856_101130044 | Ga0068856_1011300441 | 154 |
| 350 | 3300005614 | Ga0068856_101393909 | Ga0068856_1013939091 | 154 |
| 351 | 3300005616 | Ga0068852_100013451 | Ga0068852_1000134512 | 154 |
| 352 | 3300005616 | Ga0068852_100030542 | Ga0068852_1000305426 | 154 |
| 353 | 3300005616 | Ga0068852_100031074 | Ga0068852_1000310746 | 154 |
| 354 | 3300005616 | Ga0068852_100125836 | Ga0068852_1001258362 | 154 |
| 355 | 3300005616 | Ga0068852_100187856 | Ga0068852_1001878562 | 154 |
| 356 | 3300005616 | Ga0068852_100221775 | Ga0068852_1002217753 | 154 |
| 357 | 3300005616 | Ga0068852_100279679 | Ga0068852_1002796792 | 154 |
| 358 | 3300005616 | Ga0068852_100812574 | Ga0068852_1008125742 | 154 |
| 359 | 3300005616 | Ga0068852_101128342 | Ga0068852_1011283422 | 154 |
| 360 | 3300005617 | Ga0068859_100914628 | Ga0068859_1009146282 | 154 |
| 361 | 3300005618 | Ga0068864_100038826 | Ga0068864_1000388262 | 154 |
| 362 | 3300005618 | Ga0068864_100758205 | Ga0068864_1007582052 | 154 |
| 363 | 3300005834 | Ga0068851_10008280 | Ga0068851_100082806 | 154 |
| 364 | 3300005834 | Ga0068851_10013866 | Ga0068851_100138663 | 154 |
| 365 | 3300005834 | Ga0068851_10283083 | Ga0068851_102830832 | 154 |
| 366 | 3300005834 | Ga0068851_10383426 | Ga0068851_103834261 | 154 |
| 367 | 3300005841 | Ga0068863_100145598 | Ga0068863_1001455982 | 154 |
| 368 | 3300005842 | Ga0068858_100019414 | Ga0068858_1000194148 | 154 |
| 369 | 3300005844 | Ga0068862_100028027 | Ga0068862_1000280276 | 154 |
| 370 | 3300005985 | Ga0081539_10071515 | Ga0081539_100715152 | 154 |
| 371 | 3300006237 | Ga0097621_100174739 | Ga0097621_1001747392 | 154 |
| 372 | 3300006237 | Ga0097621_100524608 | Ga0097621_1005246083 | 154 |
| 373 | 3300006358 | Ga0068871_100716564 | Ga0068871_1007165642 | 154 |
| 374 | 3300006881 | Ga0068865_101045468 | Ga0068865_1010454681 | 154 |
| 375 | 3300006931 | Ga0097620_100914616 | Ga0097620_1009146162 | 154 |
| 376 | 3300009174 | Ga0105241_10503243 | Ga0105241_105032431 | 154 |
| 377 | 3300009177 | Ga0105248_10201147 | Ga0105248_102011473 | 154 |
| 378 | 3300013100 | Ga0157373_10014974 | Ga0157373_100149744 | 154 |
| 379 | 3300013100 | Ga0157373_10438077 | Ga0157373_104380772 | 154 |
| 380 | 3300013100 | Ga0157373_10518954 | Ga0157373_105189541 | 154 |
| 381 | 3300013100 | Ga0157373_10748786 | Ga0157373_107487862 | 154 |
| 382 | 3300013102 | Ga0157371_10078304 | Ga0157371_100783044 | 154 |
| 383 | 3300013104 | Ga0157370_10055585 | Ga0157370_100555853 | 154 |
| 384 | 3300013104 | Ga0157370_10892455 | Ga0157370_108924552 | 154 |
| 385 | 3300013105 | Ga0157369_10127638 | Ga0157369_101276381 | 154 |
| 386 | 3300013105 | Ga0157369_10175882 | Ga0157369_101758821 | 154 |
| 387 | 3300013105 | Ga0157369_10872117 | Ga0157369_108721171 | 154 |
| 388 | 3300013105 | Ga0157369_10881274 | Ga0157369_108812742 | 154 |
| 389 | 3300013296 | Ga0157374_10222841 | Ga0157374_102228412 | 154 |
| 390 | 3300013296 | Ga0157374_10947297 | Ga0157374_109472972 | 154 |
| 391 | 3300013296 | Ga0157374_11024352 | Ga0157374_110243521 | 154 |
| 392 | 3300013306 | Ga0163162_11228716 | Ga0163162_112287162 | 154 |
| 393 | 3300013307 | Ga0157372_10698367 | Ga0157372_106983672 | 154 |
| 394 | 3300013307 | Ga0157372_10886448 | Ga0157372_108864481 | 154 |
| 395 | 3300013307 | Ga0157372_11139254 | Ga0157372_111392542 | 154 |
| 396 | 3300013307 | Ga0157372_11880512 | Ga0157372_118805121 | 154 |
| 397 | 3300014497 | Ga0182008_10538462 | Ga0182008_105384621 | 154 |
| 398 | 3300020078 | Ga0206352_10095400 | Ga0206352_100954002 | 154 |
| 399 | 3300020081 | Ga0206354_11230177 | Ga0206354_112301771 | 154 |
| 400 | 3300021388 | Ga0213875_10011498 | Ga0213875_100114985 | 154 |
| 401 | 3300025315 | Ga0207697_10084026 | Ga0207697_100840262 | 154 |
| 402 | 3300025321 | Ga0207656_10008268 | Ga0207656_100082684 | 154 |
| 403 | 3300025321 | Ga0207656_10038801 | Ga0207656_100388012 | 154 |
| 404 | 3300025321 | Ga0207656_10302101 | Ga0207656_103021011 | 154 |
| 405 | 3300025903 | Ga0207680_10008315 | Ga0207680_100083156 | 154 |
| 406 | 3300025903 | Ga0207680_10284731 | Ga0207680_102847312 | 154 |
| 407 | 3300025904 | Ga0207647_10030159 | Ga0207647_100301595 | 154 |
| 408 | 3300025904 | Ga0207647_10118329 | Ga0207647_101183292 | 154 |
| 409 | 3300025904 | Ga0207647_10218361 | Ga0207647_102183612 | 154 |
| 410 | 3300025909 | Ga0207705_10004262 | Ga0207705_100042622 | 154 |
| 411 | 3300025909 | Ga0207705_10028284 | Ga0207705_100282846 | 154 |
| 412 | 3300025909 | Ga0207705_10057414 | Ga0207705_100574142 | 154 |
| 413 | 3300025909 | Ga0207705_10095986 | Ga0207705_100959862 | 154 |
| 414 | 3300025911 | Ga0207654_10442327 | Ga0207654_104423272 | 154 |
| 415 | 3300025912 | Ga0207707_10017647 | Ga0207707_100176475 | 154 |
| 416 | 3300025912 | Ga0207707_10039480 | Ga0207707_100394804 | 154 |
| 417 | 3300025912 | Ga0207707_10606412 | Ga0207707_106064122 | 154 |
| 418 | 3300025913 | Ga0207695_10154693 | Ga0207695_101546932 | 154 |
| 419 | 3300025914 | Ga0207671_10024193 | Ga0207671_100241935 | 154 |
| 420 | 3300025914 | Ga0207671_10028319 | Ga0207671_100283196 | 154 |
| 421 | 3300025917 | Ga0207660_10003208 | Ga0207660_1000320811 | 154 |
| 422 | 3300025917 | Ga0207660_10045526 | Ga0207660_100455263 | 154 |
| 423 | 3300025917 | Ga0207660_10189837 | Ga0207660_101898372 | 154 |
| 424 | 3300025919 | Ga0207657_10009734 | Ga0207657_1000973410 | 154 |
| 425 | 3300025919 | Ga0207657_10015926 | Ga0207657_100159262 | 154 |
| 426 | 3300025919 | Ga0207657_10039647 | Ga0207657_100396473 | 154 |
| 427 | 3300025919 | Ga0207657_10052428 | Ga0207657_100524285 | 154 |
| 428 | 3300025919 | Ga0207657_10072347 | Ga0207657_100723474 | 154 |
| 429 | 3300025919 | Ga0207657_10084906 | Ga0207657_100849063 | 154 |
| 430 | 3300025919 | Ga0207657_10091364 | Ga0207657_100913642 | 154 |
| 431 | 3300025919 | Ga0207657_10121371 | Ga0207657_101213712 | 154 |
| 432 | 3300025919 | Ga0207657_10174931 | Ga0207657_101749313 | 154 |
| 433 | 3300025919 | Ga0207657_10240584 | Ga0207657_102405842 | 154 |
| 434 | 3300025920 | Ga0207649_10012535 | Ga0207649_100125353 | 154 |
| 435 | 3300025920 | Ga0207649_10049759 | Ga0207649_100497593 | 154 |
| 436 | 3300025920 | Ga0207649_10054438 | Ga0207649_100544383 | 154 |
| 437 | 3300025920 | Ga0207649_10081183 | Ga0207649_100811832 | 154 |
| 438 | 3300025920 | Ga0207649_10189677 | Ga0207649_101896772 | 154 |
| 439 | 3300025920 | Ga0207649_10194158 | Ga0207649_101941582 | 154 |
| 440 | 3300025920 | Ga0207649_10224026 | Ga0207649_102240262 | 154 |
| 441 | 3300025920 | Ga0207649_10227042 | Ga0207649_102270423 | 154 |
| 442 | 3300025920 | Ga0207649_10340610 | Ga0207649_103406102 | 154 |
| 443 | 3300025921 | Ga0207652_10009794 | Ga0207652_100097943 | 154 |
| 444 | 3300025924 | Ga0207694_10024170 | Ga0207694_100241705 | 154 |
| 445 | 3300025924 | Ga0207694_10569298 | Ga0207694_105692982 | 154 |
| 446 | 3300025925 | Ga0207650_10005864 | Ga0207650_100058647 | 154 |
| 447 | 3300025928 | Ga0207700_11267147 | Ga0207700_112671471 | 154 |
| 448 | 3300025929 | Ga0207664_10434529 | Ga0207664_104345292 | 154 |
| 449 | 3300025929 | Ga0207664_10647739 | Ga0207664_106477392 | 154 |
| 450 | 3300025931 | Ga0207644_10000614 | Ga0207644_1000061425 | 154 |
| 451 | 3300025931 | Ga0207644_10006207 | Ga0207644_100062079 | 154 |
| 452 | 3300025931 | Ga0207644_10092846 | Ga0207644_100928463 | 154 |
| 453 | 3300025932 | Ga0207690_10004475 | Ga0207690_100044758 | 154 |
| 454 | 3300025932 | Ga0207690_10029270 | Ga0207690_100292703 | 154 |
| 455 | 3300025932 | Ga0207690_10292984 | Ga0207690_102929842 | 154 |
| 456 | 3300025932 | Ga0207690_10678778 | Ga0207690_106787782 | 154 |
| 457 | 3300025933 | Ga0207706_10078243 | Ga0207706_100782432 | 154 |
| 458 | 3300025933 | Ga0207706_10078803 | Ga0207706_100788032 | 154 |
| 459 | 3300025938 | Ga0207704_10535421 | Ga0207704_105354212 | 154 |
| 460 | 3300025940 | Ga0207691_10021942 | Ga0207691_100219428 | 154 |
| 461 | 3300025941 | Ga0207711_10011304 | Ga0207711_100113044 | 154 |
| 462 | 3300025941 | Ga0207711_10045504 | Ga0207711_100455046 | 154 |
| 463 | 3300025941 | Ga0207711_10167201 | Ga0207711_101672013 | 154 |
| 464 | 3300025944 | Ga0207661_10013875 | Ga0207661_100138752 | 154 |
| 465 | 3300025944 | Ga0207661_10074814 | Ga0207661_100748142 | 154 |
| 466 | 3300025944 | Ga0207661_10084310 | Ga0207661_100843103 | 154 |
| 467 | 3300025944 | Ga0207661_10223204 | Ga0207661_102232042 | 154 |
| 468 | 3300025944 | Ga0207661_10357131 | Ga0207661_103571313 | 154 |
| 469 | 3300025945 | Ga0207679_10197601 | Ga0207679_101976012 | 154 |
| 470 | 3300025949 | Ga0207667_10004710 | Ga0207667_100047106 | 154 |
| 471 | 3300025949 | Ga0207667_10056357 | Ga0207667_100563574 | 154 |
| 472 | 3300025949 | Ga0207667_10087521 | Ga0207667_100875213 | 154 |
| 473 | 3300025949 | Ga0207667_10139171 | Ga0207667_101391712 | 154 |
| 474 | 3300025949 | Ga0207667_10151223 | Ga0207667_101512232 | 154 |
| 475 | 3300025960 | Ga0207651_10070728 | Ga0207651_100707282 | 154 |
| 476 | 3300025960 | Ga0207651_10522805 | Ga0207651_105228052 | 154 |
| 477 | 3300025981 | Ga0207640_10109202 | Ga0207640_101092022 | 154 |
| 478 | 3300025981 | Ga0207640_10880080 | Ga0207640_108800802 | 154 |
| 479 | 3300025981 | Ga0207640_11408518 | Ga0207640_114085181 | 154 |
| 480 | 3300025986 | Ga0207658_10588695 | Ga0207658_105886952 | 154 |
| 481 | 3300026035 | Ga0207703_10249409 | Ga0207703_102494091 | 154 |
| 482 | 3300026041 | Ga0207639_10000923 | Ga0207639_100009238 | 154 |
| 483 | 3300026041 | Ga0207639_10001159 | Ga0207639_1000115926 | 154 |
| 484 | 3300026041 | Ga0207639_10006431 | Ga0207639_100064319 | 154 |
| 485 | 3300026041 | Ga0207639_10049640 | Ga0207639_100496404 | 154 |
| 486 | 3300026041 | Ga0207639_10542721 | Ga0207639_105427212 | 154 |
| 487 | 3300026067 | Ga0207678_10001315 | Ga0207678_100013155 | 154 |
| 488 | 3300026067 | Ga0207678_10015007 | Ga0207678_100150072 | 154 |
| 489 | 3300026078 | Ga0207702_10002063 | Ga0207702_1000206328 | 154 |
| 490 | 3300026078 | Ga0207702_10037780 | Ga0207702_100377804 | 154 |
| 491 | 3300026078 | Ga0207702_10082186 | Ga0207702_100821863 | 154 |
| 492 | 3300026078 | Ga0207702_10207176 | Ga0207702_102071762 | 154 |
| 493 | 3300026078 | Ga0207702_10299371 | Ga0207702_102993712 | 154 |
| 494 | 3300026078 | Ga0207702_10896867 | Ga0207702_108968672 | 154 |
| 495 | 3300026088 | Ga0207641_10003063 | Ga0207641_100030632 | 154 |
| 496 | 3300026095 | Ga0207676_10001223 | Ga0207676_1000122324 | 154 |
| 497 | 3300026116 | Ga0207674_10019569 | Ga0207674_100195692 | 154 |
| 498 | 3300026116 | Ga0207674_10095577 | Ga0207674_100955774 | 154 |
| 499 | 3300026116 | Ga0207674_10118695 | Ga0207674_101186953 | 154 |
| 500 | 3300026116 | Ga0207674_10137434 | Ga0207674_101374342 | 154 |
| 501 | 3300026116 | Ga0207674_10189915 | Ga0207674_101899153 | 154 |
| 502 | 3300026116 | Ga0207674_10609387 | Ga0207674_106093871 | 154 |
| 503 | 3300026121 | Ga0207683_10049845 | Ga0207683_100498452 | 154 |
| 504 | 3300026142 | Ga0207698_10000896 | Ga0207698_100008966 | 154 |
| 505 | 3300026142 | Ga0207698_10008977 | Ga0207698_100089776 | 154 |
| 506 | 3300026142 | Ga0207698_10115877 | Ga0207698_101158773 | 154 |
| 507 | 3300026142 | Ga0207698_10490829 | Ga0207698_104908292 | 154 |
| 508 | 3300026142 | Ga0207698_11253623 | Ga0207698_112536232 | 154 |
| 509 | 3300028379 | Ga0268266_10744688 | Ga0268266_107446882 | 154 |
| 510 | 3300028380 | Ga0268265_10179851 | Ga0268265_101798512 | 154 |
| 511 | 3300031731 | Ga0307405_10347022 | Ga0307405_103470222 | 154 |
| 512 | 3300031824 | Ga0307413_10251110 | Ga0307413_102511102 | 154 |
| 513 | 3300031852 | Ga0307410_10102566 | Ga0307410_101025662 | 154 |
| 514 | 3300031901 | Ga0307406_10421097 | Ga0307406_104210972 | 154 |
| 515 | 3300031903 | Ga0307407_10015582 | Ga0307407_100155824 | 154 |
| 516 | 3300031911 | Ga0307412_10061430 | Ga0307412_100614302 | 154 |
| 517 | 3300031911 | Ga0307412_10260600 | Ga0307412_102606002 | 154 |
| 518 | 3300031995 | Ga0307409_100149142 | Ga0307409_1001491422 | 154 |
| 519 | 3300032002 | Ga0307416_100004552 | Ga0307416_1000045523 | 154 |
| 520 | 3300032002 | Ga0307416_100030216 | Ga0307416_1000302164 | 154 |
| 521 | 3300032004 | Ga0307414_10209728 | Ga0307414_102097282 | 154 |
| 522 | 3300032005 | Ga0307411_10026146 | Ga0307411_100261462 | 154 |
| 523 | 3300032126 | Ga0307415_100016305 | Ga0307415_1000163054 | 154 |
| 524 | 3300032126 | Ga0307415_100159749 | Ga0307415_1001597492 | 154 |
| 525 | 3300032126 | Ga0307415_100784867 | Ga0307415_1007848671 | 154 |
| 526 | 3300035111 | Ga0373923_0027553 | Ga0373923_0027553_1315_1857 | 154 |
| 527 | 3300035111 | Ga0373923_0330748 | Ga0373923_0330748_65_574 | 154 |
| 528 | 3300035113 | Ga0373936_0353480 | Ga0373936_0353480_84_626 | 154 |
| 529 | 3300035118 | Ga0373954_0033151 | Ga0373954_0033151_1498_2040 | 154 |
| 530 | 3300035170 | Ga0373943_0016672 | Ga0373943_0016672_2057_2602 | 154 |
| 531 | 3300035170 | Ga0373943_0148768 | Ga0373943_0148768_453_962 | 154 |
| 532 | 3300035171 | Ga0373946_0066336 | Ga0373946_0066336_636_1181 | 154 |
| 533 | 3300035172 | Ga0373955_0002727 | Ga0373955_0002727_1216_1758 | 154 |
| 534 | 3300035692 | Ga0373935_0018058 | Ga0373935_0018058_1325_1870 | 154 |
| 535 | 3300035695 | Ga0373927_0093144 | Ga0373927_0093144_1323_1868 | 154 |
| 536 | 3300035725 | Ga0373947_0316112 | Ga0373947_0316112_393_938 | 154 |
| 537 | 3300036401 | Ga0373937_0010753 | Ga0373937_0010753_3098_3670 | 154 |
| 538 | 3300037068 | Ga0373925_0010397 | Ga0373925_0010397_3479_4021 | 154 |
| 539 | 3300037068 | Ga0373925_0332683 | Ga0373925_0332683_302_811 | 154 |
| 540 | 3300037312 | Ga0395899_0014277 | Ga0395899_0014277_5401_5943 | 154 |
| 541 | 3300037312 | Ga0395899_0072949 | Ga0395899_0072949_1226_1759 | 154 |
| 542 | 3300037312 | Ga0395899_0118898 | Ga0395899_0118898_70_591 | 154 |
| 543 | 3300037312 | Ga0395899_0130064 | Ga0395899_0130064_944_1504 | 154 |
| 544 | 3300037312 | Ga0395899_0139822 | Ga0395899_0139822_1156_1689 | 154 |
| 545 | 3300037312 | Ga0395899_0306411 | Ga0395899_0306411_545_1060 | 154 |
| 546 | 3300037312 | Ga0395899_0375049 | Ga0395899_0375049_191_736 | 154 |
| 547 | 3300037312 | Ga0395899_0403037 | Ga0395899_0403037_128_661 | 154 |
| 548 | 3300037312 | Ga0395899_0411002 | Ga0395899_0411002_136_663 | 154 |
| 549 | 3300037312 | Ga0395899_0434941 | Ga0395899_0434941_107_622 | 154 |
| 550 | 3300037312 | Ga0395899_0660779 | Ga0395899_0660779_23_568 | 154 |
| 551 | 3300037418 | Ga0395900_0001779 | Ga0395900_0001779_5559_6110 | 154 |
| 552 | 3300037418 | Ga0395900_0003085 | Ga0395900_0003085_3939_4478 | 154 |
| 553 | 3300037418 | Ga0395900_0009276 | Ga0395900_0009276_5653_6213 | 154 |
| 554 | 3300037418 | Ga0395900_0033740 | Ga0395900_0033740_4461_5003 | 154 |
| 555 | 3300037418 | Ga0395900_0041814 | Ga0395900_0041814_136_663 | 154 |
| 556 | 3300037418 | Ga0395900_0060815 | Ga0395900_0060815_3124_3657 | 154 |
| 557 | 3300037418 | Ga0395900_0149524 | Ga0395900_0149524_207_728 | 154 |
| 558 | 3300037418 | Ga0395900_0198322 | Ga0395900_0198322_1489_2004 | 154 |
| 559 | 3300037418 | Ga0395900_0265514 | Ga0395900_0265514_966_1499 | 154 |
| 560 | 3300037418 | Ga0395900_0675836 | Ga0395900_0675836_214_759 | 154 |
| 561 | 3300037418 | Ga0395900_0679881 | Ga0395900_0679881_153_713 | 154 |
| 562 | 3300037418 | Ga0395900_0754379 | Ga0395900_0754379_47_583 | 154 |
| 563 | 3300037418 | Ga0395900_0778836 | Ga0395900_0778836_231_758 | 154 |
| 564 | 3300037418 | Ga0395900_1468576 | Ga0395900_1468576_33_569 | 154 |
| 565 | 3300037466 | Ga0395898_0011721 | Ga0395898_0011721_4242_4787 | 154 |
| 566 | 3300037466 | Ga0395898_0021270 | Ga0395898_0021270_1417_1959 | 154 |
| 567 | 3300037466 | Ga0395898_0052037 | Ga0395898_0052037_2201_2722 | 154 |
| 568 | 3300037466 | Ga0395898_0154726 | Ga0395898_0154726_1036_1587 | 154 |
| 569 | 3300037466 | Ga0395898_0379279 | Ga0395898_0379279_686_1213 | 154 |
| 570 | 3300037466 | Ga0395898_0500232 | Ga0395898_0500232_395_928 | 154 |
| 571 | 3300037466 | Ga0395898_0986595 | Ga0395898_0986595_116_643 | 154 |
| 572 | 3300037471 | Ga0395905_0000104 | Ga0395905_0000104_97059_97580 | 154 |
| 573 | 3300037471 | Ga0395905_0004102 | Ga0395905_0004102_4968_5519 | 154 |
| 574 | 3300037471 | Ga0395905_0008256 | Ga0395905_0008256_7656_8216 | 154 |
| 575 | 3300037471 | Ga0395905_0023579 | Ga0395905_0023579_211_753 | 154 |
| 576 | 3300037471 | Ga0395905_0029447 | Ga0395905_0029447_867_1382 | 154 |
| 577 | 3300037471 | Ga0395905_0034571 | Ga0395905_0034571_2675_3217 | 154 |
| 578 | 3300037471 | Ga0395905_0037718 | Ga0395905_0037718_3254_3793 | 154 |
| 579 | 3300037471 | Ga0395905_0045504 | Ga0395905_0045504_1744_2274 | 154 |
| 580 | 3300037471 | Ga0395905_0208860 | Ga0395905_0208860_140_676 | 154 |
| 581 | 3300037471 | Ga0395905_0244205 | Ga0395905_0244205_192_737 | 154 |
| 582 | 3300037471 | Ga0395905_0282967 | Ga0395905_0282967_136_663 | 154 |
| 583 | 3300037471 | Ga0395905_0478805 | Ga0395905_0478805_538_1041 | 154 |
| 584 | 3300037471 | Ga0395905_0517012 | Ga0395905_0517012_245_778 | 154 |
| 585 | 3300037471 | Ga0395905_0569978 | Ga0395905_0569978_303_836 | 154 |
| 586 | 3300037471 | Ga0395905_0647674 | Ga0395905_0647674_157_678 | 154 |
| 587 | 3300037471 | Ga0395905_0729105 | Ga0395905_0729105_136_663 | 154 |
| 588 | 3300037853 | Ga0436364_1387927 | Ga0436364_1387927_26899_27465 | 154 |
| 589 | 3300038443 | Ga0395901_0000589 | Ga0395901_0000589_229_762 | 154 |
| 590 | 3300038443 | Ga0395901_0000782 | Ga0395901_0000782_5561_6100 | 154 |
| 591 | 3300038443 | Ga0395901_0103175 | Ga0395901_0103175_2345_2887 | 154 |
| 592 | 3300038443 | Ga0395901_0131734 | Ga0395901_0131734_1008_1523 | 154 |
| 593 | 3300038443 | Ga0395901_0247424 | Ga0395901_0247424_1133_1648 | 154 |
| 594 | 3300038443 | Ga0395901_0262712 | Ga0395901_0262712_1134_1661 | 154 |
| 595 | 3300038443 | Ga0395901_0358393 | Ga0395901_0358393_399_944 | 154 |
| 596 | 3300038443 | Ga0395901_0827968 | Ga0395901_0827968_261_806 | 154 |
| 597 | 3300038443 | Ga0395901_0905836 | Ga0395901_0905836_28_588 | 154 |
| 598 | 3300041413 | Ga0439465_0022888 | Ga0439465_0022888_1115_1621 | 154 |
| 599 | 3300042007 | Ga0439449_0043119 | Ga0439449_0043119_928_1434 | 154 |
| 600 | 3300042157 | Ga0439458_0000590 | Ga0439458_0000590_5373_5903 | 154 |
| 601 | 3300044658 | Ga0466972_0005975 | Ga0466972_0005975_3987_4544 | 154 |
| 602 | 3300044658 | Ga0466972_0057561 | Ga0466972_0057561_1279_1830 | 154 |
| 603 | 3300044658 | Ga0466972_0073628 | Ga0466972_0073628_236_793 | 154 |
| 604 | 3300044683 | Ga0466965_0156053 | Ga0466965_0156053_155_706 | 154 |
| 605 | 3300044693 | Ga0466961_0149153 | Ga0466961_0149153_633_1193 | 154 |
| 606 | 3300044693 | Ga0466961_0307191 | Ga0466961_0307191_144_692 | 154 |
| 607 | 3300044693 | Ga0466961_0329009 | Ga0466961_0329009_229_789 | 154 |
| 608 | 3300044693 | Ga0466961_0490775 | Ga0466961_0490775_157_714 | 154 |
| 609 | 3300044694 | Ga0466963_0010200 | Ga0466963_0010200_3220_3762 | 154 |
| 610 | 3300044694 | Ga0466963_0073140 | Ga0466963_0073140_123_656 | 154 |
| 611 | 3300044694 | Ga0466963_0246625 | Ga0466963_0246625_504_1004 | 154 |
| 612 | 3300044694 | Ga0466963_0304119 | Ga0466963_0304119_25_561 | 154 |
| 613 | 3300044694 | Ga0466963_0422153 | Ga0466963_0422153_117_647 | 154 |
| 614 | 3300044694 | Ga0466963_0581271 | Ga0466963_0581271_193_771 | 154 |
| 615 | 3300044706 | Ga0466964_0151035 | Ga0466964_0151035_142_708 | 154 |
| 616 | 3300044719 | Ga0466971_0018356 | Ga0466971_0018356_652_1200 | 154 |
| 617 | 3300044719 | Ga0466971_0213122 | Ga0466971_0213122_21_572 | 154 |
| 618 | 3300044719 | Ga0466971_0310596 | Ga0466971_0310596_172_732 | 154 |
| 619 | 3300044735 | Ga0466968_0246394 | Ga0466968_0246394_88_645 | 154 |
| 620 | 3300044842 | Ga0466957_0039900 | Ga0466957_0039900_2038_2574 | 154 |
| 621 | 3300044842 | Ga0466957_0113584 | Ga0466957_0113584_1026_1583 | 154 |
| 622 | 3300044842 | Ga0466957_0184562 | Ga0466957_0184562_437_988 | 154 |
| 623 | 3300044842 | Ga0466957_0274535 | Ga0466957_0274535_415_912 | 154 |
| 624 | 3300044842 | Ga0466957_0346149 | Ga0466957_0346149_335_901 | 154 |
| 625 | 3300044842 | Ga0466957_0653508 | Ga0466957_0653508_93_593 | 154 |
| 626 | 3300044901 | Ga0466960_0047367 | Ga0466960_0047367_948_1505 | 154 |
| 627 | 3300045049 | Ga0466959_0219829 | Ga0466959_0219829_655_1194 | 154 |
| 628 | 3300045049 | Ga0466959_0480705 | Ga0466959_0480705_111_662 | 154 |
| 629 | 3300045836 | Ga0466958_0014825 | Ga0466958_0014825_970_1512 | 154 |
| 630 | 3300045836 | Ga0466958_0032340 | Ga0466958_0032340_2033_2569 | 154 |
| 631 | 3300045836 | Ga0466958_0202812 | Ga0466958_0202812_573_1124 | 154 |
| 632 | 3300045836 | Ga0466958_0282868 | Ga0466958_0282868_130_678 | 154 |
| 633 | 3300045976 | Ga0466967_0020005 | Ga0466967_0020005_3078_3608 | 154 |
| 634 | 3300045976 | Ga0466967_0088576 | Ga0466967_0088576_2176_2718 | 154 |
| 635 | 3300045976 | Ga0466967_0096507 | Ga0466967_0096507_1806_2372 | 154 |
| 636 | 3300045976 | Ga0466967_0210613 | Ga0466967_0210613_20_577 | 154 |
| 637 | 3300045976 | Ga0466967_0249305 | Ga0466967_0249305_175_708 | 154 |
| 638 | 3300045976 | Ga0466967_0297358 | Ga0466967_0297358_255_755 | 154 |
| 639 | 3300045976 | Ga0466967_0813755 | Ga0466967_0813755_249_785 | 154 |
| 640 | 3300045976 | Ga0466967_0820870 | Ga0466967_0820870_183_725 | 154 |
| 641 | 3300045976 | Ga0466967_0893570 | Ga0466967_0893570_145_675 | 154 |
| 642 | 3300045976 | Ga0466967_1531166 | Ga0466967_1531166_121_651 | 154 |
| 643 | 3300046525 | Ga0495663_0011260 | Ga0495663_0011260_1808_2338 | 154 |
| 644 | 3300046679 | Ga0495623_0019538 | Ga0495623_0019538_2630_3172 | 154 |
| 645 | 3300046681 | Ga0495647_0348113 | Ga0495647_0348113_55_570 | 154 |
| 646 | 3300046684 | Ga0495669_0057703 | Ga0495669_0057703_1141_1641 | 154 |
| 647 | 3300046684 | Ga0495669_0387596 | Ga0495669_0387596_100_630 | 154 |
| 648 | 3300048088 | Ga0495602_0091257 | Ga0495602_0091257_1488_2066 | 154 |
| 649 | 3300048904 | Ga0496101_0457142 | Ga0496101_0457142_55_582 | 154 |
| 650 | 3300048905 | Ga0496102_0346638 | Ga0496102_0346638_50_577 | 154 |
| 651 | 3300048905 | Ga0496102_0366584 | Ga0496102_0366584_133_663 | 154 |
| 652 | 3300048907 | Ga0496104_0137509 | Ga0496104_0137509_1715_2269 | 154 |
| 653 | 3300048908 | Ga0496105_0182962 | Ga0496105_0182962_675_1229 | 154 |
| 654 | 3300048909 | Ga0496106_0082568 | Ga0496106_0082568_1696_2223 | 154 |
| 655 | 3300048910 | Ga0496107_0011494 | Ga0496107_0011494_2419_2973 | 154 |
| 656 | 3300048910 | Ga0496107_0131555 | Ga0496107_0131555_237_746 | 154 |
| 657 | 3300048911 | Ga0496108_0515020 | Ga0496108_0515020_115_669 | 154 |
| 658 | 3300048912 | Ga0496109_0061186 | Ga0496109_0061186_2645_3172 | 154 |
| 659 | 3300048912 | Ga0496109_0068968 | Ga0496109_0068968_48_602 | 154 |
| 660 | 3300048912 | Ga0496109_0467267 | Ga0496109_0467267_222_722 | 154 |
| 661 | 3300048913 | Ga0496110_0025175 | Ga0496110_0025175_1774_2328 | 154 |
| 662 | 3300048913 | Ga0496110_0033905 | Ga0496110_0033905_1653_2180 | 154 |
| 663 | 3300048913 | Ga0496110_0042482 | Ga0496110_0042482_749_1252 | 154 |
| 664 | 3300048913 | Ga0496110_0881018 | Ga0496110_0881018_28_558 | 154 |
| 665 | 3300048914 | Ga0496111_0002376 | Ga0496111_0002376_2934_3461 | 154 |
| 666 | 3300048914 | Ga0496111_0029259 | Ga0496111_0029259_2777_3331 | 154 |
| 667 | 3300048915 | Ga0496112_0040418 | Ga0496112_0040418_1608_2162 | 154 |
| 668 | 3300048915 | Ga0496112_0068145 | Ga0496112_0068145_321_866 | 154 |
| 669 | 3300048915 | Ga0496112_0143489 | Ga0496112_0143489_963_1463 | 154 |
| 670 | 3300048915 | Ga0496112_0443531 | Ga0496112_0443531_71_574 | 154 |
| 671 | 3300048916 | Ga0496113_0010921 | Ga0496113_0010921_914_1468 | 154 |
| 672 | 3300048916 | Ga0496113_0011965 | Ga0496113_0011965_604_1131 | 154 |
| 673 | 3300048916 | Ga0496113_0054432 | Ga0496113_0054432_95_625 | 154 |
| 674 | 3300049668 | Ga0501233_005985 | Ga0501233_005985_880_1386 | 154 |
| 675 | 3300049677 | Ga0501247_027531 | Ga0501247_027531_34_540 | 154 |
| 676 | 3300049679 | Ga0501249_018314 | Ga0501249_018314_396_902 | 154 |
| 677 | 3300049769 | Ga0501272_001757 | Ga0501272_001757_664_1170 | 154 |
| 678 | 3300049770 | Ga0501273_010041 | Ga0501273_010041_529_1035 | 154 |
| 679 | 3300059490 | Ga0587066_046458 | Ga0587066_046458_218_760 | 154 |
| 680 | 3300059503 | Ga0587080_010228 | Ga0587080_010228_214_756 | 154 |
| 681 | 3300059510 | Ga0587090_010448 | Ga0587090_010448_29_571 | 154 |
| 682 | 3300059630 | Ga0587128_026224 | Ga0587128_026224_71_613 | 154 |
| 683 | 3300059644 | Ga0587075_016693 | Ga0587075_016693_92_634 | 154 |
| 684 | 3300059647 | Ga0587079_075714 | Ga0587079_075714_119_661 | 154 |
| 685 | 3300061719 | Ga0466962_0006344 | Ga0466962_0006344_3892_4434 | 154 |
| 686 | 3300061719 | Ga0466962_0015820 | Ga0466962_0015820_341_892 | 154 |
| 687 | 3300061719 | Ga0466962_0330471 | Ga0466962_0330471_67_615 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2l2s-assembly1.cif.gz_A | solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine | 0.8723 | 46 | 149 |
| 3vaw-assembly1.cif.gz_A | crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase with surface mutation v3i from burkholderia pseudomallei complexed with fk506 | 0.8477 | 44 | 150 |
| 7dki-assembly2.cif.gz_B | silk worm fkbp, isoform-1 | 0.847 | 49 | 151 |
| 4ipx-assembly1.cif.gz_A | analyzing the visible conformational substates of the fk506 binding protein fkbp12 | 0.8468 | 49 | 151 |
| 5klx-assembly2.cif.gz_B | crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf110 | 0.844 | 41 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8I4E5_192_283_3.10.50.40 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8951 | 49 | 119 | 3.10.50.40 |
| 1q6uA02 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8441 | 49 | 153 | 3.10.50.40 |
| af_Q95Q60_176_299_3.10.50.40 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8427 | 46 | 154 | 3.10.50.40 |
| 5xb0A02 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8396 | 49 | 153 | 3.10.50.40 |
| 4bf8A00 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.8384 | 46 | 151 | 3.10.50.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G8CLM2-F1-model_v4 | deleted | 0.8665 | 46 | 151 |
|
| AF-A0A447LS44-F1-model_v4 | deleted | 0.8648 | 46 | 154 |
|
| AF-A0A7X3V2A0-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) | 0.8574 | 45 | 154 |
GO:0003755
|
| AF-A0A7S1VTK7-F1-model_v4 | peptidylprolyl isomerase (EC 5.2.1.8) | 0.8572 | 48 | 154 |
GO:0003755
GO:0005783 GO:0061077 |
| AF-A0A2V5LIT3-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) | 0.8527 | 46 | 153 |
GO:0006457
GO:0140839 GO:0140840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar