F475272

General Info

Members Datasets Scaffolds Average Seq Length
687 227 687 160

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0073628|Ga0466972_0073628_236_793
Length 185
Sequence VSVAEAAHRPARTGRAAALWIAFLVVIAAGVGLAWAGAGALRPEVTSSGLQFRTIKAGKGEVIHQDDAAMIDYIGTLDDGTVFDTSQNHGGAQPFTMGAVFPGFAEAMARMQEGGRYRFTMPPRLAFGNKPPPQGFPANSNLTFEVQVQKVVRGGAALMGAGPAPQQPPQGDQSMPPEQMEQMAH

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
212 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
219 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 4.95
Rhizosphere 94.32
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1011162 3300001904 Bacteria 1464
2 JGI24740J21852_10011466 3300001979 Bacteria 3372
3 JGI24740J21852_10027078 3300001979 Bacteria 1912
4 JGI24740J21852_10032137 3300001979 Bacteria 1682
5 JGI24739J22299_10006645 3300001989 Bacteria 4354
6 JGI24737J22298_10005144 3300001990 Bacteria 4528
7 JGI24735J21928_10004145 3300002067 Bacteria 4895
8 JGI24735J21928_10018977 3300002067 Bacteria 2118
9 rootH2_10095679 3300003320 Bacteria 1437
10 rootH1_10146668 3300003323 Bacteria 1574
11 Ga0070658_10014069 3300005327 Bacteria 6425
12 Ga0070658_10095418 3300005327 Bacteria 2455
13 Ga0070658_10115125 3300005327 Bacteria 2230
14 Ga0070658_10190689 3300005327 Bacteria 1727
15 Ga0070658_10382658 3300005327 Bacteria 1207
16 Ga0070658_10453259 3300005327 Bacteria 1105
17 Ga0070658_10457148 3300005327 Bacteria 1100
18 Ga0070658_10475136 3300005327 Bacteria 1078
19 Ga0070658_10603367 3300005327 Bacteria 951
20 Ga0070676_10396100 3300005328 Bacteria 960
21 Ga0070683_100009832 3300005329 Bacteria 8195
22 Ga0070683_100014717 3300005329 Bacteria 6852
23 Ga0070683_100034868 3300005329 Bacteria 4599
24 Ga0070683_100093133 3300005329 Bacteria 2830
25 Ga0070683_100430693 3300005329 Bacteria 1258
26 Ga0070683_100788728 3300005329 Bacteria 911
27 Ga0070690_100208589 3300005330 Bacteria 1363
28 Ga0070690_100604591 3300005330 Bacteria 833
29 Ga0070670_100037964 3300005331 Bacteria 4142
30 Ga0070670_100140991 3300005331 Bacteria 2084
31 Ga0070670_100309142 3300005331 Bacteria 1383
32 Ga0070677_10359569 3300005333 Unclassified 756
33 Ga0068869_100646279 3300005334 Bacteria 897
34 Ga0070666_10002971 3300005335 Bacteria 10286
35 Ga0070666_10053690 3300005335 Bacteria 2718
36 Ga0070666_10241481 3300005335 Bacteria 1277
37 Ga0070680_100001257 3300005336 Bacteria 18304
38 Ga0070680_100145622 3300005336 Bacteria 1987
39 Ga0070680_100233016 3300005336 Bacteria 1555
40 Ga0070680_100341447 3300005336 Bacteria 1272
41 Ga0070682_100062528 3300005337 Bacteria 2358
42 Ga0070682_100240793 3300005337 Bacteria 1298
43 Ga0070682_100297181 3300005337 Bacteria 1183
44 Ga0070682_100590144 3300005337 Bacteria 875
45 Ga0070682_100676506 3300005337 Bacteria 825
46 Ga0068868_100012920 3300005338 Bacteria 6109
47 Ga0068868_100074382 3300005338 Bacteria 2713
48 Ga0068868_100335976 3300005338 Bacteria 1291
49 Ga0070660_100029369 3300005339 Bacteria 4120
50 Ga0070660_100036347 3300005339 Bacteria 3730
51 Ga0070660_100046930 3300005339 Bacteria 3312
52 Ga0070660_100057029 3300005339 Bacteria 3024
53 Ga0070660_100060814 3300005339 Bacteria 2932
54 Ga0070660_100082500 3300005339 Bacteria 2524
55 Ga0070660_100192238 3300005339 Bacteria 1653
56 Ga0070660_100599932 3300005339 Bacteria 921
57 Ga0070660_100777800 3300005339 Bacteria 804
58 Ga0070660_100860822 3300005339 Bacteria 763
59 Ga0070660_100864870 3300005339 Bacteria 762
60 Ga0070691_10003582 3300005341 Bacteria 7010
61 Ga0070661_100033437 3300005344 Bacteria 3724
62 Ga0070661_100057595 3300005344 Bacteria 2847
63 Ga0070661_100115944 3300005344 Bacteria 2003
64 Ga0070661_100119212 3300005344 Bacteria 1975
65 Ga0070661_100125604 3300005344 Bacteria 1924
66 Ga0070661_100132596 3300005344 Bacteria 1872
67 Ga0070661_100255546 3300005344 Bacteria 1353
68 Ga0070661_100425149 3300005344 Bacteria 1053
69 Ga0070661_100430133 3300005344 Bacteria 1047
70 Ga0070661_100663233 3300005344 Bacteria 847
71 Ga0070661_100765250 3300005344 Bacteria 790
72 Ga0070692_10006534 3300005345 Bacteria 5069
73 Ga0070692_10013273 3300005345 Bacteria 3836
74 Ga0070692_10072159 3300005345 Bacteria 1841
75 Ga0070692_10107622 3300005345 Bacteria 1537
76 Ga0070675_100222134 3300005354 Bacteria 1645
77 Ga0070675_100354570 3300005354 Bacteria 1301
78 Ga0070671_100024137 3300005355 Bacteria 4977
79 Ga0070671_100079772 3300005355 Bacteria 2736
80 Ga0070671_100223230 3300005355 Bacteria 1598
81 Ga0070671_100479706 3300005355 Bacteria 1068
82 Ga0070674_100198542 3300005356 Bacteria 1547
83 Ga0070674_100218520 3300005356 Bacteria 1481
84 Ga0070674_100263739 3300005356 Bacteria 1358
85 Ga0070674_100402675 3300005356 Bacteria 1118
86 Ga0070673_100000526 3300005364 Bacteria 20563
87 Ga0070673_100075965 3300005364 Bacteria 2711
88 Ga0070673_100230514 3300005364 Bacteria 1606
89 Ga0070673_100895869 3300005364 Bacteria 822
90 Ga0070659_100033445 3300005366 Bacteria 3993
91 Ga0070659_100033606 3300005366 Bacteria 3984
92 Ga0070659_100045336 3300005366 Bacteria 3444
93 Ga0070659_100083906 3300005366 Bacteria 2547
94 Ga0070659_100381841 3300005366 Bacteria 1187
95 Ga0070659_100420236 3300005366 Bacteria 1131
96 Ga0070659_100443303 3300005366 Bacteria 1100
97 Ga0070659_100475719 3300005366 Bacteria 1062
98 Ga0070659_100775901 3300005366 Bacteria 832
99 Ga0070659_100897391 3300005366 Bacteria 774
100 Ga0070667_100013712 3300005367 Bacteria 6698
101 Ga0070667_100053826 3300005367 Bacteria 3397
102 Ga0070667_100056858 3300005367 Bacteria 3305
103 Ga0070667_100405460 3300005367 Bacteria 1241
104 Ga0070714_100224928 3300005435 Bacteria 1726
105 Ga0070714_100450504 3300005435 Bacteria 1222
106 Ga0070714_100715804 3300005435 Bacteria 966
107 Ga0070714_100754447 3300005435 Bacteria 941
108 Ga0070714_101482018 3300005435 Bacteria 663
109 Ga0070713_100604964 3300005436 Unclassified 1042
110 Ga0070663_100025115 3300005455 Bacteria 4020
111 Ga0070663_100053289 3300005455 Bacteria 2887
112 Ga0070663_100078053 3300005455 Bacteria 2426
113 Ga0070663_100397770 3300005455 Bacteria 1125
114 Ga0070663_100720413 3300005455 Bacteria 849
115 Ga0070678_100026409 3300005456 Bacteria 3925
116 Ga0070678_100031044 3300005456 Bacteria 3680
117 Ga0070678_100185955 3300005456 Bacteria 1705
118 Ga0070662_100028447 3300005457 Bacteria 3889
119 Ga0070662_100031341 3300005457 Bacteria 3731
120 Ga0070662_100359996 3300005457 Bacteria 1193
121 Ga0070662_100689245 3300005457 Bacteria 864
122 Ga0070681_10074936 3300005458 Bacteria 3344
123 Ga0070681_10135295 3300005458 Bacteria 2395
124 Ga0070681_10190802 3300005458 Bacteria 1968
125 Ga0070681_10421602 3300005458 Bacteria 1246
126 Ga0070681_10956825 3300005458 Bacteria 775
127 Ga0068867_100173257 3300005459 Bacteria 1710
128 Ga0068867_100224100 3300005459 Bacteria 1517
129 Ga0070685_10175839 3300005466 Bacteria 1374
130 Ga0070679_100038807 3300005530 Bacteria 4735
131 Ga0070679_100089715 3300005530 Bacteria 3061
132 Ga0070679_100624713 3300005530 Bacteria 1020
133 Ga0070679_101081056 3300005530 Bacteria 747
134 Ga0070684_100002671 3300005535 Bacteria 13167
135 Ga0070684_100034298 3300005535 Bacteria 4338
136 Ga0070684_100043830 3300005535 Bacteria 3865
137 Ga0070684_100131444 3300005535 Bacteria 2258
138 Ga0070684_100958225 3300005535 Bacteria 802
139 Ga0068853_100041268 3300005539 Bacteria 3940
140 Ga0068853_100043066 3300005539 Bacteria 3862
141 Ga0068853_100136876 3300005539 Bacteria 2196
142 Ga0068853_100182314 3300005539 Bacteria 1904
143 Ga0068853_100430520 3300005539 Bacteria 1238
144 Ga0068853_100468473 3300005539 Bacteria 1186
145 Ga0068853_101021086 3300005539 Bacteria 796
146 Ga0070672_100047900 3300005543 Bacteria 3318
147 Ga0070672_100363492 3300005543 Bacteria 1235
148 Ga0070672_100387372 3300005543 Bacteria 1196
149 Ga0070672_100563974 3300005543 Bacteria 989
150 Ga0070672_101433130 3300005543 Bacteria 618
151 Ga0070686_100608762 3300005544 Bacteria 862
152 Ga0070686_100744368 3300005544 Bacteria 786
153 Ga0070665_100040150 3300005548 Bacteria 4704
154 Ga0070665_100659351 3300005548 Bacteria 1059
155 Ga0068855_100025356 3300005563 Bacteria 7095
156 Ga0068855_100112774 3300005563 Bacteria 3120
157 Ga0068855_100115015 3300005563 Bacteria 3084
158 Ga0068855_100136178 3300005563 Bacteria 2802
159 Ga0068855_100394981 3300005563 Bacteria 1516
160 Ga0068855_100725812 3300005563 Bacteria 1061
161 Ga0070664_100006591 3300005564 Bacteria 9361
162 Ga0070664_100055897 3300005564 Bacteria 3353
163 Ga0070664_100113509 3300005564 Bacteria 2366
164 Ga0070664_100336421 3300005564 Bacteria 1370
165 Ga0070664_100349063 3300005564 Bacteria 1345
166 Ga0070664_100816447 3300005564 Bacteria 872
167 Ga0070664_100821839 3300005564 Bacteria 869
168 Ga0070664_101036703 3300005564 Bacteria 771
169 Ga0068857_100031248 3300005577 Bacteria 4705
170 Ga0068857_100039427 3300005577 Bacteria 4184
171 Ga0068857_100200012 3300005577 Bacteria 1821
172 Ga0068857_101122619 3300005577 Bacteria 760
173 Ga0068854_100033977 3300005578 Bacteria 3558
174 Ga0068854_100083539 3300005578 Bacteria 2361
175 Ga0068854_100106600 3300005578 Bacteria 2108
176 Ga0068854_100557858 3300005578 Bacteria 972
177 Ga0068856_100008253 3300005614 Bacteria 10152
178 Ga0068856_100251514 3300005614 Bacteria 1782
179 Ga0068856_100274052 3300005614 Bacteria 1703
180 Ga0068856_100900673 3300005614 Archaea 903
181 Ga0068856_100976439 3300005614 Bacteria 865
182 Ga0068856_101130044 3300005614 Bacteria 800
183 Ga0068856_101393909 3300005614 Bacteria 715
184 Ga0068852_100013451 3300005616 Bacteria 6265
185 Ga0068852_100030542 3300005616 Bacteria 4437
186 Ga0068852_100031074 3300005616 Bacteria 4402
187 Ga0068852_100125836 3300005616 Bacteria 2353
188 Ga0068852_100187856 3300005616 Bacteria 1947
189 Ga0068852_100221775 3300005616 Bacteria 1798
190 Ga0068852_100244841 3300005616 Bacteria 1715
191 Ga0068852_100279679 3300005616 Bacteria 1608
192 Ga0068852_100445873 3300005616 Bacteria 1280
193 Ga0068852_100812574 3300005616 Bacteria 949
194 Ga0068852_101128342 3300005616 Bacteria 804
195 Ga0068852_101629976 3300005616 Bacteria 668
196 Ga0068859_100221584 3300005617 Bacteria 1979
197 Ga0068859_100437124 3300005617 Bacteria 1404
198 Ga0068859_100914628 3300005617 Bacteria 962
199 Ga0068864_100038826 3300005618 Bacteria 4067
200 Ga0068864_100758205 3300005618 Bacteria 951
201 Ga0068866_10061662 3300005718 Bacteria 1948
202 Ga0068851_10008280 3300005834 Bacteria 4802
203 Ga0068851_10013866 3300005834 Bacteria 3818
204 Ga0068851_10283083 3300005834 Bacteria 949
205 Ga0068851_10314946 3300005834 Bacteria 903
206 Ga0068851_10383426 3300005834 Bacteria 824
207 Ga0068863_100145598 3300005841 Bacteria 2266
208 Ga0068858_100013510 3300005842 Bacteria 7704
209 Ga0068858_100019414 3300005842 Bacteria 6356
210 Ga0068858_100069226 3300005842 Bacteria 3271
211 Ga0068858_101088491 3300005842 Bacteria 784
212 Ga0068860_100205460 3300005843 Bacteria 1910
213 Ga0068862_100028027 3300005844 Bacteria 4743
214 Ga0081539_10071515 3300005985 Bacteria 1857
215 Ga0097621_100174739 3300006237 Bacteria 1853
216 Ga0097621_100524608 3300006237 Bacteria 1075
217 Ga0097621_101112956 3300006237 Bacteria 742
218 Ga0068871_100716564 3300006358 Bacteria 917
219 Ga0068865_100124170 3300006881 Bacteria 1924
220 Ga0068865_101045468 3300006881 Bacteria 717
221 Ga0097620_100221567 3300006931 Bacteria 1979
222 Ga0097620_100437147 3300006931 Bacteria 1404
223 Ga0097620_100914616 3300006931 Bacteria 962
224 Ga0105250_10008228 3300009092 Bacteria 4440
225 Ga0105245_10611651 3300009098 Bacteria 1117
226 Ga0105247_10092011 3300009101 Bacteria 1927
227 Ga0105241_10503243 3300009174 Bacteria 1081
228 Ga0105248_10001135 3300009177 Bacteria 29633
229 Ga0105248_10019178 3300009177 Bacteria 7567
230 Ga0105248_10201147 3300009177 Bacteria 2244
231 Ga0105248_11141514 3300009177 Bacteria 881
232 Ga0105249_10089043 3300009553 Bacteria 2884
233 Ga0157373_10014974 3300013100 Bacteria 5675
234 Ga0157373_10438077 3300013100 Bacteria 939
235 Ga0157373_10518954 3300013100 Bacteria 862
236 Ga0157373_10748786 3300013100 Bacteria 718
237 Ga0157371_10078304 3300013102 Bacteria 2342
238 Ga0157370_10055585 3300013104 Bacteria 3770
239 Ga0157370_10114252 3300013104 Bacteria 2522
240 Ga0157370_10892455 3300013104 Bacteria 807
241 Ga0157369_10127638 3300013105 Bacteria 2696
242 Ga0157369_10175882 3300013105 Bacteria 2253
243 Ga0157369_10872117 3300013105 Bacteria 924
244 Ga0157369_10881274 3300013105 Bacteria 918
245 Ga0157374_10222841 3300013296 Bacteria 1851
246 Ga0157374_10947297 3300013296 Bacteria 879
247 Ga0157374_11024352 3300013296 Bacteria 845
248 Ga0163162_10089421 3300013306 Bacteria 3160
249 Ga0163162_11228716 3300013306 Bacteria 851
250 Ga0157372_10698367 3300013307 Bacteria 1181
251 Ga0157372_10886448 3300013307 Bacteria 1035
252 Ga0157372_11139254 3300013307 Bacteria 902
253 Ga0157372_11880512 3300013307 Bacteria 688
254 Ga0157375_11130288 3300013308 Bacteria 918
255 Ga0163163_10000735 3300014325 Bacteria 27886
256 Ga0157380_11236428 3300014326 Bacteria 792
257 Ga0182008_10538462 3300014497 Bacteria 647
258 Ga0157379_10012216 3300014968 Bacteria 7500
259 Ga0157379_10330763 3300014968 Bacteria 1392
260 Ga0157376_10338846 3300014969 Bacteria 1435
261 Ga0197907_11114687 3300020069 Bacteria 855
262 Ga0206352_10095400 3300020078 Bacteria 1198
263 Ga0206354_10226857 3300020081 Bacteria 1335
264 Ga0206354_11230177 3300020081 Bacteria 748
265 Ga0206353_11563947 3300020082 Bacteria 2096
266 Ga0213875_10011498 3300021388 Bacteria 4402
267 Ga0207697_10084026 3300025315 Bacteria 1343
268 Ga0207656_10008268 3300025321 Bacteria 3821
269 Ga0207656_10038801 3300025321 Bacteria 2011
270 Ga0207656_10239381 3300025321 Bacteria 886
271 Ga0207656_10302101 3300025321 Bacteria 792
272 Ga0207680_10008315 3300025903 Bacteria 5085
273 Ga0207680_10200759 3300025903 Bacteria 1359
274 Ga0207680_10284731 3300025903 Bacteria 1149
275 Ga0207680_10331744 3300025903 Bacteria 1065
276 Ga0207647_10010648 3300025904 Bacteria 6483
277 Ga0207647_10030159 3300025904 Bacteria 3502
278 Ga0207647_10108722 3300025904 Bacteria 1640
279 Ga0207647_10118329 3300025904 Bacteria 1563
280 Ga0207647_10218361 3300025904 Bacteria 1099
281 Ga0207645_10038053 3300025907 Bacteria 3086
282 Ga0207645_10216303 3300025907 Bacteria 1262
283 Ga0207705_10000493 3300025909 Bacteria 33656
284 Ga0207705_10004262 3300025909 Bacteria 10832
285 Ga0207705_10028284 3300025909 Bacteria 3996
286 Ga0207705_10057414 3300025909 Bacteria 2807
287 Ga0207705_10095986 3300025909 Bacteria 2176
288 Ga0207654_10442327 3300025911 Bacteria 910
289 Ga0207707_10017647 3300025912 Bacteria 6225
290 Ga0207707_10039480 3300025912 Bacteria 4125
291 Ga0207707_10606412 3300025912 Bacteria 926
292 Ga0207695_10154693 3300025913 Bacteria 2229
293 Ga0207671_10024193 3300025914 Bacteria 4570
294 Ga0207671_10028319 3300025914 Bacteria 4186
295 Ga0207660_10003208 3300025917 Bacteria 10700
296 Ga0207660_10045526 3300025917 Bacteria 3091
297 Ga0207660_10054697 3300025917 Bacteria 2849
298 Ga0207660_10189837 3300025917 Bacteria 1599
299 Ga0207657_10009734 3300025919 Bacteria 9638
300 Ga0207657_10015926 3300025919 Bacteria 7264
301 Ga0207657_10017883 3300025919 Bacteria 6784
302 Ga0207657_10039647 3300025919 Bacteria 4184
303 Ga0207657_10052428 3300025919 Bacteria 3540
304 Ga0207657_10072347 3300025919 Bacteria 2917
305 Ga0207657_10084906 3300025919 Bacteria 2653
306 Ga0207657_10091364 3300025919 Bacteria 2539
307 Ga0207657_10121371 3300025919 Bacteria 2150
308 Ga0207657_10174931 3300025919 Bacteria 1738
309 Ga0207657_10240584 3300025919 Bacteria 1445
310 Ga0207649_10012535 3300025920 Bacteria 4707
311 Ga0207649_10049759 3300025920 Bacteria 2590
312 Ga0207649_10054438 3300025920 Bacteria 2490
313 Ga0207649_10081183 3300025920 Bacteria 2099
314 Ga0207649_10189677 3300025920 Bacteria 1445
315 Ga0207649_10194158 3300025920 Bacteria 1430
316 Ga0207649_10224026 3300025920 Bacteria 1341
317 Ga0207649_10227042 3300025920 Bacteria 1333
318 Ga0207649_10340610 3300025920 Bacteria 1107
319 Ga0207652_10000034 3300025921 Bacteria 138571
320 Ga0207652_10009794 3300025921 Bacteria 7714
321 Ga0207652_10579561 3300025921 Bacteria 1007
322 Ga0207694_10024170 3300025924 Bacteria 4614
323 Ga0207694_10569298 3300025924 Bacteria 952
324 Ga0207650_10005864 3300025925 Bacteria 8386
325 Ga0207650_10052898 3300025925 Bacteria 3009
326 Ga0207659_10163770 3300025926 Bacteria 1748
327 Ga0207687_10399981 3300025927 Bacteria 1129
328 Ga0207687_10406899 3300025927 Bacteria 1120
329 Ga0207700_11114265 3300025928 Bacteria 706
330 Ga0207700_11267147 3300025928 Unclassified 657
331 Ga0207664_10434529 3300025929 Bacteria 1170
332 Ga0207664_10647739 3300025929 Bacteria 949
333 Ga0207644_10000614 3300025931 Bacteria 22677
334 Ga0207644_10006207 3300025931 Bacteria 7793
335 Ga0207644_10017567 3300025931 Bacteria 4835
336 Ga0207644_10051182 3300025931 Bacteria 2964
337 Ga0207644_10092846 3300025931 Bacteria 2252
338 Ga0207644_10629129 3300025931 Bacteria 892
339 Ga0207690_10004475 3300025932 Bacteria 8254
340 Ga0207690_10029270 3300025932 Bacteria 3499
341 Ga0207690_10292984 3300025932 Bacteria 1271
342 Ga0207690_10678778 3300025932 Bacteria 846
343 Ga0207706_10068152 3300025933 Bacteria 3131
344 Ga0207706_10078243 3300025933 Bacteria 2908
345 Ga0207706_10078803 3300025933 Bacteria 2897
346 Ga0207706_10308681 3300025933 Bacteria 1378
347 Ga0207669_10145946 3300025937 Bacteria 1650
348 Ga0207669_10157753 3300025937 Bacteria 1598
349 Ga0207704_10535421 3300025938 Bacteria 950
350 Ga0207704_10566616 3300025938 Bacteria 925
351 Ga0207691_10021942 3300025940 Bacteria 6024
352 Ga0207691_10031381 3300025940 Bacteria 4960
353 Ga0207691_10200721 3300025940 Bacteria 1736
354 Ga0207691_10202556 3300025940 Bacteria 1727
355 Ga0207691_10301247 3300025940 Bacteria 1377
356 Ga0207711_10000617 3300025941 Bacteria 35805
357 Ga0207711_10006917 3300025941 Bacteria 9525
358 Ga0207711_10007240 3300025941 Bacteria 9299
359 Ga0207711_10011304 3300025941 Bacteria 7417
360 Ga0207711_10020622 3300025941 Bacteria 5500
361 Ga0207711_10033837 3300025941 Bacteria 4326
362 Ga0207711_10045504 3300025941 Bacteria 3750
363 Ga0207711_10062395 3300025941 Bacteria 3215
364 Ga0207711_10167201 3300025941 Bacteria 1994
365 Ga0207661_10009979 3300025944 Bacteria 6823
366 Ga0207661_10013875 3300025944 Bacteria 5888
367 Ga0207661_10074814 3300025944 Bacteria 2777
368 Ga0207661_10084310 3300025944 Bacteria 2631
369 Ga0207661_10223204 3300025944 Bacteria 1666
370 Ga0207661_10357131 3300025944 Bacteria 1319
371 Ga0207679_10197601 3300025945 Bacteria 1677
372 Ga0207667_10004710 3300025949 Bacteria 16697
373 Ga0207667_10049976 3300025949 Bacteria 4413
374 Ga0207667_10056357 3300025949 Bacteria 4129
375 Ga0207667_10087521 3300025949 Bacteria 3222
376 Ga0207667_10139171 3300025949 Bacteria 2499
377 Ga0207667_10151223 3300025949 Bacteria 2389
378 Ga0207651_10029038 3300025960 Bacteria 3498
379 Ga0207651_10070728 3300025960 Bacteria 2470
380 Ga0207651_10136569 3300025960 Bacteria 1887
381 Ga0207651_10501556 3300025960 Bacteria 1049
382 Ga0207651_10522805 3300025960 Bacteria 1028
383 Ga0207640_10109202 3300025981 Bacteria 1957
384 Ga0207640_10880080 3300025981 Bacteria 781
385 Ga0207640_11408518 3300025981 Unclassified 625
386 Ga0207658_10084342 3300025986 Bacteria 2444
387 Ga0207658_10392824 3300025986 Bacteria 1217
388 Ga0207658_10588695 3300025986 Bacteria 998
389 Ga0207677_10006373 3300026023 Bacteria 6471
390 Ga0207677_10371048 3300026023 Bacteria 1205
391 Ga0207677_10484598 3300026023 Bacteria 1066
392 Ga0207703_10249409 3300026035 Bacteria 1599
393 Ga0207639_10000923 3300026041 Bacteria 19909
394 Ga0207639_10001159 3300026041 Bacteria 17877
395 Ga0207639_10006431 3300026041 Bacteria 7988
396 Ga0207639_10049640 3300026041 Bacteria 3183
397 Ga0207639_10112941 3300026041 Bacteria 2218
398 Ga0207639_10278547 3300026041 Bacteria 1470
399 Ga0207639_10542721 3300026041 Bacteria 1067
400 Ga0207678_10001315 3300026067 Bacteria 22977
401 Ga0207678_10015007 3300026067 Bacteria 6816
402 Ga0207678_10017638 3300026067 Bacteria 6266
403 Ga0207702_10002063 3300026078 Bacteria 19455
404 Ga0207702_10037780 3300026078 Bacteria 4043
405 Ga0207702_10082186 3300026078 Bacteria 2800
406 Ga0207702_10207176 3300026078 Bacteria 1821
407 Ga0207702_10299371 3300026078 Bacteria 1526
408 Ga0207702_10896867 3300026078 Bacteria 878
409 Ga0207641_10003063 3300026088 Bacteria 15070
410 Ga0207648_10059945 3300026089 Bacteria 3319
411 Ga0207676_10001223 3300026095 Bacteria 19146
412 Ga0207674_10019569 3300026116 Bacteria 7331
413 Ga0207674_10095577 3300026116 Bacteria 2957
414 Ga0207674_10118695 3300026116 Bacteria 2615
415 Ga0207674_10137434 3300026116 Bacteria 2405
416 Ga0207674_10189915 3300026116 Bacteria 2004
417 Ga0207674_10609387 3300026116 Bacteria 1055
418 Ga0207683_10049845 3300026121 Bacteria 3666
419 Ga0207683_10473012 3300026121 Bacteria 1156
420 Ga0207683_10554350 3300026121 Bacteria 1063
421 Ga0207698_10000896 3300026142 Bacteria 17309
422 Ga0207698_10006766 3300026142 Bacteria 7163
423 Ga0207698_10008977 3300026142 Bacteria 6344
424 Ga0207698_10115877 3300026142 Bacteria 2257
425 Ga0207698_10325580 3300026142 Bacteria 1441
426 Ga0207698_10414127 3300026142 Bacteria 1291
427 Ga0207698_10490829 3300026142 Bacteria 1193
428 Ga0207698_11253623 3300026142 Bacteria 756
429 Ga0207698_12010683 3300026142 Unclassified 592
430 Ga0268266_10319165 3300028379 Bacteria 1453
431 Ga0268266_10744688 3300028379 Bacteria 945
432 Ga0268265_10179851 3300028380 Bacteria 1816
433 Ga0268264_10203575 3300028381 Bacteria 1812
434 Ga0307405_10347022 3300031731 Bacteria 1143
435 Ga0307413_10251110 3300031824 Bacteria 1312
436 Ga0307413_10501615 3300031824 Bacteria 974
437 Ga0307410_10102566 3300031852 Bacteria 2053
438 Ga0307410_10144957 3300031852 Bacteria 1761
439 Ga0307410_10158828 3300031852 Bacteria 1691
440 Ga0307406_10421097 3300031901 Bacteria 1064
441 Ga0307407_10015582 3300031903 Bacteria 3764
442 Ga0307407_10085950 3300031903 Bacteria 1915
443 Ga0307412_10061430 3300031911 Bacteria 2526
444 Ga0307412_10260600 3300031911 Bacteria 1351
445 Ga0307412_10696304 3300031911 Bacteria 871
446 Ga0307409_100031807 3300031995 Bacteria 3815
447 Ga0307409_100149142 3300031995 Bacteria 2028
448 Ga0307416_100004552 3300032002 Bacteria 8377
449 Ga0307416_100030216 3300032002 Bacteria 4062
450 Ga0307416_100276544 3300032002 Bacteria 1652
451 Ga0307416_101247515 3300032002 Bacteria 849
452 Ga0307414_10179571 3300032004 Bacteria 1701
453 Ga0307414_10209728 3300032004 Bacteria 1591
454 Ga0307414_10366977 3300032004 Bacteria 1240
455 Ga0307411_10026146 3300032005 Bacteria 3510
456 Ga0307411_10071637 3300032005 Bacteria 2350
457 Ga0307411_10158493 3300032005 Bacteria 1691
458 Ga0307411_10632101 3300032005 Bacteria 924
459 Ga0307415_100016305 3300032126 Bacteria 4426
460 Ga0307415_100159749 3300032126 Bacteria 1745
461 Ga0307415_100179507 3300032126 Bacteria 1659
462 Ga0307415_100784867 3300032126 Bacteria 868
463 Ga0373923_0027553 3300035111 Bacteria 2268
464 Ga0373923_0330748 3300035111 Bacteria 725
465 Ga0373936_0353480 3300035113 Unclassified 669
466 Ga0373941_0173760 3300035115 Bacteria 804
467 Ga0373954_0033151 3300035118 Bacteria 2389
468 Ga0373943_0016672 3300035170 Bacteria 3353
469 Ga0373943_0148768 3300035170 Bacteria 1267
470 Ga0373946_0066336 3300035171 Bacteria 1547
471 Ga0373955_0002727 3300035172 Bacteria 7737
472 Ga0373931_1027412 3300035691 Unclassified 559
473 Ga0373935_0018058 3300035692 Bacteria 4288
474 Ga0373927_0093144 3300035695 Bacteria 1957
475 Ga0373947_0316112 3300035725 Bacteria 1043
476 Ga0373937_0010753 3300036401 Bacteria 8007
477 Ga0373937_0222036 3300036401 Bacteria 1779
478 Ga0373925_0010397 3300037068 Bacteria 6751
479 Ga0373925_0332683 3300037068 Bacteria 1231
480 Ga0395899_0014277 3300037312 Bacteria 6064
481 Ga0395899_0072949 3300037312 Bacteria 2511
482 Ga0395899_0084671 3300037312 Bacteria 2305
483 Ga0395899_0118898 3300037312 Bacteria 1895
484 Ga0395899_0130064 3300037312 Bacteria 1798
485 Ga0395899_0139822 3300037312 Unclassified 1723
486 Ga0395899_0147116 3300037312 Bacteria 1672
487 Ga0395899_0306411 3300037312 Bacteria 1073
488 Ga0395899_0375049 3300037312 Bacteria 946
489 Ga0395899_0403037 3300037312 Bacteria 904
490 Ga0395899_0411002 3300037312 Bacteria 893
491 Ga0395899_0434941 3300037312 Bacteria 862
492 Ga0395899_0660779 3300037312 Bacteria 659
493 Ga0395900_0001779 3300037418 Bacteria 24718
494 Ga0395900_0003085 3300037418 Bacteria 18103
495 Ga0395900_0009276 3300037418 Bacteria 10089
496 Ga0395900_0010484 3300037418 Bacteria 9479
497 Ga0395900_0033740 3300037418 Bacteria 5267
498 Ga0395900_0040236 3300037418 Bacteria 4817
499 Ga0395900_0041814 3300037418 Bacteria 4723
500 Ga0395900_0060815 3300037418 Bacteria 3885
501 Ga0395900_0073712 3300037418 Bacteria 3510
502 Ga0395900_0149524 3300037418 Bacteria 2386
503 Ga0395900_0198322 3300037418 Bacteria 2032
504 Ga0395900_0265514 3300037418 Bacteria 1712
505 Ga0395900_0546719 3300037418 Bacteria 1103
506 Ga0395900_0675836 3300037418 Bacteria 967
507 Ga0395900_0679881 3300037418 Bacteria 964
508 Ga0395900_0754379 3300037418 Bacteria 903
509 Ga0395900_0778836 3300037418 Bacteria 885
510 Ga0395900_1468576 3300037418 Unclassified 594
511 Ga0395898_0011721 3300037466 Bacteria 9089
512 Ga0395898_0021270 3300037466 Bacteria 6579
513 Ga0395898_0052037 3300037466 Bacteria 4002
514 Ga0395898_0142823 3300037466 Bacteria 2292
515 Ga0395898_0154726 3300037466 Bacteria 2193
516 Ga0395898_0277996 3300037466 Bacteria 1597
517 Ga0395898_0379279 3300037466 Bacteria 1348
518 Ga0395898_0500232 3300037466 Bacteria 1156
519 Ga0395898_0986595 3300037466 Bacteria 778
520 Ga0395905_0000104 3300037471 Bacteria 141965
521 Ga0395905_0004102 3300037471 Bacteria 15259
522 Ga0395905_0008256 3300037471 Bacteria 10285
523 Ga0395905_0023579 3300037471 Bacteria 5813
524 Ga0395905_0029447 3300037471 Bacteria 5172
525 Ga0395905_0034571 3300037471 Bacteria 4746
526 Ga0395905_0036894 3300037471 Bacteria 4591
527 Ga0395905_0037718 3300037471 Bacteria 4535
528 Ga0395905_0045504 3300037471 Bacteria 4116
529 Ga0395905_0085043 3300037471 Bacteria 2964
530 Ga0395905_0086007 3300037471 Bacteria 2946
531 Ga0395905_0094163 3300037471 Bacteria 2810
532 Ga0395905_0208860 3300037471 Bacteria 1830
533 Ga0395905_0244205 3300037471 Bacteria 1677
534 Ga0395905_0282967 3300037471 Bacteria 1544
535 Ga0395905_0423000 3300037471 Bacteria 1228
536 Ga0395905_0478805 3300037471 Bacteria 1144
537 Ga0395905_0517012 3300037471 Bacteria 1094
538 Ga0395905_0569978 3300037471 Bacteria 1033
539 Ga0395905_0647674 3300037471 Bacteria 958
540 Ga0395905_0700970 3300037471 Bacteria 915
541 Ga0395905_0729105 3300037471 Bacteria 893
542 Ga0395905_1142279 3300037471 Bacteria 682
543 Ga0436364_1387927 3300037853 Bacteria 27679
544 Ga0395901_0000589 3300038443 Bacteria 42319
545 Ga0395901_0000782 3300038443 Bacteria 35570
546 Ga0395901_0103175 3300038443 Bacteria 2992
547 Ga0395901_0113729 3300038443 Bacteria 2842
548 Ga0395901_0131734 3300038443 Bacteria 2627
549 Ga0395901_0247424 3300038443 Bacteria 1858
550 Ga0395901_0262712 3300038443 Bacteria 1796
551 Ga0395901_0296008 3300038443 Bacteria 1678
552 Ga0395901_0358393 3300038443 Bacteria 1504
553 Ga0395901_0492497 3300038443 Bacteria 1249
554 Ga0395901_0514093 3300038443 Bacteria 1217
555 Ga0395901_0827968 3300038443 Bacteria 912
556 Ga0395901_0905836 3300038443 Bacteria 863
557 Ga0439465_0022888 3300041413 Bacteria 1964
558 Ga0439432_024907 3300042006 Bacteria 1965
559 Ga0439449_0043119 3300042007 Bacteria 1675
560 Ga0439458_0000590 3300042157 Bacteria 9358
561 Ga0466972_0005975 3300044658 Bacteria 6113
562 Ga0466972_0057561 3300044658 Bacteria 1867
563 Ga0466972_0073628 3300044658 Bacteria 1628
564 Ga0466972_0316434 3300044658 Bacteria 729
565 Ga0466965_0156053 3300044683 Bacteria 1195
566 Ga0466961_0149153 3300044693 Bacteria 1461
567 Ga0466961_0307191 3300044693 Bacteria 968
568 Ga0466961_0329009 3300044693 Bacteria 931
569 Ga0466961_0490775 3300044693 Bacteria 742
570 Ga0466963_0010178 3300044694 Bacteria 5686
571 Ga0466963_0010200 3300044694 Bacteria 5681
572 Ga0466963_0073140 3300044694 Bacteria 2310
573 Ga0466963_0246625 3300044694 Bacteria 1253
574 Ga0466963_0304119 3300044694 Bacteria 1122
575 Ga0466963_0422153 3300044694 Bacteria 940
576 Ga0466963_0581271 3300044694 Bacteria 791
577 Ga0466964_0151035 3300044706 Bacteria 1077
578 Ga0466964_0155698 3300044706 Bacteria 1063
579 Ga0466971_0018356 3300044719 Bacteria 3098
580 Ga0466971_0213122 3300044719 Bacteria 914
581 Ga0466971_0310596 3300044719 Bacteria 758
582 Ga0466968_0246394 3300044735 Bacteria 848
583 Ga0466957_0039900 3300044842 Bacteria 2834
584 Ga0466957_0113584 3300044842 Bacteria 1720
585 Ga0466957_0184562 3300044842 Bacteria 1363
586 Ga0466957_0274535 3300044842 Bacteria 1126
587 Ga0466957_0346149 3300044842 Bacteria 1007
588 Ga0466957_0390324 3300044842 Bacteria 950
589 Ga0466957_0588571 3300044842 Bacteria 778
590 Ga0466957_0653508 3300044842 Bacteria 739
591 Ga0466960_0047367 3300044901 Bacteria 2061
592 Ga0466959_0219829 3300045049 Bacteria 1318
593 Ga0466959_0480705 3300045049 Bacteria 841
594 Ga0466958_0014825 3300045836 Bacteria 4456
595 Ga0466958_0028552 3300045836 Bacteria 3308
596 Ga0466958_0032340 3300045836 Bacteria 3112
597 Ga0466958_0202812 3300045836 Bacteria 1262
598 Ga0466958_0217883 3300045836 Bacteria 1217
599 Ga0466958_0282868 3300045836 Bacteria 1063
600 Ga0466967_0006997 3300045976 Bacteria 8072
601 Ga0466967_0020005 3300045976 Bacteria 5398
602 Ga0466967_0088576 3300045976 Bacteria 2809
603 Ga0466967_0096507 3300045976 Bacteria 2696
604 Ga0466967_0131886 3300045976 Bacteria 2320
605 Ga0466967_0210613 3300045976 Bacteria 1843
606 Ga0466967_0247910 3300045976 Bacteria 1700
607 Ga0466967_0249305 3300045976 Bacteria 1696
608 Ga0466967_0263869 3300045976 Bacteria 1648
609 Ga0466967_0297358 3300045976 Bacteria 1552
610 Ga0466967_0813755 3300045976 Bacteria 928
611 Ga0466967_0820870 3300045976 Bacteria 923
612 Ga0466967_0893570 3300045976 Bacteria 883
613 Ga0466967_1531166 3300045976 Bacteria 664
614 Ga0495650_0152204 3300046471 Bacteria 830
615 Ga0495631_0230384 3300046518 Unclassified 790
616 Ga0495663_0011260 3300046525 Bacteria 2490
617 Ga0495663_0031760 3300046525 Bacteria 1570
618 Ga0495621_0000972 3300046539 Bacteria 7305
619 Ga0495633_0113394 3300046558 Bacteria 1257
620 Ga0495668_0011856 3300046616 Bacteria 5196
621 Ga0495623_0019538 3300046679 Bacteria 4378
622 Ga0495647_0348113 3300046681 Bacteria 674
623 Ga0495669_0057703 3300046684 Bacteria 1752
624 Ga0495669_0387596 3300046684 Bacteria 676
625 Ga0495670_0000071 3300046691 Bacteria 45180
626 Ga0495677_0087929 3300047445 Bacteria 1169
627 Ga0495602_0091257 3300048088 Bacteria 2527
628 Ga0496101_0010849 3300048904 Bacteria 6027
629 Ga0496101_0457142 3300048904 Bacteria 1007
630 Ga0496102_0346638 3300048905 Bacteria 1398
631 Ga0496102_0366584 3300048905 Bacteria 1356
632 Ga0496104_0137509 3300048907 Bacteria 2347
633 Ga0496105_0182962 3300048908 Bacteria 1715
634 Ga0496106_0082568 3300048909 Bacteria 2470
635 Ga0496106_0130672 3300048909 Bacteria 1969
636 Ga0496107_0002900 3300048910 Bacteria 11331
637 Ga0496107_0011494 3300048910 Bacteria 6167
638 Ga0496107_0131555 3300048910 Bacteria 1847
639 Ga0496108_0045905 3300048911 Bacteria 3649
640 Ga0496108_0515020 3300048911 Bacteria 1044
641 Ga0496109_0046481 3300048912 Bacteria 3943
642 Ga0496109_0061186 3300048912 Bacteria 3441
643 Ga0496109_0068968 3300048912 Bacteria 3241
644 Ga0496109_0467267 3300048912 Bacteria 1191
645 Ga0496109_0794783 3300048912 Bacteria 884
646 Ga0496110_0025175 3300048913 Bacteria 5083
647 Ga0496110_0033905 3300048913 Bacteria 4418
648 Ga0496110_0042482 3300048913 Bacteria 3968
649 Ga0496110_0184234 3300048913 Bacteria 1896
650 Ga0496110_0881018 3300048913 Bacteria 801
651 Ga0496111_0002376 3300048914 Bacteria 11340
652 Ga0496111_0029259 3300048914 Bacteria 3911
653 Ga0496112_0040418 3300048915 Bacteria 4559
654 Ga0496112_0068145 3300048915 Bacteria 3514
655 Ga0496112_0143489 3300048915 Bacteria 2356
656 Ga0496112_0443531 3300048915 Bacteria 1236
657 Ga0496113_0010921 3300048916 Bacteria 6028
658 Ga0496113_0011965 3300048916 Bacteria 5816
659 Ga0496113_0054432 3300048916 Bacteria 2996
660 Ga0496114_0058951 3300048917 Bacteria 3206
661 Ga0496115_0088057 3300048918 Bacteria 2534
662 Ga0501202_058311 3300049652 Bacteria 868
663 Ga0501207_019395 3300049654 Bacteria 1078
664 Ga0501217_067111 3300049661 Bacteria 969
665 Ga0501223_035357 3300049663 Bacteria 972
666 Ga0501233_005985 3300049668 Bacteria 2272
667 Ga0501235_008407 3300049669 Bacteria 2252
668 Ga0501239_006071 3300049672 Bacteria 1232
669 Ga0501247_027531 3300049677 Bacteria 763
670 Ga0501249_018314 3300049679 Bacteria 1514
671 Ga0501258_004127 3300049687 Bacteria 1362
672 Ga0501221_009102 3300049704 Bacteria 1738
673 Ga0501229_020960 3300049706 Bacteria 866
674 Ga0501268_000532 3300049765 Bacteria 4191
675 Ga0501272_001757 3300049769 Bacteria 2098
676 Ga0501273_010041 3300049770 Bacteria 1158
677 Ga0500658_0000036 3300053134 Bacteria 85304
678 Ga0587066_046458 3300059490 Bacteria 838
679 Ga0587080_010228 3300059503 Bacteria 1380
680 Ga0587090_010448 3300059510 Unclassified 1287
681 Ga0587128_026224 3300059630 Bacteria 933
682 Ga0587075_016693 3300059644 Bacteria 1047
683 Ga0587079_075714 3300059647 Bacteria 760
684 Ga0466962_0006344 3300061719 Bacteria 5677
685 Ga0466962_0015820 3300061719 Bacteria 3640
686 Ga0466962_0120036 3300061719 Bacteria 1268
687 Ga0466962_0330471 3300061719 Unclassified 757

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_10406899 Ga0207687_104068992 118
2 3300005335 Ga0070666_10053690 Ga0070666_100536903 134
3 3300025941 Ga0207711_10007240 Ga0207711_100072408 134
4 3300025941 Ga0207711_10020622 Ga0207711_100206223 134
5 3300025903 Ga0207680_10331744 Ga0207680_103317442 138
6 3300025907 Ga0207645_10038053 Ga0207645_100380532 138
7 3300025921 Ga0207652_10579561 Ga0207652_105795612 138
8 3300025931 Ga0207644_10629129 Ga0207644_106291292 138
9 3300025933 Ga0207706_10308681 Ga0207706_103086812 138
10 3300026142 Ga0207698_10325580 Ga0207698_103255801 138
11 3300025941 Ga0207711_10006917 Ga0207711_100069175 147
12 3300048904 Ga0496101_0010849 Ga0496101_0010849_5481_6005 147
13 3300025931 Ga0207644_10017567 Ga0207644_100175675 149
14 3300048909 Ga0496106_0130672 Ga0496106_0130672_178_702 149
15 3300048910 Ga0496107_0002900 Ga0496107_0002900_3212_3736 149
16 3300048917 Ga0496114_0058951 Ga0496114_0058951_1932_2456 149
17 3300048918 Ga0496115_0088057 Ga0496115_0088057_812_1336 149
18 3300005334 Ga0068869_100646279 Ga0068869_1006462791 150
19 3300005338 Ga0068868_100074382 Ga0068868_1000743823 150
20 3300005355 Ga0070671_100223230 Ga0070671_1002232302 150
21 3300005356 Ga0070674_100198542 Ga0070674_1001985422 150
22 3300005356 Ga0070674_100263739 Ga0070674_1002637392 150
23 3300005364 Ga0070673_100230514 Ga0070673_1002305142 150
24 3300005367 Ga0070667_100056858 Ga0070667_1000568585 150
25 3300005543 Ga0070672_100563974 Ga0070672_1005639742 150
26 3300005617 Ga0068859_100437124 Ga0068859_1004371242 150
27 3300005718 Ga0068866_10061662 Ga0068866_100616622 150
28 3300005842 Ga0068858_100013510 Ga0068858_1000135103 150
29 3300006931 Ga0097620_100437147 Ga0097620_1004371472 150
30 3300009098 Ga0105245_10611651 Ga0105245_106116512 150
31 3300025904 Ga0207647_10010648 Ga0207647_100106482 150
32 3300025927 Ga0207687_10399981 Ga0207687_103999812 150
33 3300025931 Ga0207644_10051182 Ga0207644_100511824 150
34 3300025937 Ga0207669_10157753 Ga0207669_101577532 150
35 3300025940 Ga0207691_10200721 Ga0207691_102007212 150
36 3300025940 Ga0207691_10301247 Ga0207691_103012471 150
37 3300025960 Ga0207651_10136569 Ga0207651_101365693 150
38 3300025960 Ga0207651_10501556 Ga0207651_105015562 150
39 3300026023 Ga0207677_10006373 Ga0207677_100063738 150
40 3300026023 Ga0207677_10484598 Ga0207677_104845982 150
41 3300036401 Ga0373937_0222036 Ga0373937_0222036_709_1236 150
42 3300037312 Ga0395899_0147116 Ga0395899_0147116_822_1376 150
43 3300037418 Ga0395900_0073712 Ga0395900_0073712_512_1066 150
44 3300037466 Ga0395898_0277996 Ga0395898_0277996_479_1033 150
45 3300038443 Ga0395901_0296008 Ga0395901_0296008_728_1282 150
46 3300046518 Ga0495631_0230384 Ga0495631_0230384_225_752 150
47 3300046525 Ga0495663_0031760 Ga0495663_0031760_41_568 150
48 3300046539 Ga0495621_0000972 Ga0495621_0000972_1946_2473 150
49 3300046558 Ga0495633_0113394 Ga0495633_0113394_161_688 150
50 3300046691 Ga0495670_0000071 Ga0495670_0000071_33132_33659 150
51 3300048912 Ga0496109_0794783 Ga0496109_0794783_19_546 150
52 3300005328 Ga0070676_10396100 Ga0070676_103961001 151
53 3300005330 Ga0070690_100604591 Ga0070690_1006045912 151
54 3300005335 Ga0070666_10241481 Ga0070666_102414812 151
55 3300005338 Ga0068868_100335976 Ga0068868_1003359762 151
56 3300005354 Ga0070675_100354570 Ga0070675_1003545702 151
57 3300005356 Ga0070674_100402675 Ga0070674_1004026752 151
58 3300005364 Ga0070673_100895869 Ga0070673_1008958692 151
59 3300005367 Ga0070667_100405460 Ga0070667_1004054602 151
60 3300005456 Ga0070678_100031044 Ga0070678_1000310442 151
61 3300005457 Ga0070662_100359996 Ga0070662_1003599962 151
62 3300005543 Ga0070672_100387372 Ga0070672_1003873722 151
63 3300005548 Ga0070665_100040150 Ga0070665_1000401502 151
64 3300005616 Ga0068852_101629976 Ga0068852_1016299761 151
65 3300006237 Ga0097621_101112956 Ga0097621_1011129561 151
66 3300009177 Ga0105248_11141514 Ga0105248_111415142 151
67 3300014969 Ga0157376_10338846 Ga0157376_103388462 151
68 3300025903 Ga0207680_10200759 Ga0207680_102007592 151
69 3300025907 Ga0207645_10216303 Ga0207645_102163032 151
70 3300025940 Ga0207691_10202556 Ga0207691_102025562 151
71 3300025941 Ga0207711_10033837 Ga0207711_100338375 151
72 3300025960 Ga0207651_10029038 Ga0207651_100290382 151
73 3300025986 Ga0207658_10392824 Ga0207658_103928242 151
74 3300026023 Ga0207677_10371048 Ga0207677_103710482 151
75 3300026121 Ga0207683_10554350 Ga0207683_105543502 151
76 3300028379 Ga0268266_10319165 Ga0268266_103191652 151
77 3300045836 Ga0466958_0028552 Ga0466958_0028552_128_661 151
78 3300045976 Ga0466967_0006997 Ga0466967_0006997_1581_2114 151
79 3300046471 Ga0495650_0152204 Ga0495650_0152204_211_726 151
80 3300046616 Ga0495668_0011856 Ga0495668_0011856_3294_3809 151
81 3300053134 Ga0500658_0000036 Ga0500658_0000036_37924_38439 151
82 3300061719 Ga0466962_0120036 Ga0466962_0120036_440_973 151
83 3300003323 rootH1_10146668 rootH1_101466682 152
84 3300005331 Ga0070670_100037964 Ga0070670_1000379642 152
85 3300005333 Ga0070677_10359569 Ga0070677_103595692 152
86 3300005339 Ga0070660_100599932 Ga0070660_1005999321 152
87 3300005354 Ga0070675_100222134 Ga0070675_1002221342 152
88 3300005355 Ga0070671_100479706 Ga0070671_1004797062 152
89 3300005356 Ga0070674_100218520 Ga0070674_1002185203 152
90 3300005366 Ga0070659_100420236 Ga0070659_1004202361 152
91 3300005456 Ga0070678_100185955 Ga0070678_1001859552 152
92 3300005459 Ga0068867_100224100 Ga0068867_1002241002 152
93 3300005543 Ga0070672_100047900 Ga0070672_1000479002 152
94 3300005616 Ga0068852_100445873 Ga0068852_1004458732 152
95 3300005617 Ga0068859_100221584 Ga0068859_1002215842 152
96 3300005842 Ga0068858_100069226 Ga0068858_1000692265 152
97 3300005842 Ga0068858_101088491 Ga0068858_1010884911 152
98 3300006881 Ga0068865_100124170 Ga0068865_1001241703 152
99 3300006931 Ga0097620_100221567 Ga0097620_1002215673 152
100 3300009092 Ga0105250_10008228 Ga0105250_100082282 152
101 3300009101 Ga0105247_10092011 Ga0105247_100920113 152
102 3300009177 Ga0105248_10001135 Ga0105248_1000113512 152
103 3300009553 Ga0105249_10089043 Ga0105249_100890434 152
104 3300013306 Ga0163162_10089421 Ga0163162_100894214 152
105 3300013308 Ga0157375_11130288 Ga0157375_111302881 152
106 3300014325 Ga0163163_10000735 Ga0163163_1000073534 152
107 3300014326 Ga0157380_11236428 Ga0157380_112364282 152
108 3300014968 Ga0157379_10012216 Ga0157379_100122164 152
109 3300025925 Ga0207650_10052898 Ga0207650_100528982 152
110 3300025926 Ga0207659_10163770 Ga0207659_101637702 152
111 3300025933 Ga0207706_10068152 Ga0207706_100681524 152
112 3300025937 Ga0207669_10145946 Ga0207669_101459462 152
113 3300025938 Ga0207704_10566616 Ga0207704_105666161 152
114 3300025940 Ga0207691_10031381 Ga0207691_100313817 152
115 3300025941 Ga0207711_10062395 Ga0207711_100623952 152
116 3300026089 Ga0207648_10059945 Ga0207648_100599453 152
117 3300026121 Ga0207683_10473012 Ga0207683_104730122 152
118 3300026142 Ga0207698_12010683 Ga0207698_120106831 152
119 3300031852 Ga0307410_10144957 Ga0307410_101449572 152
120 3300031903 Ga0307407_10085950 Ga0307407_100859502 152
121 3300031995 Ga0307409_100031807 Ga0307409_1000318073 152
122 3300032005 Ga0307411_10071637 Ga0307411_100716374 152
123 3300037471 Ga0395905_0036894 Ga0395905_0036894_2167_2664 152
124 3300037471 Ga0395905_0423000 Ga0395905_0423000_613_1119 152
125 3300037471 Ga0395905_0700970 Ga0395905_0700970_266_763 152
126 3300037471 Ga0395905_1142279 Ga0395905_1142279_151_657 152
127 3300044694 Ga0466963_0010178 Ga0466963_0010178_4622_5143 152
128 3300044706 Ga0466964_0155698 Ga0466964_0155698_87_608 152
129 3300044842 Ga0466957_0390324 Ga0466957_0390324_237_758 152
130 3300045976 Ga0466967_0247910 Ga0466967_0247910_450_971 152
131 3300047445 Ga0495677_0087929 Ga0495677_0087929_411_944 152
132 3300048911 Ga0496108_0045905 Ga0496108_0045905_2409_2909 152
133 3300048912 Ga0496109_0046481 Ga0496109_0046481_1251_1751 152
134 3300001979 JGI24740J21852_10032137 JGI24740J21852_100321372 153
135 3300003320 rootH2_10095679 rootH2_100956793 153
136 3300005327 Ga0070658_10603367 Ga0070658_106033672 153
137 3300005329 Ga0070683_100014717 Ga0070683_1000147178 153
138 3300005331 Ga0070670_100140991 Ga0070670_1001409912 153
139 3300005336 Ga0070680_100001257 Ga0070680_1000012573 153
140 3300005339 Ga0070660_100029369 Ga0070660_1000293692 153
141 3300005367 Ga0070667_100053826 Ga0070667_1000538264 153
142 3300005435 Ga0070714_101482018 Ga0070714_1014820181 153
143 3300005455 Ga0070663_100078053 Ga0070663_1000780534 153
144 3300005530 Ga0070679_100038807 Ga0070679_1000388076 153
145 3300005539 Ga0068853_100136876 Ga0068853_1001368763 153
146 3300005543 Ga0070672_101433130 Ga0070672_1014331301 153
147 3300005563 Ga0068855_100025356 Ga0068855_1000253568 153
148 3300005614 Ga0068856_100274052 Ga0068856_1002740522 153
149 3300005614 Ga0068856_100976439 Ga0068856_1009764392 153
150 3300005616 Ga0068852_100244841 Ga0068852_1002448412 153
151 3300005834 Ga0068851_10314946 Ga0068851_103149461 153
152 3300005843 Ga0068860_100205460 Ga0068860_1002054603 153
153 3300009177 Ga0105248_10019178 Ga0105248_100191782 153
154 3300013104 Ga0157370_10114252 Ga0157370_101142521 153
155 3300014968 Ga0157379_10330763 Ga0157379_103307632 153
156 3300020069 Ga0197907_11114687 Ga0197907_111146872 153
157 3300020081 Ga0206354_10226857 Ga0206354_102268573 153
158 3300020082 Ga0206353_11563947 Ga0206353_115639472 153
159 3300025321 Ga0207656_10239381 Ga0207656_102393811 153
160 3300025904 Ga0207647_10108722 Ga0207647_101087222 153
161 3300025909 Ga0207705_10000493 Ga0207705_1000049318 153
162 3300025917 Ga0207660_10054697 Ga0207660_100546973 153
163 3300025919 Ga0207657_10017883 Ga0207657_100178832 153
164 3300025921 Ga0207652_10000034 Ga0207652_10000034130 153
165 3300025928 Ga0207700_11114265 Ga0207700_111142651 153
166 3300025941 Ga0207711_10000617 Ga0207711_1000061730 153
167 3300025944 Ga0207661_10009979 Ga0207661_100099792 153
168 3300025949 Ga0207667_10049976 Ga0207667_100499766 153
169 3300025986 Ga0207658_10084342 Ga0207658_100843423 153
170 3300026041 Ga0207639_10112941 Ga0207639_101129413 153
171 3300026041 Ga0207639_10278547 Ga0207639_102785472 153
172 3300026067 Ga0207678_10017638 Ga0207678_100176382 153
173 3300026142 Ga0207698_10006766 Ga0207698_100067661 153
174 3300026142 Ga0207698_10414127 Ga0207698_104141272 153
175 3300028381 Ga0268264_10203575 Ga0268264_102035752 153
176 3300031824 Ga0307413_10501615 Ga0307413_105016152 153
177 3300031852 Ga0307410_10158828 Ga0307410_101588282 153
178 3300031911 Ga0307412_10696304 Ga0307412_106963041 153
179 3300032002 Ga0307416_100276544 Ga0307416_1002765442 153
180 3300032002 Ga0307416_101247515 Ga0307416_1012475152 153
181 3300032004 Ga0307414_10179571 Ga0307414_101795713 153
182 3300032004 Ga0307414_10366977 Ga0307414_103669772 153
183 3300032005 Ga0307411_10158493 Ga0307411_101584932 153
184 3300032005 Ga0307411_10632101 Ga0307411_106321012 153
185 3300032126 Ga0307415_100179507 Ga0307415_1001795072 153
186 3300035115 Ga0373941_0173760 Ga0373941_0173760_18_530 153
187 3300035691 Ga0373931_1027412 Ga0373931_1027412_19_531 153
188 3300037312 Ga0395899_0084671 Ga0395899_0084671_1312_1857 153
189 3300037418 Ga0395900_0010484 Ga0395900_0010484_867_1409 153
190 3300037418 Ga0395900_0040236 Ga0395900_0040236_191_736 153
191 3300037418 Ga0395900_0546719 Ga0395900_0546719_396_899 153
192 3300037466 Ga0395898_0142823 Ga0395898_0142823_271_840 153
193 3300037471 Ga0395905_0085043 Ga0395905_0085043_356_898 153
194 3300037471 Ga0395905_0086007 Ga0395905_0086007_191_736 153
195 3300037471 Ga0395905_0094163 Ga0395905_0094163_1304_1849 153
196 3300038443 Ga0395901_0113729 Ga0395901_0113729_2095_2634 153
197 3300038443 Ga0395901_0492497 Ga0395901_0492497_250_753 153
198 3300038443 Ga0395901_0514093 Ga0395901_0514093_464_1009 153
199 3300042006 Ga0439432_024907 Ga0439432_024907_951_1454 153
200 3300044658 Ga0466972_0316434 Ga0466972_0316434_38_589 153
201 3300044842 Ga0466957_0588571 Ga0466957_0588571_106_657 153
202 3300045836 Ga0466958_0217883 Ga0466958_0217883_428_979 153
203 3300045976 Ga0466967_0131886 Ga0466967_0131886_1566_2096 153
204 3300045976 Ga0466967_0263869 Ga0466967_0263869_507_1058 153
205 3300048913 Ga0496110_0184234 Ga0496110_0184234_581_1081 153
206 3300049652 Ga0501202_058311 Ga0501202_058311_64_567 153
207 3300049654 Ga0501207_019395 Ga0501207_019395_338_841 153
208 3300049661 Ga0501217_067111 Ga0501217_067111_448_951 153
209 3300049663 Ga0501223_035357 Ga0501223_035357_193_696 153
210 3300049669 Ga0501235_008407 Ga0501235_008407_1162_1665 153
211 3300049672 Ga0501239_006071 Ga0501239_006071_122_625 153
212 3300049687 Ga0501258_004127 Ga0501258_004127_498_1001 153
213 3300049704 Ga0501221_009102 Ga0501221_009102_456_959 153
214 3300049706 Ga0501229_020960 Ga0501229_020960_19_522 153
215 3300049765 Ga0501268_000532 Ga0501268_000532_668_1171 153
216 3300001904 JGI24736J21556_1011162 JGI24736J21556_10111622 154
217 3300001979 JGI24740J21852_10011466 JGI24740J21852_100114662 154
218 3300001979 JGI24740J21852_10027078 JGI24740J21852_100270782 154
219 3300001989 JGI24739J22299_10006645 JGI24739J22299_100066454 154
220 3300001990 JGI24737J22298_10005144 JGI24737J22298_100051444 154
221 3300002067 JGI24735J21928_10004145 JGI24735J21928_100041457 154
222 3300002067 JGI24735J21928_10018977 JGI24735J21928_100189773 154
223 3300005327 Ga0070658_10014069 Ga0070658_100140698 154
224 3300005327 Ga0070658_10095418 Ga0070658_100954182 154
225 3300005327 Ga0070658_10115125 Ga0070658_101151252 154
226 3300005327 Ga0070658_10190689 Ga0070658_101906893 154
227 3300005327 Ga0070658_10382658 Ga0070658_103826582 154
228 3300005327 Ga0070658_10453259 Ga0070658_104532592 154
229 3300005327 Ga0070658_10457148 Ga0070658_104571481 154
230 3300005327 Ga0070658_10475136 Ga0070658_104751362 154
231 3300005329 Ga0070683_100009832 Ga0070683_1000098329 154
232 3300005329 Ga0070683_100034868 Ga0070683_1000348683 154
233 3300005329 Ga0070683_100093133 Ga0070683_1000931334 154
234 3300005329 Ga0070683_100430693 Ga0070683_1004306932 154
235 3300005329 Ga0070683_100788728 Ga0070683_1007887282 154
236 3300005330 Ga0070690_100208589 Ga0070690_1002085891 154
237 3300005331 Ga0070670_100309142 Ga0070670_1003091422 154
238 3300005335 Ga0070666_10002971 Ga0070666_100029715 154
239 3300005336 Ga0070680_100145622 Ga0070680_1001456223 154
240 3300005336 Ga0070680_100233016 Ga0070680_1002330163 154
241 3300005336 Ga0070680_100341447 Ga0070680_1003414472 154
242 3300005337 Ga0070682_100062528 Ga0070682_1000625283 154
243 3300005337 Ga0070682_100240793 Ga0070682_1002407932 154
244 3300005337 Ga0070682_100297181 Ga0070682_1002971812 154
245 3300005337 Ga0070682_100590144 Ga0070682_1005901442 154
246 3300005337 Ga0070682_100676506 Ga0070682_1006765061 154
247 3300005338 Ga0068868_100012920 Ga0068868_1000129202 154
248 3300005339 Ga0070660_100036347 Ga0070660_1000363475 154
249 3300005339 Ga0070660_100046930 Ga0070660_1000469303 154
250 3300005339 Ga0070660_100057029 Ga0070660_1000570293 154
251 3300005339 Ga0070660_100060814 Ga0070660_1000608143 154
252 3300005339 Ga0070660_100082500 Ga0070660_1000825002 154
253 3300005339 Ga0070660_100192238 Ga0070660_1001922382 154
254 3300005339 Ga0070660_100777800 Ga0070660_1007778002 154
255 3300005339 Ga0070660_100860822 Ga0070660_1008608221 154
256 3300005339 Ga0070660_100864870 Ga0070660_1008648702 154
257 3300005341 Ga0070691_10003582 Ga0070691_100035823 154
258 3300005344 Ga0070661_100033437 Ga0070661_1000334373 154
259 3300005344 Ga0070661_100057595 Ga0070661_1000575952 154
260 3300005344 Ga0070661_100115944 Ga0070661_1001159442 154
261 3300005344 Ga0070661_100119212 Ga0070661_1001192122 154
262 3300005344 Ga0070661_100125604 Ga0070661_1001256042 154
263 3300005344 Ga0070661_100132596 Ga0070661_1001325962 154
264 3300005344 Ga0070661_100255546 Ga0070661_1002555462 154
265 3300005344 Ga0070661_100425149 Ga0070661_1004251492 154
266 3300005344 Ga0070661_100430133 Ga0070661_1004301332 154
267 3300005344 Ga0070661_100663233 Ga0070661_1006632331 154
268 3300005344 Ga0070661_100765250 Ga0070661_1007652502 154
269 3300005345 Ga0070692_10006534 Ga0070692_100065347 154
270 3300005345 Ga0070692_10013273 Ga0070692_100132733 154
271 3300005345 Ga0070692_10072159 Ga0070692_100721592 154
272 3300005345 Ga0070692_10107622 Ga0070692_101076222 154
273 3300005355 Ga0070671_100024137 Ga0070671_1000241371 154
274 3300005355 Ga0070671_100079772 Ga0070671_1000797721 154
275 3300005364 Ga0070673_100000526 Ga0070673_1000005262 154
276 3300005364 Ga0070673_100075965 Ga0070673_1000759652 154
277 3300005366 Ga0070659_100033445 Ga0070659_1000334454 154
278 3300005366 Ga0070659_100033606 Ga0070659_1000336065 154
279 3300005366 Ga0070659_100045336 Ga0070659_1000453365 154
280 3300005366 Ga0070659_100083906 Ga0070659_1000839064 154
281 3300005366 Ga0070659_100381841 Ga0070659_1003818411 154
282 3300005366 Ga0070659_100443303 Ga0070659_1004433032 154
283 3300005366 Ga0070659_100475719 Ga0070659_1004757192 154
284 3300005366 Ga0070659_100775901 Ga0070659_1007759012 154
285 3300005366 Ga0070659_100897391 Ga0070659_1008973911 154
286 3300005367 Ga0070667_100013712 Ga0070667_1000137128 154
287 3300005435 Ga0070714_100224928 Ga0070714_1002249282 154
288 3300005435 Ga0070714_100450504 Ga0070714_1004505042 154
289 3300005435 Ga0070714_100715804 Ga0070714_1007158042 154
290 3300005435 Ga0070714_100754447 Ga0070714_1007544471 154
291 3300005436 Ga0070713_100604964 Ga0070713_1006049641 154
292 3300005455 Ga0070663_100025115 Ga0070663_1000251154 154
293 3300005455 Ga0070663_100053289 Ga0070663_1000532892 154
294 3300005455 Ga0070663_100397770 Ga0070663_1003977702 154
295 3300005455 Ga0070663_100720413 Ga0070663_1007204132 154
296 3300005456 Ga0070678_100026409 Ga0070678_1000264093 154
297 3300005457 Ga0070662_100028447 Ga0070662_1000284474 154
298 3300005457 Ga0070662_100031341 Ga0070662_1000313412 154
299 3300005457 Ga0070662_100689245 Ga0070662_1006892451 154
300 3300005458 Ga0070681_10074936 Ga0070681_100749364 154
301 3300005458 Ga0070681_10135295 Ga0070681_101352954 154
302 3300005458 Ga0070681_10190802 Ga0070681_101908022 154
303 3300005458 Ga0070681_10421602 Ga0070681_104216022 154
304 3300005458 Ga0070681_10956825 Ga0070681_109568251 154
305 3300005459 Ga0068867_100173257 Ga0068867_1001732572 154
306 3300005466 Ga0070685_10175839 Ga0070685_101758392 154
307 3300005530 Ga0070679_100089715 Ga0070679_1000897153 154
308 3300005530 Ga0070679_100624713 Ga0070679_1006247132 154
309 3300005530 Ga0070679_101081056 Ga0070679_1010810561 154
310 3300005535 Ga0070684_100002671 Ga0070684_10000267113 154
311 3300005535 Ga0070684_100034298 Ga0070684_1000342985 154
312 3300005535 Ga0070684_100043830 Ga0070684_1000438305 154
313 3300005535 Ga0070684_100131444 Ga0070684_1001314442 154
314 3300005535 Ga0070684_100958225 Ga0070684_1009582251 154
315 3300005539 Ga0068853_100041268 Ga0068853_1000412684 154
316 3300005539 Ga0068853_100043066 Ga0068853_1000430662 154
317 3300005539 Ga0068853_100182314 Ga0068853_1001823142 154
318 3300005539 Ga0068853_100430520 Ga0068853_1004305202 154
319 3300005539 Ga0068853_100468473 Ga0068853_1004684733 154
320 3300005539 Ga0068853_101021086 Ga0068853_1010210862 154
321 3300005543 Ga0070672_100363492 Ga0070672_1003634922 154
322 3300005544 Ga0070686_100608762 Ga0070686_1006087621 154
323 3300005544 Ga0070686_100744368 Ga0070686_1007443681 154
324 3300005548 Ga0070665_100659351 Ga0070665_1006593512 154
325 3300005563 Ga0068855_100112774 Ga0068855_1001127743 154
326 3300005563 Ga0068855_100115015 Ga0068855_1001150152 154
327 3300005563 Ga0068855_100136178 Ga0068855_1001361784 154
328 3300005563 Ga0068855_100394981 Ga0068855_1003949812 154
329 3300005563 Ga0068855_100725812 Ga0068855_1007258122 154
330 3300005564 Ga0070664_100006591 Ga0070664_1000065912 154
331 3300005564 Ga0070664_100055897 Ga0070664_1000558972 154
332 3300005564 Ga0070664_100113509 Ga0070664_1001135094 154
333 3300005564 Ga0070664_100336421 Ga0070664_1003364213 154
334 3300005564 Ga0070664_100349063 Ga0070664_1003490632 154
335 3300005564 Ga0070664_100816447 Ga0070664_1008164471 154
336 3300005564 Ga0070664_100821839 Ga0070664_1008218391 154
337 3300005564 Ga0070664_101036703 Ga0070664_1010367032 154
338 3300005577 Ga0068857_100031248 Ga0068857_1000312484 154
339 3300005577 Ga0068857_100039427 Ga0068857_1000394273 154
340 3300005577 Ga0068857_100200012 Ga0068857_1002000122 154
341 3300005577 Ga0068857_101122619 Ga0068857_1011226192 154
342 3300005578 Ga0068854_100033977 Ga0068854_1000339775 154
343 3300005578 Ga0068854_100083539 Ga0068854_1000835392 154
344 3300005578 Ga0068854_100106600 Ga0068854_1001066002 154
345 3300005578 Ga0068854_100557858 Ga0068854_1005578582 154
346 3300005614 Ga0068856_100008253 Ga0068856_10000825310 154
347 3300005614 Ga0068856_100251514 Ga0068856_1002515142 154
348 3300005614 Ga0068856_100900673 Ga0068856_1009006732 154
349 3300005614 Ga0068856_101130044 Ga0068856_1011300441 154
350 3300005614 Ga0068856_101393909 Ga0068856_1013939091 154
351 3300005616 Ga0068852_100013451 Ga0068852_1000134512 154
352 3300005616 Ga0068852_100030542 Ga0068852_1000305426 154
353 3300005616 Ga0068852_100031074 Ga0068852_1000310746 154
354 3300005616 Ga0068852_100125836 Ga0068852_1001258362 154
355 3300005616 Ga0068852_100187856 Ga0068852_1001878562 154
356 3300005616 Ga0068852_100221775 Ga0068852_1002217753 154
357 3300005616 Ga0068852_100279679 Ga0068852_1002796792 154
358 3300005616 Ga0068852_100812574 Ga0068852_1008125742 154
359 3300005616 Ga0068852_101128342 Ga0068852_1011283422 154
360 3300005617 Ga0068859_100914628 Ga0068859_1009146282 154
361 3300005618 Ga0068864_100038826 Ga0068864_1000388262 154
362 3300005618 Ga0068864_100758205 Ga0068864_1007582052 154
363 3300005834 Ga0068851_10008280 Ga0068851_100082806 154
364 3300005834 Ga0068851_10013866 Ga0068851_100138663 154
365 3300005834 Ga0068851_10283083 Ga0068851_102830832 154
366 3300005834 Ga0068851_10383426 Ga0068851_103834261 154
367 3300005841 Ga0068863_100145598 Ga0068863_1001455982 154
368 3300005842 Ga0068858_100019414 Ga0068858_1000194148 154
369 3300005844 Ga0068862_100028027 Ga0068862_1000280276 154
370 3300005985 Ga0081539_10071515 Ga0081539_100715152 154
371 3300006237 Ga0097621_100174739 Ga0097621_1001747392 154
372 3300006237 Ga0097621_100524608 Ga0097621_1005246083 154
373 3300006358 Ga0068871_100716564 Ga0068871_1007165642 154
374 3300006881 Ga0068865_101045468 Ga0068865_1010454681 154
375 3300006931 Ga0097620_100914616 Ga0097620_1009146162 154
376 3300009174 Ga0105241_10503243 Ga0105241_105032431 154
377 3300009177 Ga0105248_10201147 Ga0105248_102011473 154
378 3300013100 Ga0157373_10014974 Ga0157373_100149744 154
379 3300013100 Ga0157373_10438077 Ga0157373_104380772 154
380 3300013100 Ga0157373_10518954 Ga0157373_105189541 154
381 3300013100 Ga0157373_10748786 Ga0157373_107487862 154
382 3300013102 Ga0157371_10078304 Ga0157371_100783044 154
383 3300013104 Ga0157370_10055585 Ga0157370_100555853 154
384 3300013104 Ga0157370_10892455 Ga0157370_108924552 154
385 3300013105 Ga0157369_10127638 Ga0157369_101276381 154
386 3300013105 Ga0157369_10175882 Ga0157369_101758821 154
387 3300013105 Ga0157369_10872117 Ga0157369_108721171 154
388 3300013105 Ga0157369_10881274 Ga0157369_108812742 154
389 3300013296 Ga0157374_10222841 Ga0157374_102228412 154
390 3300013296 Ga0157374_10947297 Ga0157374_109472972 154
391 3300013296 Ga0157374_11024352 Ga0157374_110243521 154
392 3300013306 Ga0163162_11228716 Ga0163162_112287162 154
393 3300013307 Ga0157372_10698367 Ga0157372_106983672 154
394 3300013307 Ga0157372_10886448 Ga0157372_108864481 154
395 3300013307 Ga0157372_11139254 Ga0157372_111392542 154
396 3300013307 Ga0157372_11880512 Ga0157372_118805121 154
397 3300014497 Ga0182008_10538462 Ga0182008_105384621 154
398 3300020078 Ga0206352_10095400 Ga0206352_100954002 154
399 3300020081 Ga0206354_11230177 Ga0206354_112301771 154
400 3300021388 Ga0213875_10011498 Ga0213875_100114985 154
401 3300025315 Ga0207697_10084026 Ga0207697_100840262 154
402 3300025321 Ga0207656_10008268 Ga0207656_100082684 154
403 3300025321 Ga0207656_10038801 Ga0207656_100388012 154
404 3300025321 Ga0207656_10302101 Ga0207656_103021011 154
405 3300025903 Ga0207680_10008315 Ga0207680_100083156 154
406 3300025903 Ga0207680_10284731 Ga0207680_102847312 154
407 3300025904 Ga0207647_10030159 Ga0207647_100301595 154
408 3300025904 Ga0207647_10118329 Ga0207647_101183292 154
409 3300025904 Ga0207647_10218361 Ga0207647_102183612 154
410 3300025909 Ga0207705_10004262 Ga0207705_100042622 154
411 3300025909 Ga0207705_10028284 Ga0207705_100282846 154
412 3300025909 Ga0207705_10057414 Ga0207705_100574142 154
413 3300025909 Ga0207705_10095986 Ga0207705_100959862 154
414 3300025911 Ga0207654_10442327 Ga0207654_104423272 154
415 3300025912 Ga0207707_10017647 Ga0207707_100176475 154
416 3300025912 Ga0207707_10039480 Ga0207707_100394804 154
417 3300025912 Ga0207707_10606412 Ga0207707_106064122 154
418 3300025913 Ga0207695_10154693 Ga0207695_101546932 154
419 3300025914 Ga0207671_10024193 Ga0207671_100241935 154
420 3300025914 Ga0207671_10028319 Ga0207671_100283196 154
421 3300025917 Ga0207660_10003208 Ga0207660_1000320811 154
422 3300025917 Ga0207660_10045526 Ga0207660_100455263 154
423 3300025917 Ga0207660_10189837 Ga0207660_101898372 154
424 3300025919 Ga0207657_10009734 Ga0207657_1000973410 154
425 3300025919 Ga0207657_10015926 Ga0207657_100159262 154
426 3300025919 Ga0207657_10039647 Ga0207657_100396473 154
427 3300025919 Ga0207657_10052428 Ga0207657_100524285 154
428 3300025919 Ga0207657_10072347 Ga0207657_100723474 154
429 3300025919 Ga0207657_10084906 Ga0207657_100849063 154
430 3300025919 Ga0207657_10091364 Ga0207657_100913642 154
431 3300025919 Ga0207657_10121371 Ga0207657_101213712 154
432 3300025919 Ga0207657_10174931 Ga0207657_101749313 154
433 3300025919 Ga0207657_10240584 Ga0207657_102405842 154
434 3300025920 Ga0207649_10012535 Ga0207649_100125353 154
435 3300025920 Ga0207649_10049759 Ga0207649_100497593 154
436 3300025920 Ga0207649_10054438 Ga0207649_100544383 154
437 3300025920 Ga0207649_10081183 Ga0207649_100811832 154
438 3300025920 Ga0207649_10189677 Ga0207649_101896772 154
439 3300025920 Ga0207649_10194158 Ga0207649_101941582 154
440 3300025920 Ga0207649_10224026 Ga0207649_102240262 154
441 3300025920 Ga0207649_10227042 Ga0207649_102270423 154
442 3300025920 Ga0207649_10340610 Ga0207649_103406102 154
443 3300025921 Ga0207652_10009794 Ga0207652_100097943 154
444 3300025924 Ga0207694_10024170 Ga0207694_100241705 154
445 3300025924 Ga0207694_10569298 Ga0207694_105692982 154
446 3300025925 Ga0207650_10005864 Ga0207650_100058647 154
447 3300025928 Ga0207700_11267147 Ga0207700_112671471 154
448 3300025929 Ga0207664_10434529 Ga0207664_104345292 154
449 3300025929 Ga0207664_10647739 Ga0207664_106477392 154
450 3300025931 Ga0207644_10000614 Ga0207644_1000061425 154
451 3300025931 Ga0207644_10006207 Ga0207644_100062079 154
452 3300025931 Ga0207644_10092846 Ga0207644_100928463 154
453 3300025932 Ga0207690_10004475 Ga0207690_100044758 154
454 3300025932 Ga0207690_10029270 Ga0207690_100292703 154
455 3300025932 Ga0207690_10292984 Ga0207690_102929842 154
456 3300025932 Ga0207690_10678778 Ga0207690_106787782 154
457 3300025933 Ga0207706_10078243 Ga0207706_100782432 154
458 3300025933 Ga0207706_10078803 Ga0207706_100788032 154
459 3300025938 Ga0207704_10535421 Ga0207704_105354212 154
460 3300025940 Ga0207691_10021942 Ga0207691_100219428 154
461 3300025941 Ga0207711_10011304 Ga0207711_100113044 154
462 3300025941 Ga0207711_10045504 Ga0207711_100455046 154
463 3300025941 Ga0207711_10167201 Ga0207711_101672013 154
464 3300025944 Ga0207661_10013875 Ga0207661_100138752 154
465 3300025944 Ga0207661_10074814 Ga0207661_100748142 154
466 3300025944 Ga0207661_10084310 Ga0207661_100843103 154
467 3300025944 Ga0207661_10223204 Ga0207661_102232042 154
468 3300025944 Ga0207661_10357131 Ga0207661_103571313 154
469 3300025945 Ga0207679_10197601 Ga0207679_101976012 154
470 3300025949 Ga0207667_10004710 Ga0207667_100047106 154
471 3300025949 Ga0207667_10056357 Ga0207667_100563574 154
472 3300025949 Ga0207667_10087521 Ga0207667_100875213 154
473 3300025949 Ga0207667_10139171 Ga0207667_101391712 154
474 3300025949 Ga0207667_10151223 Ga0207667_101512232 154
475 3300025960 Ga0207651_10070728 Ga0207651_100707282 154
476 3300025960 Ga0207651_10522805 Ga0207651_105228052 154
477 3300025981 Ga0207640_10109202 Ga0207640_101092022 154
478 3300025981 Ga0207640_10880080 Ga0207640_108800802 154
479 3300025981 Ga0207640_11408518 Ga0207640_114085181 154
480 3300025986 Ga0207658_10588695 Ga0207658_105886952 154
481 3300026035 Ga0207703_10249409 Ga0207703_102494091 154
482 3300026041 Ga0207639_10000923 Ga0207639_100009238 154
483 3300026041 Ga0207639_10001159 Ga0207639_1000115926 154
484 3300026041 Ga0207639_10006431 Ga0207639_100064319 154
485 3300026041 Ga0207639_10049640 Ga0207639_100496404 154
486 3300026041 Ga0207639_10542721 Ga0207639_105427212 154
487 3300026067 Ga0207678_10001315 Ga0207678_100013155 154
488 3300026067 Ga0207678_10015007 Ga0207678_100150072 154
489 3300026078 Ga0207702_10002063 Ga0207702_1000206328 154
490 3300026078 Ga0207702_10037780 Ga0207702_100377804 154
491 3300026078 Ga0207702_10082186 Ga0207702_100821863 154
492 3300026078 Ga0207702_10207176 Ga0207702_102071762 154
493 3300026078 Ga0207702_10299371 Ga0207702_102993712 154
494 3300026078 Ga0207702_10896867 Ga0207702_108968672 154
495 3300026088 Ga0207641_10003063 Ga0207641_100030632 154
496 3300026095 Ga0207676_10001223 Ga0207676_1000122324 154
497 3300026116 Ga0207674_10019569 Ga0207674_100195692 154
498 3300026116 Ga0207674_10095577 Ga0207674_100955774 154
499 3300026116 Ga0207674_10118695 Ga0207674_101186953 154
500 3300026116 Ga0207674_10137434 Ga0207674_101374342 154
501 3300026116 Ga0207674_10189915 Ga0207674_101899153 154
502 3300026116 Ga0207674_10609387 Ga0207674_106093871 154
503 3300026121 Ga0207683_10049845 Ga0207683_100498452 154
504 3300026142 Ga0207698_10000896 Ga0207698_100008966 154
505 3300026142 Ga0207698_10008977 Ga0207698_100089776 154
506 3300026142 Ga0207698_10115877 Ga0207698_101158773 154
507 3300026142 Ga0207698_10490829 Ga0207698_104908292 154
508 3300026142 Ga0207698_11253623 Ga0207698_112536232 154
509 3300028379 Ga0268266_10744688 Ga0268266_107446882 154
510 3300028380 Ga0268265_10179851 Ga0268265_101798512 154
511 3300031731 Ga0307405_10347022 Ga0307405_103470222 154
512 3300031824 Ga0307413_10251110 Ga0307413_102511102 154
513 3300031852 Ga0307410_10102566 Ga0307410_101025662 154
514 3300031901 Ga0307406_10421097 Ga0307406_104210972 154
515 3300031903 Ga0307407_10015582 Ga0307407_100155824 154
516 3300031911 Ga0307412_10061430 Ga0307412_100614302 154
517 3300031911 Ga0307412_10260600 Ga0307412_102606002 154
518 3300031995 Ga0307409_100149142 Ga0307409_1001491422 154
519 3300032002 Ga0307416_100004552 Ga0307416_1000045523 154
520 3300032002 Ga0307416_100030216 Ga0307416_1000302164 154
521 3300032004 Ga0307414_10209728 Ga0307414_102097282 154
522 3300032005 Ga0307411_10026146 Ga0307411_100261462 154
523 3300032126 Ga0307415_100016305 Ga0307415_1000163054 154
524 3300032126 Ga0307415_100159749 Ga0307415_1001597492 154
525 3300032126 Ga0307415_100784867 Ga0307415_1007848671 154
526 3300035111 Ga0373923_0027553 Ga0373923_0027553_1315_1857 154
527 3300035111 Ga0373923_0330748 Ga0373923_0330748_65_574 154
528 3300035113 Ga0373936_0353480 Ga0373936_0353480_84_626 154
529 3300035118 Ga0373954_0033151 Ga0373954_0033151_1498_2040 154
530 3300035170 Ga0373943_0016672 Ga0373943_0016672_2057_2602 154
531 3300035170 Ga0373943_0148768 Ga0373943_0148768_453_962 154
532 3300035171 Ga0373946_0066336 Ga0373946_0066336_636_1181 154
533 3300035172 Ga0373955_0002727 Ga0373955_0002727_1216_1758 154
534 3300035692 Ga0373935_0018058 Ga0373935_0018058_1325_1870 154
535 3300035695 Ga0373927_0093144 Ga0373927_0093144_1323_1868 154
536 3300035725 Ga0373947_0316112 Ga0373947_0316112_393_938 154
537 3300036401 Ga0373937_0010753 Ga0373937_0010753_3098_3670 154
538 3300037068 Ga0373925_0010397 Ga0373925_0010397_3479_4021 154
539 3300037068 Ga0373925_0332683 Ga0373925_0332683_302_811 154
540 3300037312 Ga0395899_0014277 Ga0395899_0014277_5401_5943 154
541 3300037312 Ga0395899_0072949 Ga0395899_0072949_1226_1759 154
542 3300037312 Ga0395899_0118898 Ga0395899_0118898_70_591 154
543 3300037312 Ga0395899_0130064 Ga0395899_0130064_944_1504 154
544 3300037312 Ga0395899_0139822 Ga0395899_0139822_1156_1689 154
545 3300037312 Ga0395899_0306411 Ga0395899_0306411_545_1060 154
546 3300037312 Ga0395899_0375049 Ga0395899_0375049_191_736 154
547 3300037312 Ga0395899_0403037 Ga0395899_0403037_128_661 154
548 3300037312 Ga0395899_0411002 Ga0395899_0411002_136_663 154
549 3300037312 Ga0395899_0434941 Ga0395899_0434941_107_622 154
550 3300037312 Ga0395899_0660779 Ga0395899_0660779_23_568 154
551 3300037418 Ga0395900_0001779 Ga0395900_0001779_5559_6110 154
552 3300037418 Ga0395900_0003085 Ga0395900_0003085_3939_4478 154
553 3300037418 Ga0395900_0009276 Ga0395900_0009276_5653_6213 154
554 3300037418 Ga0395900_0033740 Ga0395900_0033740_4461_5003 154
555 3300037418 Ga0395900_0041814 Ga0395900_0041814_136_663 154
556 3300037418 Ga0395900_0060815 Ga0395900_0060815_3124_3657 154
557 3300037418 Ga0395900_0149524 Ga0395900_0149524_207_728 154
558 3300037418 Ga0395900_0198322 Ga0395900_0198322_1489_2004 154
559 3300037418 Ga0395900_0265514 Ga0395900_0265514_966_1499 154
560 3300037418 Ga0395900_0675836 Ga0395900_0675836_214_759 154
561 3300037418 Ga0395900_0679881 Ga0395900_0679881_153_713 154
562 3300037418 Ga0395900_0754379 Ga0395900_0754379_47_583 154
563 3300037418 Ga0395900_0778836 Ga0395900_0778836_231_758 154
564 3300037418 Ga0395900_1468576 Ga0395900_1468576_33_569 154
565 3300037466 Ga0395898_0011721 Ga0395898_0011721_4242_4787 154
566 3300037466 Ga0395898_0021270 Ga0395898_0021270_1417_1959 154
567 3300037466 Ga0395898_0052037 Ga0395898_0052037_2201_2722 154
568 3300037466 Ga0395898_0154726 Ga0395898_0154726_1036_1587 154
569 3300037466 Ga0395898_0379279 Ga0395898_0379279_686_1213 154
570 3300037466 Ga0395898_0500232 Ga0395898_0500232_395_928 154
571 3300037466 Ga0395898_0986595 Ga0395898_0986595_116_643 154
572 3300037471 Ga0395905_0000104 Ga0395905_0000104_97059_97580 154
573 3300037471 Ga0395905_0004102 Ga0395905_0004102_4968_5519 154
574 3300037471 Ga0395905_0008256 Ga0395905_0008256_7656_8216 154
575 3300037471 Ga0395905_0023579 Ga0395905_0023579_211_753 154
576 3300037471 Ga0395905_0029447 Ga0395905_0029447_867_1382 154
577 3300037471 Ga0395905_0034571 Ga0395905_0034571_2675_3217 154
578 3300037471 Ga0395905_0037718 Ga0395905_0037718_3254_3793 154
579 3300037471 Ga0395905_0045504 Ga0395905_0045504_1744_2274 154
580 3300037471 Ga0395905_0208860 Ga0395905_0208860_140_676 154
581 3300037471 Ga0395905_0244205 Ga0395905_0244205_192_737 154
582 3300037471 Ga0395905_0282967 Ga0395905_0282967_136_663 154
583 3300037471 Ga0395905_0478805 Ga0395905_0478805_538_1041 154
584 3300037471 Ga0395905_0517012 Ga0395905_0517012_245_778 154
585 3300037471 Ga0395905_0569978 Ga0395905_0569978_303_836 154
586 3300037471 Ga0395905_0647674 Ga0395905_0647674_157_678 154
587 3300037471 Ga0395905_0729105 Ga0395905_0729105_136_663 154
588 3300037853 Ga0436364_1387927 Ga0436364_1387927_26899_27465 154
589 3300038443 Ga0395901_0000589 Ga0395901_0000589_229_762 154
590 3300038443 Ga0395901_0000782 Ga0395901_0000782_5561_6100 154
591 3300038443 Ga0395901_0103175 Ga0395901_0103175_2345_2887 154
592 3300038443 Ga0395901_0131734 Ga0395901_0131734_1008_1523 154
593 3300038443 Ga0395901_0247424 Ga0395901_0247424_1133_1648 154
594 3300038443 Ga0395901_0262712 Ga0395901_0262712_1134_1661 154
595 3300038443 Ga0395901_0358393 Ga0395901_0358393_399_944 154
596 3300038443 Ga0395901_0827968 Ga0395901_0827968_261_806 154
597 3300038443 Ga0395901_0905836 Ga0395901_0905836_28_588 154
598 3300041413 Ga0439465_0022888 Ga0439465_0022888_1115_1621 154
599 3300042007 Ga0439449_0043119 Ga0439449_0043119_928_1434 154
600 3300042157 Ga0439458_0000590 Ga0439458_0000590_5373_5903 154
601 3300044658 Ga0466972_0005975 Ga0466972_0005975_3987_4544 154
602 3300044658 Ga0466972_0057561 Ga0466972_0057561_1279_1830 154
603 3300044658 Ga0466972_0073628 Ga0466972_0073628_236_793 154
604 3300044683 Ga0466965_0156053 Ga0466965_0156053_155_706 154
605 3300044693 Ga0466961_0149153 Ga0466961_0149153_633_1193 154
606 3300044693 Ga0466961_0307191 Ga0466961_0307191_144_692 154
607 3300044693 Ga0466961_0329009 Ga0466961_0329009_229_789 154
608 3300044693 Ga0466961_0490775 Ga0466961_0490775_157_714 154
609 3300044694 Ga0466963_0010200 Ga0466963_0010200_3220_3762 154
610 3300044694 Ga0466963_0073140 Ga0466963_0073140_123_656 154
611 3300044694 Ga0466963_0246625 Ga0466963_0246625_504_1004 154
612 3300044694 Ga0466963_0304119 Ga0466963_0304119_25_561 154
613 3300044694 Ga0466963_0422153 Ga0466963_0422153_117_647 154
614 3300044694 Ga0466963_0581271 Ga0466963_0581271_193_771 154
615 3300044706 Ga0466964_0151035 Ga0466964_0151035_142_708 154
616 3300044719 Ga0466971_0018356 Ga0466971_0018356_652_1200 154
617 3300044719 Ga0466971_0213122 Ga0466971_0213122_21_572 154
618 3300044719 Ga0466971_0310596 Ga0466971_0310596_172_732 154
619 3300044735 Ga0466968_0246394 Ga0466968_0246394_88_645 154
620 3300044842 Ga0466957_0039900 Ga0466957_0039900_2038_2574 154
621 3300044842 Ga0466957_0113584 Ga0466957_0113584_1026_1583 154
622 3300044842 Ga0466957_0184562 Ga0466957_0184562_437_988 154
623 3300044842 Ga0466957_0274535 Ga0466957_0274535_415_912 154
624 3300044842 Ga0466957_0346149 Ga0466957_0346149_335_901 154
625 3300044842 Ga0466957_0653508 Ga0466957_0653508_93_593 154
626 3300044901 Ga0466960_0047367 Ga0466960_0047367_948_1505 154
627 3300045049 Ga0466959_0219829 Ga0466959_0219829_655_1194 154
628 3300045049 Ga0466959_0480705 Ga0466959_0480705_111_662 154
629 3300045836 Ga0466958_0014825 Ga0466958_0014825_970_1512 154
630 3300045836 Ga0466958_0032340 Ga0466958_0032340_2033_2569 154
631 3300045836 Ga0466958_0202812 Ga0466958_0202812_573_1124 154
632 3300045836 Ga0466958_0282868 Ga0466958_0282868_130_678 154
633 3300045976 Ga0466967_0020005 Ga0466967_0020005_3078_3608 154
634 3300045976 Ga0466967_0088576 Ga0466967_0088576_2176_2718 154
635 3300045976 Ga0466967_0096507 Ga0466967_0096507_1806_2372 154
636 3300045976 Ga0466967_0210613 Ga0466967_0210613_20_577 154
637 3300045976 Ga0466967_0249305 Ga0466967_0249305_175_708 154
638 3300045976 Ga0466967_0297358 Ga0466967_0297358_255_755 154
639 3300045976 Ga0466967_0813755 Ga0466967_0813755_249_785 154
640 3300045976 Ga0466967_0820870 Ga0466967_0820870_183_725 154
641 3300045976 Ga0466967_0893570 Ga0466967_0893570_145_675 154
642 3300045976 Ga0466967_1531166 Ga0466967_1531166_121_651 154
643 3300046525 Ga0495663_0011260 Ga0495663_0011260_1808_2338 154
644 3300046679 Ga0495623_0019538 Ga0495623_0019538_2630_3172 154
645 3300046681 Ga0495647_0348113 Ga0495647_0348113_55_570 154
646 3300046684 Ga0495669_0057703 Ga0495669_0057703_1141_1641 154
647 3300046684 Ga0495669_0387596 Ga0495669_0387596_100_630 154
648 3300048088 Ga0495602_0091257 Ga0495602_0091257_1488_2066 154
649 3300048904 Ga0496101_0457142 Ga0496101_0457142_55_582 154
650 3300048905 Ga0496102_0346638 Ga0496102_0346638_50_577 154
651 3300048905 Ga0496102_0366584 Ga0496102_0366584_133_663 154
652 3300048907 Ga0496104_0137509 Ga0496104_0137509_1715_2269 154
653 3300048908 Ga0496105_0182962 Ga0496105_0182962_675_1229 154
654 3300048909 Ga0496106_0082568 Ga0496106_0082568_1696_2223 154
655 3300048910 Ga0496107_0011494 Ga0496107_0011494_2419_2973 154
656 3300048910 Ga0496107_0131555 Ga0496107_0131555_237_746 154
657 3300048911 Ga0496108_0515020 Ga0496108_0515020_115_669 154
658 3300048912 Ga0496109_0061186 Ga0496109_0061186_2645_3172 154
659 3300048912 Ga0496109_0068968 Ga0496109_0068968_48_602 154
660 3300048912 Ga0496109_0467267 Ga0496109_0467267_222_722 154
661 3300048913 Ga0496110_0025175 Ga0496110_0025175_1774_2328 154
662 3300048913 Ga0496110_0033905 Ga0496110_0033905_1653_2180 154
663 3300048913 Ga0496110_0042482 Ga0496110_0042482_749_1252 154
664 3300048913 Ga0496110_0881018 Ga0496110_0881018_28_558 154
665 3300048914 Ga0496111_0002376 Ga0496111_0002376_2934_3461 154
666 3300048914 Ga0496111_0029259 Ga0496111_0029259_2777_3331 154
667 3300048915 Ga0496112_0040418 Ga0496112_0040418_1608_2162 154
668 3300048915 Ga0496112_0068145 Ga0496112_0068145_321_866 154
669 3300048915 Ga0496112_0143489 Ga0496112_0143489_963_1463 154
670 3300048915 Ga0496112_0443531 Ga0496112_0443531_71_574 154
671 3300048916 Ga0496113_0010921 Ga0496113_0010921_914_1468 154
672 3300048916 Ga0496113_0011965 Ga0496113_0011965_604_1131 154
673 3300048916 Ga0496113_0054432 Ga0496113_0054432_95_625 154
674 3300049668 Ga0501233_005985 Ga0501233_005985_880_1386 154
675 3300049677 Ga0501247_027531 Ga0501247_027531_34_540 154
676 3300049679 Ga0501249_018314 Ga0501249_018314_396_902 154
677 3300049769 Ga0501272_001757 Ga0501272_001757_664_1170 154
678 3300049770 Ga0501273_010041 Ga0501273_010041_529_1035 154
679 3300059490 Ga0587066_046458 Ga0587066_046458_218_760 154
680 3300059503 Ga0587080_010228 Ga0587080_010228_214_756 154
681 3300059510 Ga0587090_010448 Ga0587090_010448_29_571 154
682 3300059630 Ga0587128_026224 Ga0587128_026224_71_613 154
683 3300059644 Ga0587075_016693 Ga0587075_016693_92_634 154
684 3300059647 Ga0587079_075714 Ga0587079_075714_119_661 154
685 3300061719 Ga0466962_0006344 Ga0466962_0006344_3892_4434 154
686 3300061719 Ga0466962_0015820 Ga0466962_0015820_341_892 154
687 3300061719 Ga0466962_0330471 Ga0466962_0330471_67_615 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

59

149

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l2s-assembly1.cif.gz_A solution structure of peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine 0.8723 46 149
3vaw-assembly1.cif.gz_A crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase with surface mutation v3i from burkholderia pseudomallei complexed with fk506 0.8477 44 150
7dki-assembly2.cif.gz_B silk worm fkbp, isoform-1 0.847 49 151
4ipx-assembly1.cif.gz_A analyzing the visible conformational substates of the fk506 binding protein fkbp12 0.8468 49 151
5klx-assembly2.cif.gz_B crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf110 0.844 41 150
ID Description Score Start End Superfamily
af_Q8I4E5_192_283_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.8951 49 119 3.10.50.40
1q6uA02 Alpha Beta;Roll;Chitinase A; domain 3; 0.8441 49 153 3.10.50.40
af_Q95Q60_176_299_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.8427 46 154 3.10.50.40
5xb0A02 Alpha Beta;Roll;Chitinase A; domain 3; 0.8396 49 153 3.10.50.40
4bf8A00 Alpha Beta;Roll;Chitinase A; domain 3; 0.8384 46 151 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A2G8CLM2-F1-model_v4 deleted 0.8665 46 151
AF-A0A447LS44-F1-model_v4 deleted 0.8648 46 154
AF-A0A7X3V2A0-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.8574 45 154 GO:0003755
AF-A0A7S1VTK7-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.8572 48 154 GO:0003755
GO:0005783
GO:0061077
AF-A0A2V5LIT3-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.8527 46 153 GO:0006457
GO:0140839
GO:0140840

Feature Viewer

pLDDT pTM Quality
82.56 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map