F475282

General Info

Members Datasets Scaffolds Average Seq Length
687 542 361 294

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0063923|Ga0495625_0063923_219_1223
Length 334
Sequence LNSLQNNWIEWSYAAPAEADKSPERANSRNLEFSIMDRLTSMAVFVKAVDLGSFAAAADVFEMSGPMVGKHVRFLEERLGVRLLNRTTRRQSLTDAGHAYYERCRAVLSEAEAADAVVANELSEPRGRLRVTVPALLGRHCIAPLLMKLARKYPHLELDLSFGDPIADIIEAGYDLAIRTGDLDDQSGLITRRIASQRMVVCGARSYLRANGKPKSLDDLAAHQAIIYRRSGRVRPWLFPQAGQLPREIMPEGRLRLDDLEAIADAAAQGMGLAWLPYWLVRERFSTGALVGLFGGEPEFLYDCHALWPRSPRMPPKVRAAVDTLAAALPKLMT

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
11 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
12 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
13 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2519899620 Rhizobium sp. Pop5 Isolate Nodule
18 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
21 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
22 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
23 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
26 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
27 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
28 2643221736 Bosea sp. Root483D1 Isolate Unclassified
29 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
30 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
31 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
32 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
33 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
34 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
35 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
36 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
37 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
38 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
39 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
40 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
41 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
42 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
43 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
44 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
45 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
46 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
47 2841760612 Bosea sp. Tri-49 Isolate Nodule
48 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
49 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
50 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
51 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
52 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
53 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
54 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
55 2844104063 Bosea sp. Tri-39 Isolate Nodule
56 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
57 2851246043 Bosea sp. Tri-54 Isolate Nodule
58 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
59 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
60 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
61 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
62 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
63 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
64 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
65 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
66 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
67 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
68 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
69 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
70 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
71 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
72 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
73 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
74 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
75 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
76 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
77 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
78 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
79 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
80 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
81 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
82 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
83 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
84 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
85 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
86 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
87 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
88 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
89 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
90 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
91 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
92 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
93 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
94 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
95 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
96 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
97 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
98 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
99 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
100 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
101 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
102 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
103 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
104 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
105 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
106 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
107 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
108 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
109 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
110 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
111 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
112 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
113 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
114 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
115 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
116 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
117 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
118 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
119 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
120 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
121 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
122 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
123 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
124 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
125 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
126 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
127 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
128 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
129 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
130 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
131 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
132 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
133 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
134 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
135 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
136 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
137 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
138 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
139 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
140 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
141 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
142 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
143 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
144 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
145 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
146 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
147 2909042592 Labrys sp. LIt4 Isolate Nodule
148 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
149 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
150 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
151 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
152 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
153 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
154 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
155 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
156 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
157 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
158 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
159 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
160 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
161 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
162 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
163 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
164 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
165 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
166 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
167 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
168 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
169 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
170 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
171 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
172 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
173 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
174 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
175 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
176 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
177 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
178 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
179 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
180 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
181 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
182 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
183 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
184 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
185 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
186 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
187 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
188 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
189 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
190 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
191 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
192 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
193 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
194 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
195 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
196 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
197 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
198 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
199 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
200 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
201 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
202 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
203 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
204 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
205 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
206 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
207 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
208 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
209 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
210 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
211 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
212 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
213 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
214 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
215 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
216 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
217 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
218 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
219 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
220 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
221 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
222 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
223 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
224 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
225 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
226 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
227 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
228 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
229 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
230 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
231 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
232 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
233 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
234 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
235 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
236 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
237 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
238 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
239 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
240 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
241 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
242 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
243 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
244 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
245 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
246 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
247 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
248 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
249 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
250 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
251 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
252 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
253 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
254 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
255 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
256 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
257 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
258 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
259 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
260 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
261 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
262 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
263 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
264 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
265 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
266 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
267 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
268 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
269 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
270 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
271 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
272 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
273 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
274 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
275 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
276 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
277 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
278 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
279 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
280 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
281 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
282 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
283 3004167301 Mesorhizobium loti 582 Isolate Unclassified
284 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
285 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
286 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
287 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
288 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
289 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
290 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
291 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
292 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
293 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
294 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
295 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
296 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
297 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
298 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
299 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
300 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
301 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
302 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
303 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
304 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
305 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
306 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
307 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
308 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
309 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
310 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
311 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
312 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
313 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
314 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
315 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
316 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
317 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
318 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
319 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
320 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
321 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
322 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
323 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
324 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
325 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
326 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
327 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
328 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
329 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
330 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
331 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
332 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
333 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
334 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
335 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
336 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
337 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
338 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
339 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
340 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
341 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
342 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
343 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
344 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
345 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
346 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
347 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
348 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
349 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
350 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
351 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
352 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
353 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
354 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
355 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
356 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
357 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
358 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
359 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
360 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
361 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
362 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
363 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
364 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
365 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
366 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
367 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
368 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
369 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
371 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
372 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
373 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
374 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
376 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
377 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
378 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
379 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
380 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
381 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
382 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
384 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
385 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
406 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
407 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
408 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
409 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
410 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
413 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
414 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
415 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
416 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
417 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
418 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
419 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
420 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
421 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
422 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
423 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
424 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
425 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
426 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
427 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
428 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
429 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
430 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
431 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
432 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
433 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
434 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
435 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
436 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
437 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
438 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
439 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
440 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
441 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
442 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
443 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
444 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
445 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
446 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
447 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
448 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
449 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
450 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
451 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
452 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
453 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
454 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
455 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
456 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
457 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
458 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
459 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
460 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
461 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
462 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
463 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
464 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
465 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
466 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
467 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
468 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
469 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
470 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
471 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
472 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
473 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
474 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
475 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
476 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
477 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
478 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
479 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
480 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
481 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
482 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
483 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
484 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
485 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
486 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
487 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
488 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
489 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
490 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
491 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
492 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
493 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
494 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
496 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
497 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
498 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
499 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
500 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
501 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
502 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
503 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
504 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
505 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
506 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
507 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
508 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
509 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
510 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
511 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
512 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
513 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
514 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
515 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
516 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
517 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
518 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
519 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
520 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
521 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
522 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
523 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
524 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
525 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
526 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
527 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
528 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
529 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
530 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
531 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
532 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
533 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
534 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
535 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
536 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
537 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
538 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
539 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
540 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
541 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
542 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.62
Metatranscriptomes 0
Isolates 47.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.28
Nodule 41.92
Rhizoplane 2.91
Rhizosphere 28.24
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000092 3300002737 Bacteria 100905
2 JGI25162J39368_1002603 3300002737 Bacteria 6765
3 JGI25158J39367_1000455 3300002739 Bacteria 8383
4 JGI25157J39369_1000175 3300002741 Bacteria 54070
5 JGI25152J39213_1002006 3300002773 Bacteria 8023
6 JGI25152J39213_1004791 3300002773 Bacteria 4151
7 JGI25159J45721_1000930 3300002987 Bacteria 12760
8 JGI25165J46597_1001313 3300003214 Bacteria 14090
9 JGI25165J46597_1010908 3300003214 Bacteria 1312
10 JGI25153J46596_10002456 3300003215 Bacteria 10683
11 JGI25153J46596_10007449 3300003215 Bacteria 5383
12 JGI25153J46596_10010602 3300003215 Bacteria 4151
13 rootH1_10065860 3300003316 Bacteria 2199
14 rootH1_10104155 3300003316 Bacteria 2535
15 rootH1_10138269 3300003323 Bacteria 4487
16 rootH1_10279230 3300003323 Bacteria 2162
17 JGI25160J50197_1000034 3300003354 Bacteria 169670
18 JGI25160J50197_1001127 3300003354 Bacteria 13654
19 JGI25161J50226_1000019 3300003374 Bacteria 169670
20 JGI25161J50226_1000314 3300003374 Bacteria 26620
21 Ga0055529_1004473 3300003763 Bacteria 2122
22 Ga0055526_1000368 3300003771 Bacteria 36399
23 Ga0055526_1000420 3300003771 Bacteria 34141
24 Ga0055526_1000549 3300003771 Bacteria 29652
25 Ga0055526_1001050 3300003771 Bacteria 20158
26 Ga0055537_1000159 3300003773 Bacteria 50407
27 Ga0055524_1018769 3300003775 Bacteria 2390
28 Ga0055524_1018859 3300003775 Bacteria 2379
29 Ga0055534_1000451 3300003784 Bacteria 24079
30 Ga0055528_1000147 3300003790 Bacteria 57895
31 Ga0055528_1009522 3300003790 Bacteria 4047
32 Ga0055540_1012486 3300003792 Bacteria 2662
33 Ga0055540_1017491 3300003792 Bacteria 1999
34 Ga0055543_1000018 3300004625 Bacteria 169708
35 Ga0055543_1000525 3300004625 Bacteria 21838
36 Ga0065165_1000121 3300005262 Bacteria 134128
37 Ga0065165_1012357 3300005262 Bacteria 3483
38 Ga0070658_10207794 3300005327 Bacteria 1653
39 Ga0070682_100092577 3300005337 Bacteria 1981
40 Ga0070660_100059089 3300005339 Bacteria 2973
41 Ga0070660_100259017 3300005339 Bacteria 1420
42 Ga0070668_100190756 3300005347 Bacteria 1678
43 Ga0070669_100193352 3300005353 Bacteria 1597
44 Ga0070671_100044376 3300005355 Bacteria 3694
45 Ga0070659_100065010 3300005366 Bacteria 2888
46 Ga0070659_100356690 3300005366 Bacteria 1228
47 Ga0070659_100511199 3300005366 Bacteria 1025
48 Ga0070667_100094016 3300005367 Bacteria 2582
49 Ga0070663_100053132 3300005455 Bacteria 2891
50 Ga0070663_100089484 3300005455 Bacteria 2278
51 Ga0070663_100212118 3300005455 Bacteria 1517
52 Ga0070663_100510366 3300005455 Bacteria 1000
53 Ga0070662_100085325 3300005457 Bacteria 2359
54 Ga0068867_100075108 3300005459 Bacteria 2535
55 Ga0070665_100131391 3300005548 Bacteria 2506
56 Ga0070665_100257106 3300005548 Bacteria 1748
57 Ga0070665_100302624 3300005548 Bacteria 1602
58 Ga0070665_100381009 3300005548 Bacteria 1418
59 Ga0068855_100454142 3300005563 Bacteria 1398
60 Ga0068857_100030382 3300005577 Bacteria 4771
61 Ga0068856_100501499 3300005614 Bacteria 1235
62 Ga0068852_100003454 3300005616 Bacteria 11050
63 Ga0068852_100043141 3300005616 Bacteria 3824
64 Ga0068864_100122837 3300005618 Bacteria 2324
65 Ga0068851_10155879 3300005834 Bacteria 1251
66 Ga0075365_10038993 3300006038 Bacteria 3091
67 Ga0075365_10252405 3300006038 Bacteria 1239
68 Ga0075363_100004571 3300006048 Bacteria 6068
69 Ga0075364_10011401 3300006051 Bacteria 5401
70 Ga0075364_10084970 3300006051 Bacteria 2095
71 Ga0075366_10035418 3300006195 Bacteria 2942
72 Ga0075370_10034992 3300006353 Bacteria 2817
73 Ga0099825_1039343 3300006941 Bacteria 1458
74 Ga0099824_1012241 3300006942 Bacteria 9427
75 Ga0099824_1022377 3300006942 Bacteria 4181
76 Ga0099822_1017281 3300006943 Bacteria 7741
77 Ga0099826_10000013 3300006948 Bacteria 265459
78 Ga0105244_10003099 3300009036 Bacteria 12169
79 Ga0105240_10038137 3300009093 Bacteria 6167
80 Ga0105243_10050150 3300009148 Bacteria 3296
81 Ga0105241_10207746 3300009174 Bacteria 1639
82 Ga0105248_10035824 3300009177 Bacteria 5550
83 Ga0105237_10060297 3300009545 Bacteria 3796
84 Ga0105237_10092609 3300009545 Bacteria 3012
85 Ga0105237_10284192 3300009545 Bacteria 1657
86 Ga0105237_10458138 3300009545 Bacteria 1281
87 Ga0105238_10171425 3300009551 Bacteria 2146
88 Ga0105238_10348079 3300009551 Bacteria 1471
89 Ga0105238_10348937 3300009551 Bacteria 1469
90 Ga0105249_10079100 3300009553 Bacteria 3052
91 Ga0105239_10061498 3300010375 Bacteria 4122
92 Ga0105239_10066808 3300010375 Bacteria 3950
93 Ga0105239_10215118 3300010375 Bacteria 2154
94 Ga0105239_10469998 3300010375 Bacteria 1428
95 Ga0157371_10000008 3300013102 Bacteria 393028
96 Ga0157369_10169086 3300013105 Bacteria 2304
97 Ga0157369_10587966 3300013105 Bacteria 1150
98 Ga0171462_1008 3300013250 Bacteria 384318
99 Ga0157374_10115337 3300013296 Bacteria 2587
100 Ga0157372_10082125 3300013307 Bacteria 3648
101 Ga0163163_10009184 3300014325 Bacteria 8811
102 Ga0163163_10156797 3300014325 Bacteria 2321
103 Ga0182008_10000284 3300014497 Bacteria 39712
104 Ga0182008_10024751 3300014497 Bacteria 3053
105 Ga0157377_10194753 3300014745 Bacteria 1283
106 Ga0182007_10008211 3300015262 Bacteria 4302
107 Ga0214544_1000002 3300021320 Bacteria 753857
108 Ga0214542_1000001 3300021321 Bacteria 1018696
109 Ga0214545_1000001 3300021324 Bacteria 1092817
110 Ga0214543_1000001 3300021327 Bacteria 776921
111 Ga0209436_100872 3300025208 Bacteria 12064
112 Ga0209437_100023 3300025233 Bacteria 614195
113 Ga0207425_1002019 3300025245 Bacteria 7563
114 Ga0209026_1000005 3300025250 Bacteria 731387
115 Ga0209148_1000057 3300025254 Bacteria 360463
116 Ga0209759_1000111 3300025256 Bacteria 143545
117 Ga0209129_1000680 3300025258 Bacteria 22439
118 Ga0209129_1004043 3300025258 Bacteria 5986
119 Ga0209233_1000219 3300025261 Bacteria 104797
120 Ga0209233_1001070 3300025261 Bacteria 11346
121 Ga0209233_1004320 3300025261 Bacteria 4856
122 Ga0209233_1007596 3300025261 Bacteria 3419
123 Ga0209565_1000003 3300025263 Bacteria 1099648
124 Ga0209455_1000131 3300025272 Bacteria 160715
125 Ga0209673_1000003 3300025273 Bacteria 980859
126 Ga0209673_1002512 3300025273 Bacteria 12595
127 Ga0209130_1000006 3300025284 Bacteria 596528
128 Ga0209130_1000077 3300025284 Bacteria 169722
129 Ga0209130_1000279 3300025284 Bacteria 63145
130 Ga0209675_1000003 3300025291 Bacteria 1003982
131 Ga0209676_1000049 3300025292 Bacteria 403210
132 Ga0209025_1016884 3300025294 Bacteria 4261
133 Ga0209564_1000012 3300025295 Bacteria 792078
134 Ga0209564_1000031 3300025295 Bacteria 494703
135 Ga0209564_1000166 3300025295 Bacteria 160208
136 Ga0209564_1001524 3300025295 Bacteria 23030
137 Ga0209758_1000160 3300025297 Bacteria 154304
138 Ga0209758_1004797 3300025297 Bacteria 10927
139 Ga0209758_1004868 3300025297 Bacteria 10818
140 Ga0209758_1006348 3300025297 Bacteria 8559
141 Ga0209758_1046870 3300025297 Bacteria 1553
142 Ga0209758_1055474 3300025297 Bacteria 1345
143 Ga0209050_1004332 3300025298 Bacteria 9680
144 Ga0209256_1000431 3300025299 Bacteria 65392
145 Ga0209256_1001361 3300025299 Bacteria 25724
146 Ga0207426_1000054 3300025302 Bacteria 384435
147 Ga0207426_1000231 3300025302 Bacteria 128171
148 Ga0207426_1000705 3300025302 Bacteria 39483
149 Ga0207426_1045680 3300025302 Bacteria 1331
150 Ga0209051_1007868 3300025303 Bacteria 5750
151 Ga0209051_1063848 3300025303 Bacteria 1144
152 Ga0209257_1000239 3300025304 Bacteria 128383
153 Ga0209257_1014795 3300025304 Bacteria 3313
154 Ga0207647_10008593 3300025904 Bacteria 7307
155 Ga0207705_10162241 3300025909 Bacteria 1680
156 Ga0207695_10038247 3300025913 Bacteria 5168
157 Ga0207695_10566941 3300025913 Bacteria 1017
158 Ga0207671_10015652 3300025914 Bacteria 5930
159 Ga0207671_10069366 3300025914 Bacteria 2628
160 Ga0207671_10088052 3300025914 Bacteria 2335
161 Ga0207671_10117108 3300025914 Bacteria 2033
162 Ga0207657_10059128 3300025919 Bacteria 3296
163 Ga0207657_10062614 3300025919 Bacteria 3184
164 Ga0207681_10146002 3300025923 Bacteria 1768
165 Ga0207694_10189141 3300025924 Bacteria 1672
166 Ga0207694_10256339 3300025924 Bacteria 1432
167 Ga0207644_10050149 3300025931 Bacteria 2991
168 Ga0207706_10087457 3300025933 Bacteria 2740
169 Ga0207709_10084172 3300025935 Bacteria 2058
170 Ga0207667_10325644 3300025949 Bacteria 1569
171 Ga0207668_10097977 3300025972 Bacteria 2171
172 Ga0207658_10210469 3300025986 Bacteria 1629
173 Ga0207678_10027446 3300026067 Bacteria 4966
174 Ga0207678_10081088 3300026067 Bacteria 2777
175 Ga0207678_10104411 3300026067 Bacteria 2418
176 Ga0207678_10313739 3300026067 Bacteria 1348
177 Ga0207702_10019913 3300026078 Bacteria 5558
178 Ga0207702_10519127 3300026078 Bacteria 1163
179 Ga0207676_10248414 3300026095 Bacteria 1600
180 Ga0207674_10039940 3300026116 Bacteria 4862
181 Ga0207674_10085683 3300026116 Bacteria 3145
182 Ga0207674_10095178 3300026116 Bacteria 2964
183 Ga0207698_10002176 3300026142 Bacteria 11585
184 Ga0207698_10010109 3300026142 Bacteria 6043
185 Ga0209389_1000081 3300027296 Bacteria 89601
186 Ga0209589_1000001 3300027357 Bacteria 794224
187 Ga0209589_1000091 3300027357 Bacteria 89601
188 Ga0209489_100001 3300027361 Bacteria 794224
189 Ga0209489_100096 3300027361 Bacteria 122075
190 Ga0209700_100001 3300027363 Bacteria 794224
191 Ga0209282_1000043 3300027666 Bacteria 119260
192 Ga0268266_10101737 3300028379 Bacteria 2534
193 Ga0268266_10107504 3300028379 Bacteria 2467
194 Ga0268266_10175494 3300028379 Bacteria 1948
195 Ga0268265_10013853 3300028380 Bacteria 5488
196 Ga0307513_10153601 3300031456 Bacteria 2206
197 Ga0307408_100008605 3300031548 Bacteria 6740
198 Ga0307408_100252656 3300031548 Bacteria 1455
199 Ga0307416_100074581 3300032002 Bacteria 2835
200 Ga0395899_0001863 3300037312 Bacteria 17434
201 Ga0395899_0049669 3300037312 Bacteria 3117
202 Ga0395899_0162205 3300037312 Bacteria 1578
203 Ga0395900_0005273 3300037418 Bacteria 13551
204 Ga0395900_0007017 3300037418 Bacteria 11665
205 Ga0395898_0004346 3300037466 Bacteria 15517
206 Ga0395898_0005843 3300037466 Bacteria 13233
207 Ga0395898_0290846 3300037466 Bacteria 1559
208 Ga0395905_0028459 3300037471 Bacteria 5268
209 Ga0395905_0052441 3300037471 Bacteria 3818
210 Ga0395905_0056729 3300037471 Bacteria 3663
211 Ga0395905_0089138 3300037471 Bacteria 2891
212 Ga0395905_0115693 3300037471 Bacteria 2520
213 Ga0395901_0000715 3300038443 Bacteria 37852
214 Ga0395901_0043019 3300038443 Bacteria 4685
215 Ga0395901_0188522 3300038443 Bacteria 2163
216 Ga0395901_0242355 3300038443 Bacteria 1880
217 Ga0395901_0434526 3300038443 Bacteria 1344
218 Ga0439436_0000790 3300041404 Bacteria 8556
219 Ga0439439_0040880 3300041406 Bacteria 1201
220 Ga0439465_0000496 3300041413 Bacteria 11730
221 Ga0439465_0002719 3300041413 Bacteria 5781
222 Ga0439465_0051984 3300041413 Bacteria 1344
223 Ga0451802_1930353 3300041460 Bacteria 1375
224 Ga0439431_0000492 3300041997 Bacteria 8361
225 Ga0439433_0000544 3300041999 Bacteria 7112
226 Ga0439442_002780 3300042002 Bacteria 3437
227 Ga0439445_0008847 3300042004 Bacteria 2365
228 Ga0439432_000899 3300042006 Bacteria 11161
229 Ga0439449_0001320 3300042007 Bacteria 9713
230 Ga0439449_0030486 3300042007 Bacteria 2010
231 Ga0439452_004610 3300042010 Bacteria 4580
232 Ga0439457_006915 3300042014 Bacteria 2744
233 Ga0439446_0053956 3300042156 Bacteria 1204
234 Ga0450909_014317 3300042185 Bacteria 1168
235 Ga0439434_0004219 3300042435 Bacteria 4198
236 Ga0466972_0000276 3300044658 Bacteria 32176
237 Ga0466972_0030288 3300044658 Bacteria 2664
238 Ga0466966_0073389 3300044684 Bacteria 2140
239 Ga0466961_0009262 3300044693 Bacteria 6268
240 Ga0466961_0186844 3300044693 Bacteria 1285
241 Ga0466964_0130686 3300044706 Bacteria 1143
242 Ga0466957_0000335 3300044842 Bacteria 22997
243 Ga0466959_0011613 3300045049 Bacteria 6331
244 Ga0466959_0319083 3300045049 Bacteria 1062
245 Ga0466958_0043848 3300045836 Bacteria 2695
246 Ga0466967_0041480 3300045976 Bacteria 3968
247 Ga0495605_0003306 3300046474 Bacteria 9652
248 Ga0495605_0114086 3300046474 Bacteria 1230
249 Ga0495584_0039536 3300046491 Bacteria 2383
250 Ga0495596_0000058 3300046500 Bacteria 80763
251 Ga0495607_0000091 3300046501 Bacteria 93971
252 Ga0495607_0009070 3300046501 Bacteria 6761
253 Ga0495606_0068202 3300046507 Bacteria 2251
254 Ga0495606_0069036 3300046507 Bacteria 2234
255 Ga0495606_0088600 3300046507 Bacteria 1908
256 Ga0495606_0148718 3300046507 Bacteria 1376
257 Ga0495610_0000563 3300046512 Bacteria 37173
258 Ga0495610_0058975 3300046512 Bacteria 1834
259 Ga0495616_0004221 3300046513 Bacteria 9092
260 Ga0495616_0081134 3300046513 Bacteria 1552
261 Ga0495620_0000585 3300046515 Bacteria 22803
262 Ga0495620_0042915 3300046515 Bacteria 1973
263 Ga0495628_0177893 3300046516 Bacteria 1611
264 Ga0495632_0121463 3300046519 Bacteria 1221
265 Ga0495643_0013748 3300046522 Bacteria 4834
266 Ga0495643_0043021 3300046522 Bacteria 2459
267 Ga0495648_0177677 3300046524 Bacteria 1085
268 Ga0495609_0002472 3300046538 Bacteria 11352
269 Ga0495622_0076067 3300046557 Bacteria 1547
270 Ga0495668_0032305 3300046616 Bacteria 2946
271 Ga0495625_0063923 3300046660 Bacteria 2598
272 Ga0495625_0162677 3300046660 Bacteria 1494
273 Ga0495661_0005184 3300046665 Bacteria 9286
274 Ga0495670_0087849 3300046691 Bacteria 1589
275 Ga0495671_0000878 3300046692 Bacteria 21471
276 Ga0495649_0007422 3300046694 Bacteria 6683
277 Ga0495649_0022915 3300046694 Bacteria 3491
278 Ga0495649_0103508 3300046694 Bacteria 1512
279 Ga0495660_0103802 3300046810 Bacteria 1460
280 Ga0495672_0001648 3300047320 Bacteria 21695
281 Ga0495672_0024227 3300047320 Bacteria 3914
282 Ga0495687_014462 3300047443 Bacteria 4060
283 Ga0495685_034557 3300047447 Bacteria 1737
284 Ga0495686_0069999 3300047472 Bacteria 2162
285 Ga0495686_0166102 3300047472 Bacteria 1286
286 Ga0495602_0033463 3300048088 Bacteria 4822
287 Ga0496100_0297859 3300048903 Bacteria 1206
288 Ga0496101_0295266 3300048904 Bacteria 1268
289 Ga0496102_0201627 3300048905 Bacteria 1875
290 Ga0496103_0040858 3300048906 Bacteria 2850
291 Ga0496103_0063652 3300048906 Bacteria 2298
292 Ga0496104_0089345 3300048907 Bacteria 2943
293 Ga0496105_0077581 3300048908 Bacteria 2743
294 Ga0496105_0217534 3300048908 Bacteria 1556
295 Ga0496106_0010509 3300048909 Bacteria 6837
296 Ga0496107_0133542 3300048910 Bacteria 1833
297 Ga0496108_0024440 3300048911 Bacteria 4974
298 Ga0496109_0233850 3300048912 Bacteria 1729
299 Ga0496110_0051267 3300048913 Bacteria 3626
300 Ga0496111_0052530 3300048914 Bacteria 2943
301 Ga0496112_0027666 3300048915 Bacteria 5468
302 Ga0496112_0713950 3300048915 Bacteria 930
303 Ga0496113_0659257 3300048916 Bacteria 837
304 Ga0496115_0374132 3300048918 Bacteria 1159
305 Ga0496116_0002090 3300048919 Bacteria 21348
306 Ga0496116_0031044 3300048919 Bacteria 3833
307 Ga0496116_0043678 3300048919 Bacteria 3051
308 Ga0496116_0057588 3300048919 Bacteria 2540
309 Ga0496117_0034851 3300048920 Bacteria 3786
310 Ga0496117_0057750 3300048920 Bacteria 2692
311 Ga0496118_0030764 3300048921 Bacteria 4469
312 Ga0496118_0182205 3300048921 Bacteria 1268
313 Ga0496119_0063593 3300048922 Bacteria 2194
314 Ga0496121_0009355 3300048924 Bacteria 11285
315 Ga0496121_0017479 3300048924 Bacteria 7324
316 Ga0496121_0033710 3300048924 Bacteria 4628
317 Ga0496121_0090241 3300048924 Bacteria 2396
318 Ga0496121_0102775 3300048924 Bacteria 2200
319 Ga0496121_0144883 3300048924 Bacteria 1757
320 Ga0496122_0000908 3300048925 Bacteria 54441
321 Ga0496122_0126623 3300048925 Bacteria 1633
322 Ga0496123_0000412 3300048926 Bacteria 78170
323 Ga0496123_0053952 3300048926 Bacteria 2651
324 Ga0496124_0074146 3300048927 Bacteria 2814
325 Ga0496124_0131228 3300048927 Bacteria 1990
326 Ga0496125_0106973 3300048928 Bacteria 2040
327 Ga0496125_0170890 3300048928 Bacteria 1461
328 Ga0496126_0086440 3300048929 Bacteria 2764
329 Ga0496126_0186406 3300048929 Bacteria 1759
330 Ga0501034_0273800 3300049571 Bacteria 1629
331 Ga0501067_0082981 3300049583 Bacteria 1778
332 Ga0501069_0042973 3300049585 Bacteria 2501
333 nmdc:mga00v17_33513_c1 3300050491 Bacteria 3043
334 nmdc:mga00v17_84908_c1 3300050491 Bacteria 1982
335 nmdc:mga0yw44_127436_c1 3300050492 Bacteria 1645
336 nmdc:mga0yw44_1668_c1 3300050492 Bacteria 8969
337 nmdc:mga0yw44_274082_c1 3300050492 Bacteria 1127
338 nmdc:mga0yw44_3052_c1 3300050492 Bacteria 7328
339 nmdc:mga0k408_31429_c2 3300050493 Bacteria 2611
340 nmdc:mga06z11_39431_c1 3300050494 Bacteria 2351
341 nmdc:mga07m45_39802_c1 3300050496 Bacteria 2629
342 nmdc:mga07m45_60485_c1 3300050496 Bacteria 2144
343 nmdc:mga0sz30_121224_c1 3300050516 Bacteria 1149
344 nmdc:mga0sz30_4624_c1 3300050516 Bacteria 4985
345 nmdc:mga0sz30_86308_c1 3300050516 Bacteria 1362
346 Ga0495655_0017738 3300053083 Bacteria 1555
347 Ga0500578_0116963 3300053086 Bacteria 1678
348 Ga0500578_0128117 3300053086 Bacteria 1593
349 Ga0500555_002838 3300053103 Bacteria 4973
350 Ga0500595_003494 3300053119 Bacteria 7311
351 Ga0500595_017867 3300053119 Bacteria 2606
352 Ga0500658_0013921 3300053134 Bacteria 2975
353 Ga0500568_0005153 3300053139 Bacteria 6817
354 Ga0500577_0024570 3300053142 Bacteria 2028
355 Ga0500588_0000957 3300053146 Bacteria 5149
356 Ga0500616_0002115 3300053153 Bacteria 17246
357 Ga0500622_0006732 3300053156 Bacteria 6623
358 Ga0500633_0010581 3300053160 Bacteria 2475
359 Ga0501082_0092626 3300060353 Bacteria 2611
360 Ga0466962_0048860 3300061719 Bacteria 2021
361 Ga0466962_0051794 3300061719 Bacteria 1963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0092626 Ga0501082_0092626_183_959 250
2 iso_pu_bacteria 2970532167 2970535170 257
3 iso_pu_bacteria 2987673487 2987674451 257
4 3300048924 Ga0496121_0033710 Ga0496121_0033710_1962_2846 260
5 3300053142 Ga0500577_0024570 Ga0500577_0024570_1206_2012 260
6 iso_pu_bacteria 3004248173 3004255251 260
7 3300037466 Ga0395898_0290846 Ga0395898_0290846_13_822 261
8 3300048916 Ga0496113_0659257 Ga0496113_0659257_18_827 261
9 3300050516 nmdc:mga0sz30_121224_c1 nmdc:mga0sz30_121224_c1_330_1139 261
10 iso_pu_bacteria 2878730984 2878732670 262
11 3300048903 Ga0496100_0297859 Ga0496100_0297859_362_1177 263
12 3300048915 Ga0496112_0713950 Ga0496112_0713950_81_896 263
13 3300002739 JGI25158J39367_1000455 JGI25158J39367_10004556 267
14 3300002773 JGI25152J39213_1002006 JGI25152J39213_10020064 267
15 3300002773 JGI25152J39213_1004791 JGI25152J39213_10047912 267
16 3300003215 JGI25153J46596_10007449 JGI25153J46596_100074492 267
17 3300003215 JGI25153J46596_10010602 JGI25153J46596_100106022 267
18 3300003374 JGI25161J50226_1000314 JGI25161J50226_100031417 267
19 3300003771 Ga0055526_1001050 Ga0055526_100105018 267
20 3300003775 Ga0055524_1018859 Ga0055524_10188591 267
21 3300003790 Ga0055528_1009522 Ga0055528_10095222 267
22 3300003792 Ga0055540_1012486 Ga0055540_10124862 267
23 3300003792 Ga0055540_1017491 Ga0055540_10174912 267
24 3300004625 Ga0055543_1000525 Ga0055543_10005252 267
25 3300005262 Ga0065165_1012357 Ga0065165_10123572 267
26 3300005353 Ga0070669_100193352 Ga0070669_1001933522 267
27 3300005548 Ga0070665_100302624 Ga0070665_1003026242 267
28 3300025208 Ga0209436_100872 Ga0209436_1008726 267
29 3300025245 Ga0207425_1002019 Ga0207425_10020192 267
30 3300025258 Ga0209129_1000680 Ga0209129_100068014 267
31 3300025258 Ga0209129_1004043 Ga0209129_10040437 267
32 3300025273 Ga0209673_1002512 Ga0209673_100251214 267
33 3300025284 Ga0209130_1000006 Ga0209130_1000006389 267
34 3300025294 Ga0209025_1016884 Ga0209025_10168845 267
35 3300025295 Ga0209564_1001524 Ga0209564_100152422 267
36 3300025297 Ga0209758_1004868 Ga0209758_10048686 267
37 3300025297 Ga0209758_1006348 Ga0209758_10063483 267
38 3300025302 Ga0207426_1000231 Ga0207426_100023133 267
39 3300025303 Ga0209051_1007868 Ga0209051_10078683 267
40 3300025923 Ga0207681_10146002 Ga0207681_101460022 267
41 3300028379 Ga0268266_10175494 Ga0268266_101754942 267
42 3300041413 Ga0439465_0002719 Ga0439465_0002719_3645_4544 267
43 3300046474 Ga0495605_0003306 Ga0495605_0003306_125_1033 267
44 3300046491 Ga0495584_0039536 Ga0495584_0039536_1445_2353 267
45 3300046500 Ga0495596_0000058 Ga0495596_0000058_59429_60337 267
46 3300046501 Ga0495607_0009070 Ga0495607_0009070_5766_6674 267
47 3300046507 Ga0495606_0069036 Ga0495606_0069036_514_1422 267
48 3300046512 Ga0495610_0000563 Ga0495610_0000563_27785_28693 267
49 3300046513 Ga0495616_0004221 Ga0495616_0004221_4782_5690 267
50 3300046519 Ga0495632_0121463 Ga0495632_0121463_134_1033 267
51 3300046522 Ga0495643_0043021 Ga0495643_0043021_455_1354 267
52 3300046524 Ga0495648_0177677 Ga0495648_0177677_57_956 267
53 3300046665 Ga0495661_0005184 Ga0495661_0005184_5361_6269 267
54 3300046692 Ga0495671_0000878 Ga0495671_0000878_20509_21417 267
55 3300046694 Ga0495649_0007422 Ga0495649_0007422_5237_6145 267
56 3300046694 Ga0495649_0022915 Ga0495649_0022915_1446_2345 267
57 3300047447 Ga0495685_034557 Ga0495685_034557_150_1058 267
58 3300048919 Ga0496116_0002090 Ga0496116_0002090_19257_20165 267
59 3300048919 Ga0496116_0043678 Ga0496116_0043678_543_1442 267
60 3300048924 Ga0496121_0009355 Ga0496121_0009355_4720_5628 267
61 3300048924 Ga0496121_0017479 Ga0496121_0017479_4951_5850 267
62 3300048925 Ga0496122_0000908 Ga0496122_0000908_33100_34008 267
63 3300048925 Ga0496122_0126623 Ga0496122_0126623_110_1009 267
64 3300048926 Ga0496123_0000412 Ga0496123_0000412_59929_60837 267
65 3300048926 Ga0496123_0053952 Ga0496123_0053952_1416_2315 267
66 3300048927 Ga0496124_0131228 Ga0496124_0131228_62_961 267
67 3300048928 Ga0496125_0106973 Ga0496125_0106973_203_1111 267
68 3300048928 Ga0496125_0170890 Ga0496125_0170890_19_918 267
69 3300048929 Ga0496126_0086440 Ga0496126_0086440_1806_2714 267
70 3300050516 nmdc:mga0sz30_86308_c1 nmdc:mga0sz30_86308_c1_174_1073 267
71 3300053156 Ga0500622_0006732 Ga0500622_0006732_1405_2304 267
72 3300046538 Ga0495609_0002472 Ga0495609_0002472_8201_9109 268
73 3300046810 Ga0495660_0103802 Ga0495660_0103802_284_1192 268
74 3300047320 Ga0495672_0024227 Ga0495672_0024227_1713_2621 268
75 3300006948 Ga0099826_10000013 Ga0099826_10000013192 274
76 3300027666 Ga0209282_1000043 Ga0209282_100004399 274
77 iso_pu_bacteria 8016583857 8016591663 274
78 3300048927 Ga0496124_0074146 Ga0496124_0074146_348_1229 276
79 3300046691 Ga0495670_0087849 Ga0495670_0087849_477_1358 278
80 iso_pu_bacteria 2852387548 2852388220 278
81 iso_pu_bacteria 2857349434 2857354611 278
82 iso_pu_bacteria 2876369609 2876377044 278
83 iso_pu_bacteria 2889010040 2889013613 278
84 iso_pu_bacteria 2889016732 2889021671 278
85 iso_pu_bacteria 2922185730 2922193957 278
86 3300041460 Ga0451802_1930353 Ga0451802_1930353_407_1306 279
87 iso_pu_bacteria 2928521798 2928522462 280
88 iso_pu_bacteria 2954011201 2954014145 280
89 3300048088 Ga0495602_0033463 Ga0495602_0033463_336_1262 281
90 iso_pu_bacteria 2509276019 2509377272 281
91 iso_pu_bacteria 2558860100 2558862203 281
92 iso_pu_bacteria 2838122688 2838123669 281
93 iso_pu_bacteria 2881161766 2881166215 281
94 iso_pu_bacteria 2509276022 2509398288 282
95 iso_pu_bacteria 2588253730 2588514796 282
96 iso_pu_bacteria 2599185301 2599939503 282
97 iso_pu_bacteria 2856364286 2856365567 282
98 iso_pu_bacteria 2869285874 2869287043 282
99 iso_pu_bacteria 2871429161 2871434349 282
100 iso_pu_bacteria 2874146452 2874147484 282
101 iso_pu_bacteria 2874155637 2874156490 282
102 iso_pu_bacteria 2876377896 2876384497 282
103 iso_pu_bacteria 2876413966 2876414678 282
104 iso_pu_bacteria 2878745973 2878747224 282
105 iso_pu_bacteria 2903492973 2903500166 282
106 iso_pu_bacteria 2903521522 2903526686 282
107 iso_pu_bacteria 2903528002 2903530695 282
108 iso_pu_bacteria 2906308376 2906309396 282
109 iso_pu_bacteria 2906321335 2906327046 282
110 iso_pu_bacteria 2938014810 2938018539 282
111 iso_pu_bacteria 8004640170 8004642530 282
112 iso_pu_bacteria 2524023228 2524538588 283
113 3300009093 Ga0105240_10038137 Ga0105240_100381375 284
114 3300025913 Ga0207695_10038247 Ga0207695_100382474 284
115 3300048908 Ga0496105_0077581 Ga0496105_0077581_1849_2727 284
116 3300048921 Ga0496118_0182205 Ga0496118_0182205_235_1137 284
117 3300002737 JGI25162J39368_1002603 JGI25162J39368_10026036 285
118 3300003214 JGI25165J46597_1001313 JGI25165J46597_100131314 285
119 3300003354 JGI25160J50197_1000034 JGI25160J50197_100003437 285
120 3300003374 JGI25161J50226_1000019 JGI25161J50226_1000019140 285
121 3300004625 Ga0055543_1000018 Ga0055543_100001837 285
122 3300005262 Ga0065165_1000121 Ga0065165_100012137 285
123 3300025233 Ga0209437_100023 Ga0209437_10002363 285
124 3300025261 Ga0209233_1000219 Ga0209233_100021963 285
125 3300025284 Ga0209130_1000077 Ga0209130_100007737 285
126 3300025292 Ga0209676_1000049 Ga0209676_1000049382 285
127 3300025298 Ga0209050_1004332 Ga0209050_100433210 285
128 3300025302 Ga0207426_1000054 Ga0207426_100005437 285
129 3300044706 Ga0466964_0130686 Ga0466964_0130686_14_898 285
130 iso_pu_bacteria 2977986579 2977992837 285
131 3300010375 Ga0105239_10061498 Ga0105239_100614984 286
132 3300010375 Ga0105239_10066808 Ga0105239_100668083 286
133 3300013105 Ga0157369_10587966 Ga0157369_105879662 286
134 3300013296 Ga0157374_10115337 Ga0157374_101153372 286
135 3300050491 nmdc:mga00v17_33513_c1 nmdc:mga00v17_33513_c1_313_1197 286
136 3300050492 nmdc:mga0yw44_1668_c1 nmdc:mga0yw44_1668_c1_7949_8833 286
137 3300050492 nmdc:mga0yw44_3052_c1 nmdc:mga0yw44_3052_c1_5194_6078 286
138 3300050496 nmdc:mga07m45_60485_c1 nmdc:mga07m45_60485_c1_297_1181 286
139 iso_pu_bacteria 2824661429 2824665734 286
140 iso_pu_bacteria 2879099564 2879105838 286
141 iso_pu_bacteria 2932784394 2932790439 286
142 iso_pu_bacteria 2932809354 2932810859 286
143 iso_pu_bacteria 2932818245 2932823810 286
144 iso_pu_bacteria 2932828146 2932830069 286
145 iso_pu_bacteria 2935616580 2935622704 286
146 iso_pu_bacteria 2935638405 2935642496 286
147 iso_pu_bacteria 2935665750 2935668200 286
148 iso_pu_bacteria 2935675223 2935676233 286
149 iso_pu_bacteria 2935703347 2935706060 286
150 iso_pu_bacteria 2935760218 2935766556 286
151 iso_pu_bacteria 2935801545 2935803059 286
152 iso_pu_bacteria 2935810662 2935814376 286
153 iso_pu_bacteria 2935827899 2935831513 286
154 iso_pu_bacteria 2935855204 2935860953 286
155 iso_pu_bacteria 2935864058 2935869710 286
156 iso_pu_bacteria 2935873716 2935878871 286
157 iso_pu_bacteria 2935992306 2935994732 286
158 iso_pu_bacteria 2936002035 2936003375 286
159 iso_pu_bacteria 2936037263 2936039932 286
160 iso_pu_bacteria 8016511872 8016522246 286
161 iso_pu_bacteria 8017057580 8017063309 286
162 iso_pu_bacteria 8019586578 8019590530 286
163 iso_pu_bacteria 8019597564 8019600821 286
164 iso_pu_bacteria 8019608314 8019617735 286
165 3300047320 Ga0495672_0001648 Ga0495672_0001648_14134_15078 287
166 iso_pu_bacteria 2507262055 2507508519 287
167 iso_pu_bacteria 2508501042 2508691648 287
168 iso_pu_bacteria 2513237092 2513627963 287
169 iso_pu_bacteria 2513237095 2513645766 287
170 iso_pu_bacteria 2513237096 2513654792 287
171 iso_pu_bacteria 2513237161 2514013599 287
172 iso_pu_bacteria 2515154112 2515629826 287
173 iso_pu_bacteria 2517572143 2517892325 287
174 iso_pu_bacteria 2519899620 2520375189 287
175 iso_pu_bacteria 2528768022 2528850000 287
176 iso_pu_bacteria 2615840624 2616296074 287
177 iso_pu_bacteria 2617270735 2617347444 287
178 iso_pu_bacteria 2617270741 2617375694 287
179 iso_pu_bacteria 2816332527 2818238816 287
180 iso_pu_bacteria 2824600985 2824608043 287
181 iso_pu_bacteria 2824609381 2824616602 287
182 iso_pu_bacteria 2824653114 2824658691 287
183 iso_pu_bacteria 2824671348 2824674796 287
184 iso_pu_bacteria 2824679649 2824686357 287
185 iso_pu_bacteria 2824687955 2824691214 287
186 iso_pu_bacteria 2824704595 2824708963 287
187 iso_pu_bacteria 2824732956 2824736690 287
188 iso_pu_bacteria 2824746037 2824750161 287
189 iso_pu_bacteria 2824753945 2824759493 287
190 iso_pu_bacteria 2824763712 2824769875 287
191 iso_pu_bacteria 2824773399 2824779433 287
192 iso_pu_bacteria 2834641062 2834642491 287
193 iso_pu_bacteria 2838022645 2838022990 287
194 iso_pu_bacteria 2838074704 2838077079 287
195 iso_pu_bacteria 2841941048 2841946687 287
196 iso_pu_bacteria 2841966195 2841971726 287
197 iso_pu_bacteria 2841983080 2841983507 287
198 iso_pu_bacteria 2842198810 2842199419 287
199 iso_pu_bacteria 2842324504 2842327087 287
200 iso_pu_bacteria 2842348783 2842350692 287
201 iso_pu_bacteria 2842454564 2842456568 287
202 iso_pu_bacteria 2850079185 2850085410 287
203 iso_pu_bacteria 2874590934 2874598124 287
204 iso_pu_bacteria 2874645413 2874645831 287
205 iso_pu_bacteria 2876761206 2876764591 287
206 iso_pu_bacteria 2876771140 2876778398 287
207 iso_pu_bacteria 2876818435 2876825733 287
208 iso_pu_bacteria 2879074833 2879082192 287
209 iso_pu_bacteria 2879127579 2879135339 287
210 iso_pu_bacteria 2879142872 2879150548 287
211 iso_pu_bacteria 2881364244 2881368767 287
212 iso_pu_bacteria 2881665667 2881671231 287
213 iso_pu_bacteria 2885366525 2885373227 287
214 iso_pu_bacteria 2888378607 2888384139 287
215 iso_pu_bacteria 2888419890 2888424605 287
216 iso_pu_bacteria 2896384573 2896385893 287
217 iso_pu_bacteria 2904711408 2904714729 287
218 iso_pu_bacteria 2906635258 2906638859 287
219 iso_pu_bacteria 2906660503 2906666302 287
220 iso_pu_bacteria 2908775508 2908780255 287
221 iso_pu_bacteria 2909042592 2909045010 287
222 iso_pu_bacteria 2919100787 2919103983 287
223 iso_pu_bacteria 2920760137 2920761817 287
224 iso_pu_bacteria 2922368715 2922374478 287
225 iso_pu_bacteria 2922393267 2922400720 287
226 iso_pu_bacteria 2929615660 2929618143 287
227 iso_pu_bacteria 2929624759 2929632331 287
228 iso_pu_bacteria 2935648319 2935653344 287
229 iso_pu_bacteria 2935656913 2935660185 287
230 iso_pu_bacteria 2935684952 2935686308 287
231 iso_pu_bacteria 2935694250 2935701156 287
232 iso_pu_bacteria 2935713505 2935722357 287
233 iso_pu_bacteria 2935722832 2935731614 287
234 iso_pu_bacteria 2935732158 2935732252 287
235 iso_pu_bacteria 2935741537 2935741631 287
236 iso_pu_bacteria 2935750917 2935752273 287
237 iso_pu_bacteria 2935837841 2935838374 287
238 iso_pu_bacteria 2935975950 2935983815 287
239 iso_pu_bacteria 2935984226 2935991195 287
240 iso_pu_bacteria 2936011229 2936016214 287
241 iso_pu_bacteria 2936019824 2936024847 287
242 iso_pu_bacteria 2936028420 2936032095 287
243 iso_pu_bacteria 2936046547 2936049956 287
244 iso_pu_bacteria 2936055302 2936060908 287
245 iso_pu_bacteria 2940556831 2940556925 287
246 iso_pu_bacteria 2941531003 2941532896 287
247 iso_pu_bacteria 2941538514 2941538958 287
248 iso_pu_bacteria 2977971508 2977979816 287
249 iso_pu_bacteria 3002141150 3002142864 287
250 iso_pu_bacteria 8003400568 8003403890 287
251 iso_pu_bacteria 8011350971 8011353969 287
252 iso_pu_bacteria 8018127388 8018131473 287
253 iso_pu_bacteria 8019629233 8019634376 287
254 iso_pu_bacteria 8019638758 8019645355 287
255 iso_pu_bacteria 8019659431 8019662256 287
256 iso_pu_bacteria 8019668869 8019671763 287
257 iso_pu_bacteria 8019678201 8019684330 287
258 iso_pu_bacteria 8055742211 8055746268 287
259 iso_pu_bacteria 2503198000 2503203944 288
260 iso_pu_bacteria 2508501123 2509117204 288
261 iso_pu_bacteria 2512875016 2512929249 288
262 iso_pu_bacteria 2512875024 2512964054 288
263 iso_pu_bacteria 2513237090 2513607928 288
264 iso_pu_bacteria 2513237094 2513644670 288
265 iso_pu_bacteria 2643221595 2643986342 288
266 iso_pu_bacteria 2643221627 2644152574 288
267 iso_pu_bacteria 2643221736 2644743283 288
268 iso_pu_bacteria 2841760612 2841761157 288
269 iso_pu_bacteria 2844104063 2844104182 288
270 iso_pu_bacteria 2851246043 2851247170 288
271 iso_pu_bacteria 2856320880 2856326325 288
272 iso_pu_bacteria 2857367948 2857370612 288
273 iso_pu_bacteria 2869234852 2869235698 288
274 iso_pu_bacteria 2869242130 2869247007 288
275 iso_pu_bacteria 2869249662 2869251242 288
276 iso_pu_bacteria 2869256925 2869259517 288
277 iso_pu_bacteria 2869264136 2869264824 288
278 iso_pu_bacteria 2869271264 2869273627 288
279 iso_pu_bacteria 2869278585 2869284051 288
280 iso_pu_bacteria 2871435913 2871443077 288
281 iso_pu_bacteria 2871451962 2871458443 288
282 iso_pu_bacteria 2871459585 2871464401 288
283 iso_pu_bacteria 2871481445 2871487222 288
284 iso_pu_bacteria 2871495908 2871497073 288
285 iso_pu_bacteria 2874109183 2874115894 288
286 iso_pu_bacteria 2874116593 2874123659 288
287 iso_pu_bacteria 2874123672 2874126454 288
288 iso_pu_bacteria 2874131515 2874135364 288
289 iso_pu_bacteria 2874139085 2874144670 288
290 iso_pu_bacteria 2874162495 2874164275 288
291 iso_pu_bacteria 2874168670 2874173944 288
292 iso_pu_bacteria 2876363079 2876367195 288
293 iso_pu_bacteria 2876386047 2876391227 288
294 iso_pu_bacteria 2876392853 2876393538 288
295 iso_pu_bacteria 2876399893 2876401846 288
296 iso_pu_bacteria 2876406927 2876407776 288
297 iso_pu_bacteria 2876420981 2876427886 288
298 iso_pu_bacteria 2878738818 2878743955 288
299 iso_pu_bacteria 2878760144 2878761189 288
300 iso_pu_bacteria 2878767105 2878768260 288
301 iso_pu_bacteria 2878774303 2878778099 288
302 iso_pu_bacteria 2878781027 2878786515 288
303 iso_pu_bacteria 2881147464 2881154212 288
304 iso_pu_bacteria 2881161766 2881163280 288
305 iso_pu_bacteria 2885305155 2885312257 288
306 iso_pu_bacteria 2885326080 2885333982 288
307 iso_pu_bacteria 2885334103 2885341631 288
308 iso_pu_bacteria 2885374607 2885379487 288
309 iso_pu_bacteria 2888337043 2888342104 288
310 iso_pu_bacteria 2888350351 2888351224 288
311 iso_pu_bacteria 2903448605 2903453337 288
312 iso_pu_bacteria 2903513507 2903514657 288
313 iso_pu_bacteria 2903540706 2903541868 288
314 iso_pu_bacteria 2904659560 2904660046 288
315 iso_pu_bacteria 2906354277 2906362252 288
316 iso_pu_bacteria 2906363423 2906364854 288
317 iso_pu_bacteria 2906370794 2906377587 288
318 iso_pu_bacteria 2906393657 2906401318 288
319 iso_pu_bacteria 2906401398 2906403742 288
320 iso_pu_bacteria 2906408224 2906412871 288
321 iso_pu_bacteria 2906626472 2906633344 288
322 iso_pu_bacteria 2922130491 2922138129 288
323 iso_pu_bacteria 2922151315 2922153168 288
324 iso_pu_bacteria 2922172374 2922175506 288
325 iso_pu_bacteria 2924710171 2924718180 288
326 iso_pu_bacteria 2924733363 2924738855 288
327 iso_pu_bacteria 2924748358 2924752434 288
328 iso_pu_bacteria 2924776078 2924781872 288
329 iso_pu_bacteria 2937813078 2937813755 288
330 iso_pu_bacteria 2937848649 2937850278 288
331 iso_pu_bacteria 2937868953 2937871507 288
332 iso_pu_bacteria 2937877337 2937884799 288
333 iso_pu_bacteria 2937972304 2937978072 288
334 iso_pu_bacteria 2937980651 2937983721 288
335 iso_pu_bacteria 2937994558 2937995617 288
336 iso_pu_bacteria 2958034702 2958040440 288
337 iso_pu_bacteria 2958041894 2958055288 288
338 iso_pu_bacteria 2958041894 2958057811 288
339 iso_pu_bacteria 2958084443 2958092108 288
340 iso_pu_bacteria 2958092219 2958099937 288
341 iso_pu_bacteria 2958100919 2958103037 288
342 iso_pu_bacteria 2958108152 2958114670 288
343 iso_pu_bacteria 2958122699 2958128606 288
344 iso_pu_bacteria 2958130278 2958131442 288
345 iso_pu_bacteria 2958137437 2958141256 288
346 iso_pu_bacteria 2958144490 2958146162 288
347 iso_pu_bacteria 2958165035 2958166197 288
348 iso_pu_bacteria 2958172287 2958176872 288
349 iso_pu_bacteria 2958179912 2958181267 288
350 iso_pu_bacteria 2961077736 2961079105 288
351 iso_pu_bacteria 2961114664 2961115371 288
352 iso_pu_bacteria 2961136820 2961138079 288
353 iso_pu_bacteria 2961163497 2961164659 288
354 iso_pu_bacteria 2961183825 2961185147 288
355 iso_pu_bacteria 2963644680 2963649988 288
356 iso_pu_bacteria 2965018300 2965019003 288
357 iso_pu_bacteria 2965025482 2965027445 288
358 iso_pu_bacteria 2965040258 2965045344 288
359 iso_pu_bacteria 2965047637 2965048299 288
360 iso_pu_bacteria 2965089291 2965091092 288
361 iso_pu_bacteria 2965102966 2965104106 288
362 iso_pu_bacteria 2965110997 2965113135 288
363 iso_pu_bacteria 2965119406 2965123998 288
364 iso_pu_bacteria 2968016561 2968021934 288
365 iso_pu_bacteria 2968083720 2968086701 288
366 iso_pu_bacteria 2968110612 2968111102 288
367 iso_pu_bacteria 2968138860 2968146795 288
368 iso_pu_bacteria 2968171901 2968172955 288
369 iso_pu_bacteria 2970469710 2970474524 288
370 iso_pu_bacteria 2970489779 2970491832 288
371 iso_pu_bacteria 2970510686 2970516146 288
372 iso_pu_bacteria 2970547951 2970549700 288
373 iso_pu_bacteria 2970554993 2970556048 288
374 iso_pu_bacteria 2970593180 2970598663 288
375 iso_pu_bacteria 2970619444 2970622477 288
376 iso_pu_bacteria 2970627176 2970627978 288
377 iso_pu_bacteria 2977843712 2977843853 288
378 iso_pu_bacteria 2977851361 2977855642 288
379 iso_pu_bacteria 2977864932 2977867726 288
380 iso_pu_bacteria 2977872689 2977877885 288
381 iso_pu_bacteria 2977907340 2977907656 288
382 iso_pu_bacteria 2977915119 2977921356 288
383 iso_pu_bacteria 2977922695 2977928025 288
384 iso_pu_bacteria 2977935797 2977937413 288
385 iso_pu_bacteria 2977942078 2977946391 288
386 iso_pu_bacteria 2977950692 2977951259 288
387 iso_pu_bacteria 2977957713 2977958945 288
388 iso_pu_bacteria 2977971508 2977979059 288
389 iso_pu_bacteria 2979710463 2979717640 288
390 iso_pu_bacteria 2979742915 2979743697 288
391 iso_pu_bacteria 2979764755 2979770169 288
392 iso_pu_bacteria 2979772303 2979775406 288
393 iso_pu_bacteria 2979793036 2979797670 288
394 iso_pu_bacteria 2987636660 2987643213 288
395 iso_pu_bacteria 2987645492 2987649664 288
396 iso_pu_bacteria 2987652177 2987654228 288
397 iso_pu_bacteria 2987659509 2987660562 288
398 iso_pu_bacteria 2996348954 2996353933 288
399 iso_pu_bacteria 2996386984 2996391223 288
400 iso_pu_bacteria 3000135777 3000141054 288
401 iso_pu_bacteria 3004167301 3004171545 288
402 iso_pu_bacteria 3004188549 3004189610 288
403 iso_pu_bacteria 3004195979 3004198563 288
404 iso_pu_bacteria 3004203850 3004206761 288
405 iso_pu_bacteria 3004211236 3004213582 288
406 iso_pu_bacteria 3004218560 3004223173 288
407 iso_pu_bacteria 3004232784 3004239138 288
408 iso_pu_bacteria 3004239961 3004246908 288
409 iso_pu_bacteria 3004268573 3004270239 288
410 iso_pu_bacteria 3004275668 3004280601 288
411 iso_pu_bacteria 3004289098 3004295040 288
412 iso_pu_bacteria 3004334049 3004338751 288
413 iso_pu_bacteria 637000159 637079006 288
414 iso_pu_bacteria 649633066 649875116 288
415 iso_pu_bacteria 8004300914 8004306989 288
416 iso_pu_bacteria 8004312739 8004315567 288
417 iso_pu_bacteria 8004361976 8004365301 288
418 iso_pu_bacteria 8004387939 8004389010 288
419 iso_pu_bacteria 8004695233 8004696267 288
420 iso_pu_bacteria 8004714634 8004715654 288
421 iso_pu_bacteria 8004727605 8004733037 288
422 iso_pu_bacteria 8019565922 8019568639 288
423 iso_pu_bacteria 8057529695 8057530631 288
424 3300009545 Ga0105237_10284192 Ga0105237_102841922 289
425 3300013102 Ga0157371_10000008 Ga0157371_10000008324 289
426 3300038443 Ga0395901_0434526 Ga0395901_0434526_18_887 289
427 3300003771 Ga0055526_1000420 Ga0055526_100042029 290
428 3300014325 Ga0163163_10156797 Ga0163163_101567972 290
429 3300025295 Ga0209564_1000166 Ga0209564_100016636 290
430 3300026067 Ga0207678_10081088 Ga0207678_100810882 290
431 3300031548 Ga0307408_100252656 Ga0307408_1002526562 290
432 3300046507 Ga0495606_0068202 Ga0495606_0068202_111_1007 290
433 3300046515 Ga0495620_0042915 Ga0495620_0042915_276_1172 290
434 3300046557 Ga0495622_0076067 Ga0495622_0076067_368_1264 290
435 3300046660 Ga0495625_0162677 Ga0495625_0162677_235_1131 290
436 3300046694 Ga0495649_0103508 Ga0495649_0103508_241_1137 290
437 3300048904 Ga0496101_0295266 Ga0496101_0295266_308_1204 290
438 3300048910 Ga0496107_0133542 Ga0496107_0133542_53_949 290
439 3300048918 Ga0496115_0374132 Ga0496115_0374132_208_1104 290
440 3300048924 Ga0496121_0102775 Ga0496121_0102775_83_1030 290
441 3300048929 Ga0496126_0186406 Ga0496126_0186406_397_1293 290
442 3300053083 Ga0495655_0017738 Ga0495655_0017738_395_1291 290
443 3300002987 JGI25159J45721_1000930 JGI25159J45721_10009308 291
444 3300003214 JGI25165J46597_1010908 JGI25165J46597_10109082 291
445 3300003215 JGI25153J46596_10002456 JGI25153J46596_100024569 291
446 3300003354 JGI25160J50197_1001127 JGI25160J50197_10011277 291
447 3300003771 Ga0055526_1000549 Ga0055526_100054912 291
448 3300003775 Ga0055524_1018769 Ga0055524_10187692 291
449 3300005327 Ga0070658_10207794 Ga0070658_102077942 291
450 3300005337 Ga0070682_100092577 Ga0070682_1000925772 291
451 3300005339 Ga0070660_100059089 Ga0070660_1000590892 291
452 3300005339 Ga0070660_100259017 Ga0070660_1002590172 291
453 3300005347 Ga0070668_100190756 Ga0070668_1001907562 291
454 3300005355 Ga0070671_100044376 Ga0070671_1000443762 291
455 3300005366 Ga0070659_100065010 Ga0070659_1000650104 291
456 3300005366 Ga0070659_100356690 Ga0070659_1003566901 291
457 3300005366 Ga0070659_100511199 Ga0070659_1005111991 291
458 3300005367 Ga0070667_100094016 Ga0070667_1000940162 291
459 3300005455 Ga0070663_100053132 Ga0070663_1000531321 291
460 3300005455 Ga0070663_100089484 Ga0070663_1000894842 291
461 3300005455 Ga0070663_100212118 Ga0070663_1002121181 291
462 3300005457 Ga0070662_100085325 Ga0070662_1000853252 291
463 3300005459 Ga0068867_100075108 Ga0068867_1000751083 291
464 3300005548 Ga0070665_100257106 Ga0070665_1002571063 291
465 3300005614 Ga0068856_100501499 Ga0068856_1005014991 291
466 3300005616 Ga0068852_100043141 Ga0068852_1000431414 291
467 3300005618 Ga0068864_100122837 Ga0068864_1001228373 291
468 3300006038 Ga0075365_10252405 Ga0075365_102524051 291
469 3300006051 Ga0075364_10084970 Ga0075364_100849702 291
470 3300006195 Ga0075366_10035418 Ga0075366_100354183 291
471 3300006941 Ga0099825_1039343 Ga0099825_10393432 291
472 3300006942 Ga0099824_1012241 Ga0099824_10122413 291
473 3300006942 Ga0099824_1022377 Ga0099824_10223772 291
474 3300006943 Ga0099822_1017281 Ga0099822_10172815 291
475 3300009148 Ga0105243_10050150 Ga0105243_100501503 291
476 3300009177 Ga0105248_10035824 Ga0105248_100358245 291
477 3300009545 Ga0105237_10060297 Ga0105237_100602973 291
478 3300009545 Ga0105237_10092609 Ga0105237_100926093 291
479 3300009551 Ga0105238_10171425 Ga0105238_101714252 291
480 3300009553 Ga0105249_10079100 Ga0105249_100791002 291
481 3300010375 Ga0105239_10215118 Ga0105239_102151182 291
482 3300013105 Ga0157369_10169086 Ga0157369_101690863 291
483 3300013250 Ga0171462_1008 Ga0171462_1008199 291
484 3300014325 Ga0163163_10009184 Ga0163163_1000918410 291
485 3300014745 Ga0157377_10194753 Ga0157377_101947532 291
486 3300021320 Ga0214544_1000002 Ga0214544_1000002359 291
487 3300021321 Ga0214542_1000001 Ga0214542_1000001709 291
488 3300021324 Ga0214545_1000001 Ga0214545_1000001775 291
489 3300021327 Ga0214543_1000001 Ga0214543_1000001420 291
490 3300025261 Ga0209233_1001070 Ga0209233_10010709 291
491 3300025261 Ga0209233_1004320 Ga0209233_10043203 291
492 3300025284 Ga0209130_1000279 Ga0209130_100027926 291
493 3300025295 Ga0209564_1000031 Ga0209564_1000031352 291
494 3300025297 Ga0209758_1000160 Ga0209758_1000160112 291
495 3300025297 Ga0209758_1004797 Ga0209758_100479710 291
496 3300025297 Ga0209758_1046870 Ga0209758_10468702 291
497 3300025297 Ga0209758_1055474 Ga0209758_10554742 291
498 3300025299 Ga0209256_1001361 Ga0209256_10013612 291
499 3300025302 Ga0207426_1000705 Ga0207426_100070523 291
500 3300025302 Ga0207426_1045680 Ga0207426_10456802 291
501 3300025303 Ga0209051_1063848 Ga0209051_10638481 291
502 3300025304 Ga0209257_1000239 Ga0209257_100023995 291
503 3300025304 Ga0209257_1014795 Ga0209257_10147953 291
504 3300025904 Ga0207647_10008593 Ga0207647_100085935 291
505 3300025909 Ga0207705_10162241 Ga0207705_101622412 291
506 3300025914 Ga0207671_10015652 Ga0207671_100156523 291
507 3300025914 Ga0207671_10069366 Ga0207671_100693662 291
508 3300025919 Ga0207657_10062614 Ga0207657_100626142 291
509 3300025924 Ga0207694_10256339 Ga0207694_102563392 291
510 3300025931 Ga0207644_10050149 Ga0207644_100501493 291
511 3300025933 Ga0207706_10087457 Ga0207706_100874572 291
512 3300025935 Ga0207709_10084172 Ga0207709_100841721 291
513 3300025972 Ga0207668_10097977 Ga0207668_100979773 291
514 3300025986 Ga0207658_10210469 Ga0207658_102104692 291
515 3300026067 Ga0207678_10027446 Ga0207678_100274463 291
516 3300026067 Ga0207678_10313739 Ga0207678_103137392 291
517 3300026078 Ga0207702_10519127 Ga0207702_105191272 291
518 3300026095 Ga0207676_10248414 Ga0207676_102484141 291
519 3300026116 Ga0207674_10085683 Ga0207674_100856832 291
520 3300027296 Ga0209389_1000081 Ga0209389_100008117 291
521 3300027357 Ga0209589_1000001 Ga0209589_10000015 291
522 3300027357 Ga0209589_1000091 Ga0209589_100009117 291
523 3300027361 Ga0209489_100001 Ga0209489_1000015 291
524 3300027361 Ga0209489_100096 Ga0209489_10009649 291
525 3300027363 Ga0209700_100001 Ga0209700_1000015 291
526 3300028379 Ga0268266_10101737 Ga0268266_101017373 291
527 3300028380 Ga0268265_10013853 Ga0268265_100138536 291
528 3300031456 Ga0307513_10153601 Ga0307513_101536012 291
529 3300031548 Ga0307408_100008605 Ga0307408_1000086055 291
530 3300032002 Ga0307416_100074581 Ga0307416_1000745812 291
531 3300037312 Ga0395899_0001863 Ga0395899_0001863_6525_7424 291
532 3300037312 Ga0395899_0049669 Ga0395899_0049669_1948_2847 291
533 3300037418 Ga0395900_0005273 Ga0395900_0005273_2228_3127 291
534 3300037418 Ga0395900_0007017 Ga0395900_0007017_10050_10949 291
535 3300037466 Ga0395898_0004346 Ga0395898_0004346_5647_6546 291
536 3300037466 Ga0395898_0005843 Ga0395898_0005843_11830_12729 291
537 3300037471 Ga0395905_0052441 Ga0395905_0052441_653_1552 291
538 3300037471 Ga0395905_0115693 Ga0395905_0115693_638_1537 291
539 3300038443 Ga0395901_0000715 Ga0395901_0000715_10029_10928 291
540 3300038443 Ga0395901_0188522 Ga0395901_0188522_327_1226 291
541 3300041404 Ga0439436_0000790 Ga0439436_0000790_407_1306 291
542 3300041406 Ga0439439_0040880 Ga0439439_0040880_212_1123 291
543 3300041413 Ga0439465_0000496 Ga0439465_0000496_10805_11704 291
544 3300041413 Ga0439465_0051984 Ga0439465_0051984_182_1081 291
545 3300041997 Ga0439431_0000492 Ga0439431_0000492_513_1412 291
546 3300041999 Ga0439433_0000544 Ga0439433_0000544_491_1390 291
547 3300042002 Ga0439442_002780 Ga0439442_002780_1970_2869 291
548 3300042004 Ga0439445_0008847 Ga0439445_0008847_560_1459 291
549 3300042006 Ga0439432_000899 Ga0439432_000899_2424_3323 291
550 3300042007 Ga0439449_0001320 Ga0439449_0001320_8717_9616 291
551 3300042007 Ga0439449_0030486 Ga0439449_0030486_20_919 291
552 3300042010 Ga0439452_004610 Ga0439452_004610_1575_2474 291
553 3300042014 Ga0439457_006915 Ga0439457_006915_116_1015 291
554 3300042156 Ga0439446_0053956 Ga0439446_0053956_271_1170 291
555 3300042185 Ga0450909_014317 Ga0450909_014317_132_1031 291
556 3300042435 Ga0439434_0004219 Ga0439434_0004219_1537_2436 291
557 3300044658 Ga0466972_0000276 Ga0466972_0000276_26545_27444 291
558 3300044693 Ga0466961_0186844 Ga0466961_0186844_269_1168 291
559 3300044842 Ga0466957_0000335 Ga0466957_0000335_1945_2844 291
560 3300045049 Ga0466959_0011613 Ga0466959_0011613_708_1607 291
561 3300045049 Ga0466959_0319083 Ga0466959_0319083_140_1039 291
562 3300045976 Ga0466967_0041480 Ga0466967_0041480_1326_2225 291
563 3300046507 Ga0495606_0088600 Ga0495606_0088600_612_1511 291
564 3300046507 Ga0495606_0148718 Ga0495606_0148718_127_1026 291
565 3300046512 Ga0495610_0058975 Ga0495610_0058975_438_1337 291
566 3300046513 Ga0495616_0081134 Ga0495616_0081134_317_1216 291
567 3300046516 Ga0495628_0177893 Ga0495628_0177893_551_1450 291
568 3300046522 Ga0495643_0013748 Ga0495643_0013748_1328_2227 291
569 3300046616 Ga0495668_0032305 Ga0495668_0032305_652_1551 291
570 3300046660 Ga0495625_0063923 Ga0495625_0063923_219_1223 291
571 3300047443 Ga0495687_014462 Ga0495687_014462_527_1426 291
572 3300047472 Ga0495686_0069999 Ga0495686_0069999_753_1652 291
573 3300047472 Ga0495686_0166102 Ga0495686_0166102_202_1101 291
574 3300048905 Ga0496102_0201627 Ga0496102_0201627_13_912 291
575 3300048906 Ga0496103_0040858 Ga0496103_0040858_703_1602 291
576 3300048906 Ga0496103_0063652 Ga0496103_0063652_1257_2156 291
577 3300048907 Ga0496104_0089345 Ga0496104_0089345_1450_2349 291
578 3300048909 Ga0496106_0010509 Ga0496106_0010509_4489_5388 291
579 3300048911 Ga0496108_0024440 Ga0496108_0024440_649_1548 291
580 3300048912 Ga0496109_0233850 Ga0496109_0233850_492_1391 291
581 3300048913 Ga0496110_0051267 Ga0496110_0051267_2076_2975 291
582 3300048914 Ga0496111_0052530 Ga0496111_0052530_1295_2194 291
583 3300048915 Ga0496112_0027666 Ga0496112_0027666_2364_3263 291
584 3300048919 Ga0496116_0031044 Ga0496116_0031044_353_1252 291
585 3300048919 Ga0496116_0057588 Ga0496116_0057588_231_1130 291
586 3300048920 Ga0496117_0057750 Ga0496117_0057750_1357_2256 291
587 3300048921 Ga0496118_0030764 Ga0496118_0030764_2853_3752 291
588 3300048922 Ga0496119_0063593 Ga0496119_0063593_624_1523 291
589 3300048924 Ga0496121_0090241 Ga0496121_0090241_1222_2121 291
590 3300048924 Ga0496121_0144883 Ga0496121_0144883_41_943 291
591 3300049571 Ga0501034_0273800 Ga0501034_0273800_436_1335 291
592 3300049583 Ga0501067_0082981 Ga0501067_0082981_200_1099 291
593 3300049585 Ga0501069_0042973 Ga0501069_0042973_399_1298 291
594 3300050491 nmdc:mga00v17_84908_c1 nmdc:mga00v17_84908_c1_715_1614 291
595 3300050492 nmdc:mga0yw44_274082_c1 nmdc:mga0yw44_274082_c1_51_950 291
596 3300050493 nmdc:mga0k408_31429_c2 nmdc:mga0k408_31429_c2_1695_2594 291
597 3300050494 nmdc:mga06z11_39431_c1 nmdc:mga06z11_39431_c1_587_1486 291
598 3300050516 nmdc:mga0sz30_4624_c1 nmdc:mga0sz30_4624_c1_1069_1968 291
599 3300053086 Ga0500578_0116963 Ga0500578_0116963_28_927 291
600 3300053086 Ga0500578_0128117 Ga0500578_0128117_105_1004 291
601 3300053103 Ga0500555_002838 Ga0500555_002838_467_1366 291
602 3300053119 Ga0500595_003494 Ga0500595_003494_5864_6763 291
603 3300053119 Ga0500595_017867 Ga0500595_017867_652_1551 291
604 3300053134 Ga0500658_0013921 Ga0500658_0013921_713_1612 291
605 3300053139 Ga0500568_0005153 Ga0500568_0005153_4148_5047 291
606 3300053146 Ga0500588_0000957 Ga0500588_0000957_628_1527 291
607 3300053153 Ga0500616_0002115 Ga0500616_0002115_12563_13462 291
608 3300053160 Ga0500633_0010581 Ga0500633_0010581_1373_2272 291
609 3300061719 Ga0466962_0048860 Ga0466962_0048860_334_1233 291
610 iso_pu_bacteria 2933577622 2933580071 291
611 iso_pu_bacteria 2935630451 2935631599 291
612 iso_pu_bacteria 2941507105 2941511393 291
613 iso_pu_bacteria 2941515067 2941519094 291
614 iso_pu_bacteria 2941523033 2941526326 291
615 3300002741 JGI25157J39369_1000175 JGI25157J39369_100017510 292
616 3300003316 rootH1_10104155 rootH1_101041552 292
617 3300003763 Ga0055529_1004473 Ga0055529_10044732 292
618 3300005455 Ga0070663_100510366 Ga0070663_1005103661 292
619 3300005548 Ga0070665_100131391 Ga0070665_1001313913 292
620 3300005548 Ga0070665_100381009 Ga0070665_1003810091 292
621 3300005563 Ga0068855_100454142 Ga0068855_1004541421 292
622 3300006038 Ga0075365_10038993 Ga0075365_100389932 292
623 3300006048 Ga0075363_100004571 Ga0075363_1000045716 292
624 3300006051 Ga0075364_10011401 Ga0075364_100114014 292
625 3300006353 Ga0075370_10034992 Ga0075370_100349922 292
626 3300009174 Ga0105241_10207746 Ga0105241_102077462 292
627 3300009545 Ga0105237_10458138 Ga0105237_104581382 292
628 3300009551 Ga0105238_10348079 Ga0105238_103480791 292
629 3300009551 Ga0105238_10348937 Ga0105238_103489371 292
630 3300014497 Ga0182008_10024751 Ga0182008_100247512 292
631 3300015262 Ga0182007_10008211 Ga0182007_100082112 292
632 3300025250 Ga0209026_1000005 Ga0209026_1000005524 292
633 3300025254 Ga0209148_1000057 Ga0209148_100005714 292
634 3300025256 Ga0209759_1000111 Ga0209759_1000111109 292
635 3300025261 Ga0209233_1007596 Ga0209233_10075962 292
636 3300025272 Ga0209455_1000131 Ga0209455_100013132 292
637 3300025913 Ga0207695_10566941 Ga0207695_105669411 292
638 3300025914 Ga0207671_10117108 Ga0207671_101171082 292
639 3300025919 Ga0207657_10059128 Ga0207657_100591281 292
640 3300025924 Ga0207694_10189141 Ga0207694_101891412 292
641 3300025949 Ga0207667_10325644 Ga0207667_103256441 292
642 3300026067 Ga0207678_10104411 Ga0207678_101044112 292
643 3300026116 Ga0207674_10095178 Ga0207674_100951786 292
644 3300026142 Ga0207698_10010109 Ga0207698_100101092 292
645 3300028379 Ga0268266_10107504 Ga0268266_101075041 292
646 3300037471 Ga0395905_0089138 Ga0395905_0089138_1647_2585 292
647 3300038443 Ga0395901_0242355 Ga0395901_0242355_317_1219 292
648 3300044658 Ga0466972_0030288 Ga0466972_0030288_877_1821 292
649 3300048908 Ga0496105_0217534 Ga0496105_0217534_287_1189 292
650 3300050492 nmdc:mga0yw44_127436_c1 nmdc:mga0yw44_127436_c1_401_1303 292
651 3300050496 nmdc:mga07m45_39802_c1 nmdc:mga07m45_39802_c1_1238_2140 292
652 3300003771 Ga0055526_1000368 Ga0055526_100036832 293
653 3300003773 Ga0055537_1000159 Ga0055537_100015913 293
654 3300003784 Ga0055534_1000451 Ga0055534_10004515 293
655 3300003790 Ga0055528_1000147 Ga0055528_100014741 293
656 3300025263 Ga0209565_1000003 Ga0209565_1000003409 293
657 3300025273 Ga0209673_1000003 Ga0209673_1000003295 293
658 3300025291 Ga0209675_1000003 Ga0209675_1000003629 293
659 3300025295 Ga0209564_1000012 Ga0209564_1000012437 293
660 3300025299 Ga0209256_1000431 Ga0209256_100043110 293
661 3300002737 JGI25162J39368_1000092 JGI25162J39368_100009241 295
662 3300003316 rootH1_10065860 rootH1_100658602 295
663 3300003323 rootH1_10138269 rootH1_101382692 295
664 3300003323 rootH1_10279230 rootH1_102792302 295
665 3300005577 Ga0068857_100030382 Ga0068857_1000303824 295
666 3300005616 Ga0068852_100003454 Ga0068852_1000034544 295
667 3300005834 Ga0068851_10155879 Ga0068851_101558792 295
668 3300009036 Ga0105244_10003099 Ga0105244_100030999 295
669 3300010375 Ga0105239_10469998 Ga0105239_104699982 295
670 3300013307 Ga0157372_10082125 Ga0157372_100821252 295
671 3300014497 Ga0182008_10000284 Ga0182008_1000028423 295
672 3300025914 Ga0207671_10088052 Ga0207671_100880522 295
673 3300026078 Ga0207702_10019913 Ga0207702_100199132 295
674 3300026116 Ga0207674_10039940 Ga0207674_100399404 295
675 3300026142 Ga0207698_10002176 Ga0207698_100021764 295
676 3300037312 Ga0395899_0162205 Ga0395899_0162205_321_1208 295
677 3300037471 Ga0395905_0028459 Ga0395905_0028459_4196_5083 295
678 3300037471 Ga0395905_0056729 Ga0395905_0056729_822_1709 295
679 3300038443 Ga0395901_0043019 Ga0395901_0043019_195_1082 295
680 3300044684 Ga0466966_0073389 Ga0466966_0073389_795_1682 295
681 3300044693 Ga0466961_0009262 Ga0466961_0009262_2900_3787 295
682 3300045836 Ga0466958_0043848 Ga0466958_0043848_1413_2300 295
683 3300046474 Ga0495605_0114086 Ga0495605_0114086_93_1004 295
684 3300046501 Ga0495607_0000091 Ga0495607_0000091_68446_69357 295
685 3300046515 Ga0495620_0000585 Ga0495620_0000585_6613_7521 295
686 3300048920 Ga0496117_0034851 Ga0496117_0034851_503_1390 295
687 3300061719 Ga0466962_0051794 Ga0466962_0051794_430_1317 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

39

98

0.97

PF03466

LysR_substrate

LysR substrate binding domain

122

330

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9611 1 83
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9587 1 83
5xxp-assembly1.cif.gz_B crystal structure of cbnr_dbd-dna complex 0.9525 1 83
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9481 1 86
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9469 1 83
ID Description Score Start End Superfamily
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.986 4 80 1.10.10.10
af_P37641_3_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9835 4 82 1.10.10.10
af_P0ACR7_1_84_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9807 5 79 1.10.10.10
af_P77700_7_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9792 5 87 1.10.10.10
af_Q57748_4_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9757 4 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A242M2C6-F1-model_v4 Putative transcription regulator protein of MDR efflux pump cluster 0.9001 164 265 GO:0003700
GO:0006351
GO:0043565
AF-A0A0F6L9K3-F1-model_v4 deleted 0.8999 157 293
AF-A0A5F0LPX3-F1-model_v4 LysR family transcriptional regulator 0.89 162 293
AF-A0A380UKQ5-F1-model_v4 deleted 0.8867 164 292
AF-A0A3D5N4X1-F1-model_v4 LysR family transcriptional regulator 0.8836 147 294 GO:0003700
GO:0006351
GO:0043565

Feature Viewer

pLDDT pTM Quality
90.52 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map