F475289
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 687 | 394 | 622 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_37301_c1|nmdc:mga0k408_37301_c1_154_624 |
| Length | 156 |
| Sequence | MSRAKPVDRIGTGIFRTTQMSQTYTGGCACGAIRYEISGEPIFQNHCQCRDCQRKSGTGHGSYLTFARDGVKHSGQATPWAIVADSGNVKTRAFCPTCGSPVYMTFSAMPDIFTVHAASLDDPGRYRPQAVTYTVRGPEWDCLDPALPKFDKMPAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 6 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 7 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 8 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 9 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 10 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 11 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 12 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 13 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 14 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 15 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 16 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 17 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 18 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 19 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 20 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 21 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 22 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 23 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 24 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 25 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 26 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 27 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 28 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 29 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 30 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 31 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 32 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 33 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 34 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 35 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 36 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 37 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 38 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 39 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 40 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 41 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 42 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 43 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 44 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 45 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 46 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 47 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 48 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 49 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 50 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 51 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 52 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 53 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 54 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 55 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 56 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 57 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 58 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 59 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 60 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 61 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 62 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 63 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 64 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 65 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 66 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 67 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 68 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 69 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 70 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 71 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 72 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 73 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 74 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 81 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 83 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 84 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 85 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 86 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 87 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 88 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 89 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 90 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 95 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 109 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 114 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 117 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 119 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 120 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 121 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 122 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 123 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 124 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 125 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 126 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 127 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 128 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 129 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 130 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 131 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 132 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 133 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 134 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 135 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 136 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 137 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 138 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 139 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 140 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 142 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 145 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 158 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 244 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 245 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 246 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 253 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 254 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 255 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 261 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 269 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 270 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 271 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 272 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 273 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 276 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 277 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 278 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 279 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 280 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 281 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 282 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 336 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 337 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 338 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 339 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 361 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 362 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 363 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 364 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 366 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 367 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 368 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 369 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 370 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 371 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 372 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 373 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 374 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 375 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 376 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 377 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 379 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 381 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 386 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 387 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 390 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 391 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 394 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.54 |
| Metatranscriptomes | 0 |
| Isolates | 9.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 29.4 |
| Nodule | 5.24 |
| Rhizoplane | 4.37 |
| Rhizosphere | 49.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5120920 | 2162886012 | Bacteria | 1100 |
| 2 | JGI25152J39213_1000902 | 3300002773 | Bacteria | 14533 |
| 3 | JGI25150J39212_1000529 | 3300002774 | Bacteria | 15578 |
| 4 | JGI25159J45721_1000714 | 3300002987 | Bacteria | 14510 |
| 5 | JGI25159J45721_1015530 | 3300002987 | Bacteria | 1663 |
| 6 | JGI25151J46595_10001672 | 3300003187 | Bacteria | 14533 |
| 7 | JGI25153J46596_10001378 | 3300003215 | Bacteria | 14533 |
| 8 | rootH1_10084038 | 3300003316 | Bacteria | 2213 |
| 9 | JGI25160J50197_1000504 | 3300003354 | Bacteria | 23228 |
| 10 | JGI25160J50197_1001019 | 3300003354 | Bacteria | 14510 |
| 11 | JGI25160J50197_1016594 | 3300003354 | Bacteria | 2367 |
| 12 | JGI25161J50226_1001946 | 3300003374 | Bacteria | 5689 |
| 13 | JGI25161J50226_1007453 | 3300003374 | Bacteria | 1830 |
| 14 | Ga0055539_1023106 | 3300003752 | Bacteria | 732 |
| 15 | Ga0055535_1000544 | 3300003761 | Bacteria | 32432 |
| 16 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 17 | Ga0055526_1001885 | 3300003771 | Bacteria | 14533 |
| 18 | Ga0055526_1020268 | 3300003771 | Bacteria | 2375 |
| 19 | Ga0055537_1000532 | 3300003773 | Bacteria | 22142 |
| 20 | Ga0055537_1021503 | 3300003773 | Bacteria | 957 |
| 21 | Ga0055524_1001312 | 3300003775 | Bacteria | 14533 |
| 22 | Ga0055524_1003577 | 3300003775 | Bacteria | 7490 |
| 23 | Ga0055524_1008003 | 3300003775 | Bacteria | 4434 |
| 24 | Ga0055536_1001009 | 3300003781 | Bacteria | 17895 |
| 25 | Ga0055534_1000806 | 3300003784 | Bacteria | 14533 |
| 26 | Ga0055534_1006267 | 3300003784 | Bacteria | 3023 |
| 27 | Ga0055528_1000780 | 3300003790 | Bacteria | 22142 |
| 28 | Ga0055528_1016555 | 3300003790 | Bacteria | 2599 |
| 29 | Ga0055530_10000730 | 3300003791 | Bacteria | 27505 |
| 30 | Ga0055530_10001183 | 3300003791 | Bacteria | 20158 |
| 31 | Ga0055540_1001469 | 3300003792 | Bacteria | 14046 |
| 32 | Ga0055540_1005496 | 3300003792 | Bacteria | 5306 |
| 33 | Ga0055531_10002619 | 3300003794 | Bacteria | 11919 |
| 34 | Ga0055531_10008256 | 3300003794 | Bacteria | 5535 |
| 35 | Ga0055543_1000702 | 3300004625 | Bacteria | 17034 |
| 36 | Ga0055543_1001310 | 3300004625 | Bacteria | 10206 |
| 37 | Ga0065165_1000278 | 3300005262 | Bacteria | 87353 |
| 38 | Ga0065165_1002519 | 3300005262 | Bacteria | 15255 |
| 39 | Ga0065165_1016865 | 3300005262 | Bacteria | 2714 |
| 40 | Ga0065165_1024980 | 3300005262 | Bacteria | 1996 |
| 41 | Ga0065714_10404806 | 3300005288 | Bacteria | 587 |
| 42 | Ga0065715_10136549 | 3300005293 | Bacteria | 1920 |
| 43 | Ga0070658_10005436 | 3300005327 | Bacteria | 10336 |
| 44 | Ga0070676_10067141 | 3300005328 | Bacteria | 2144 |
| 45 | Ga0070670_100061462 | 3300005331 | Bacteria | 3224 |
| 46 | Ga0070670_100065897 | 3300005331 | Bacteria | 3108 |
| 47 | Ga0070670_100136746 | 3300005331 | Bacteria | 2118 |
| 48 | Ga0070677_10011531 | 3300005333 | Bacteria | 3051 |
| 49 | Ga0068869_100367635 | 3300005334 | Bacteria | 1176 |
| 50 | Ga0068869_101690182 | 3300005334 | Bacteria | 565 |
| 51 | Ga0070666_10000008 | 3300005335 | Bacteria | 293415 |
| 52 | Ga0070661_100013390 | 3300005344 | Bacteria | 5757 |
| 53 | Ga0070668_100026997 | 3300005347 | Bacteria | 4359 |
| 54 | Ga0070668_100787774 | 3300005347 | Bacteria | 844 |
| 55 | Ga0070668_101231803 | 3300005347 | Bacteria | 679 |
| 56 | Ga0070669_100022638 | 3300005353 | Bacteria | 4494 |
| 57 | Ga0070669_100118587 | 3300005353 | Bacteria | 2016 |
| 58 | Ga0070675_100000730 | 3300005354 | Bacteria | 22896 |
| 59 | Ga0070671_100002821 | 3300005355 | Bacteria | 13508 |
| 60 | Ga0070671_100034351 | 3300005355 | Bacteria | 4197 |
| 61 | Ga0070671_100234860 | 3300005355 | Bacteria | 1556 |
| 62 | Ga0070671_100781906 | 3300005355 | Bacteria | 830 |
| 63 | Ga0070674_101268572 | 3300005356 | Bacteria | 656 |
| 64 | Ga0070673_100016466 | 3300005364 | Bacteria | 5229 |
| 65 | Ga0070673_100087038 | 3300005364 | Bacteria | 2546 |
| 66 | Ga0070673_100429956 | 3300005364 | Bacteria | 1185 |
| 67 | Ga0070667_100023464 | 3300005367 | Bacteria | 5118 |
| 68 | Ga0070667_100035512 | 3300005367 | Bacteria | 4177 |
| 69 | Ga0070667_100230615 | 3300005367 | Bacteria | 1651 |
| 70 | Ga0070667_100412982 | 3300005367 | Bacteria | 1230 |
| 71 | Ga0070667_100457391 | 3300005367 | Bacteria | 1167 |
| 72 | Ga0070667_100701117 | 3300005367 | Bacteria | 937 |
| 73 | Ga0070667_101396241 | 3300005367 | Bacteria | 657 |
| 74 | Ga0070667_101416414 | 3300005367 | Bacteria | 652 |
| 75 | Ga0070708_100173250 | 3300005445 | Bacteria | 2015 |
| 76 | Ga0070708_100289057 | 3300005445 | Bacteria | 1543 |
| 77 | Ga0070663_100003812 | 3300005455 | Bacteria | 8775 |
| 78 | Ga0070678_100011111 | 3300005456 | Bacteria | 5538 |
| 79 | Ga0070662_100224876 | 3300005457 | Bacteria | 1499 |
| 80 | Ga0070662_100403870 | 3300005457 | Bacteria | 1128 |
| 81 | Ga0068867_100001685 | 3300005459 | Bacteria | 15414 |
| 82 | Ga0068867_100020669 | 3300005459 | Bacteria | 4691 |
| 83 | Ga0068867_100243945 | 3300005459 | Bacteria | 1458 |
| 84 | Ga0070706_100000297 | 3300005467 | Bacteria | 60441 |
| 85 | Ga0070707_100016306 | 3300005468 | Bacteria | 6974 |
| 86 | Ga0070698_100156206 | 3300005471 | Bacteria | 2227 |
| 87 | Ga0070697_101469464 | 3300005536 | Bacteria | 609 |
| 88 | Ga0068853_100001340 | 3300005539 | Bacteria | 17741 |
| 89 | Ga0068853_100059971 | 3300005539 | Bacteria | 3287 |
| 90 | Ga0068853_100398065 | 3300005539 | Bacteria | 1288 |
| 91 | Ga0070672_100000424 | 3300005543 | Bacteria | 24646 |
| 92 | Ga0070665_100009026 | 3300005548 | Bacteria | 10100 |
| 93 | Ga0070665_100031156 | 3300005548 | Bacteria | 5368 |
| 94 | Ga0070665_100363659 | 3300005548 | Bacteria | 1453 |
| 95 | Ga0070665_100687013 | 3300005548 | Bacteria | 1036 |
| 96 | Ga0070665_100841690 | 3300005548 | Bacteria | 930 |
| 97 | Ga0070665_100932919 | 3300005548 | Bacteria | 880 |
| 98 | Ga0068855_100123638 | 3300005563 | Bacteria | 2960 |
| 99 | Ga0068855_100150995 | 3300005563 | Bacteria | 2642 |
| 100 | Ga0070664_100096689 | 3300005564 | Bacteria | 2563 |
| 101 | Ga0070664_100457789 | 3300005564 | Bacteria | 1172 |
| 102 | Ga0070664_101272953 | 3300005564 | Bacteria | 694 |
| 103 | Ga0068857_100018893 | 3300005577 | Bacteria | 6048 |
| 104 | Ga0068857_100285909 | 3300005577 | Bacteria | 1518 |
| 105 | Ga0068857_100763917 | 3300005577 | Bacteria | 921 |
| 106 | Ga0068854_100073055 | 3300005578 | Bacteria | 2513 |
| 107 | Ga0068854_100649103 | 3300005578 | Bacteria | 906 |
| 108 | Ga0068856_100482528 | 3300005614 | Bacteria | 1260 |
| 109 | Ga0068856_101101422 | 3300005614 | Bacteria | 811 |
| 110 | Ga0068852_100045272 | 3300005616 | Bacteria | 3742 |
| 111 | Ga0068852_100172206 | 3300005616 | Bacteria | 2030 |
| 112 | Ga0068859_100538291 | 3300005617 | Bacteria | 1262 |
| 113 | Ga0068864_100022500 | 3300005618 | Bacteria | 5285 |
| 114 | Ga0068864_100240584 | 3300005618 | Bacteria | 1677 |
| 115 | Ga0068866_10043543 | 3300005718 | Bacteria | 2241 |
| 116 | Ga0068861_100009698 | 3300005719 | Bacteria | 6657 |
| 117 | Ga0068851_10014519 | 3300005834 | Bacteria | 3741 |
| 118 | Ga0068851_10111571 | 3300005834 | Bacteria | 1460 |
| 119 | Ga0068863_100276597 | 3300005841 | Bacteria | 1626 |
| 120 | Ga0068863_101031522 | 3300005841 | Bacteria | 826 |
| 121 | Ga0068863_102127948 | 3300005841 | Bacteria | 571 |
| 122 | Ga0068858_100252152 | 3300005842 | Bacteria | 1676 |
| 123 | Ga0068860_100134545 | 3300005843 | Bacteria | 2374 |
| 124 | Ga0068860_100262900 | 3300005843 | Bacteria | 1682 |
| 125 | Ga0068860_100304562 | 3300005843 | Bacteria | 1562 |
| 126 | Ga0068860_101225147 | 3300005843 | Bacteria | 771 |
| 127 | Ga0068862_100114031 | 3300005844 | Bacteria | 2375 |
| 128 | Ga0068862_100177327 | 3300005844 | Bacteria | 1911 |
| 129 | Ga0081455_10779102 | 3300005937 | Bacteria | 602 |
| 130 | Ga0075365_10039463 | 3300006038 | Bacteria | 3074 |
| 131 | Ga0075365_10052571 | 3300006038 | Bacteria | 2695 |
| 132 | Ga0075365_10202781 | 3300006038 | Bacteria | 1390 |
| 133 | Ga0075365_10239282 | 3300006038 | Bacteria | 1275 |
| 134 | Ga0075368_10007174 | 3300006042 | Bacteria | 3927 |
| 135 | Ga0075368_10119702 | 3300006042 | Bacteria | 1090 |
| 136 | Ga0075363_100001650 | 3300006048 | Bacteria | 8628 |
| 137 | Ga0075363_100373831 | 3300006048 | Bacteria | 835 |
| 138 | Ga0075364_10160045 | 3300006051 | Bacteria | 1520 |
| 139 | Ga0075364_10218217 | 3300006051 | Bacteria | 1294 |
| 140 | Ga0075364_10243112 | 3300006051 | Bacteria | 1223 |
| 141 | Ga0075364_10869892 | 3300006051 | Bacteria | 614 |
| 142 | Ga0075362_10002752 | 3300006177 | Bacteria | 5996 |
| 143 | Ga0075362_10056719 | 3300006177 | Bacteria | 1764 |
| 144 | Ga0075362_10589839 | 3300006177 | Bacteria | 574 |
| 145 | Ga0075367_10054447 | 3300006178 | Bacteria | 2372 |
| 146 | Ga0075367_10111355 | 3300006178 | Bacteria | 1680 |
| 147 | Ga0075367_10116181 | 3300006178 | Bacteria | 1646 |
| 148 | Ga0075367_10125088 | 3300006178 | Bacteria | 1586 |
| 149 | Ga0075367_10142242 | 3300006178 | Bacteria | 1486 |
| 150 | Ga0075367_10217764 | 3300006178 | Bacteria | 1194 |
| 151 | Ga0075367_10936405 | 3300006178 | Bacteria | 553 |
| 152 | Ga0075369_10172125 | 3300006186 | Bacteria | 995 |
| 153 | Ga0075369_10184095 | 3300006186 | Bacteria | 961 |
| 154 | Ga0075366_10024798 | 3300006195 | Bacteria | 3498 |
| 155 | Ga0075366_10035548 | 3300006195 | Bacteria | 2937 |
| 156 | Ga0075366_10169770 | 3300006195 | Bacteria | 1323 |
| 157 | Ga0097621_100004522 | 3300006237 | Bacteria | 9692 |
| 158 | Ga0097621_100954044 | 3300006237 | Bacteria | 801 |
| 159 | Ga0075370_10004005 | 3300006353 | Bacteria | 7080 |
| 160 | Ga0075370_10051002 | 3300006353 | Bacteria | 2347 |
| 161 | Ga0075370_10112829 | 3300006353 | Bacteria | 1579 |
| 162 | Ga0068871_100027319 | 3300006358 | Bacteria | 4463 |
| 163 | Ga0068871_101506224 | 3300006358 | Bacteria | 636 |
| 164 | Ga0097620_100538283 | 3300006931 | Bacteria | 1262 |
| 165 | Ga0099824_1016622 | 3300006942 | Bacteria | 6617 |
| 166 | Ga0105250_10168069 | 3300009092 | Bacteria | 917 |
| 167 | Ga0105240_10024486 | 3300009093 | Bacteria | 7953 |
| 168 | Ga0105240_10294803 | 3300009093 | Bacteria | 1858 |
| 169 | Ga0105240_10361675 | 3300009093 | Bacteria | 1643 |
| 170 | Ga0105245_10136564 | 3300009098 | Bacteria | 2305 |
| 171 | Ga0105245_12248933 | 3300009098 | Bacteria | 599 |
| 172 | Ga0105247_10123462 | 3300009101 | Bacteria | 1680 |
| 173 | Ga0105247_10573530 | 3300009101 | Bacteria | 833 |
| 174 | Ga0105243_10048008 | 3300009148 | Bacteria | 3364 |
| 175 | Ga0105243_10256053 | 3300009148 | Bacteria | 1565 |
| 176 | Ga0105241_10089422 | 3300009174 | Bacteria | 2426 |
| 177 | Ga0105241_10281550 | 3300009174 | Bacteria | 1420 |
| 178 | Ga0105248_10099852 | 3300009177 | Bacteria | 3270 |
| 179 | Ga0105248_11194399 | 3300009177 | Bacteria | 860 |
| 180 | Ga0105237_10001770 | 3300009545 | Bacteria | 27892 |
| 181 | Ga0105237_10035674 | 3300009545 | Bacteria | 5031 |
| 182 | Ga0105237_10342649 | 3300009545 | Bacteria | 1499 |
| 183 | Ga0105237_11699223 | 3300009545 | Bacteria | 638 |
| 184 | Ga0105238_10000178 | 3300009551 | Bacteria | 69458 |
| 185 | Ga0105249_10154357 | 3300009553 | Bacteria | 2213 |
| 186 | Ga0105239_10089934 | 3300010375 | Bacteria | 3386 |
| 187 | Ga0105239_10233941 | 3300010375 | Bacteria | 2062 |
| 188 | Ga0105239_10238225 | 3300010375 | Bacteria | 2042 |
| 189 | Ga0105239_11163119 | 3300010375 | Bacteria | 889 |
| 190 | Ga0105239_11571551 | 3300010375 | Bacteria | 760 |
| 191 | Ga0105246_10041441 | 3300011119 | Bacteria | 3112 |
| 192 | Ga0157347_1024357 | 3300012502 | Bacteria | 726 |
| 193 | Ga0157373_10926955 | 3300013100 | Bacteria | 647 |
| 194 | Ga0157371_10018923 | 3300013102 | Bacteria | 5084 |
| 195 | Ga0157371_10948339 | 3300013102 | Bacteria | 654 |
| 196 | Ga0157370_10754424 | 3300013104 | Unclassified | 887 |
| 197 | Ga0157369_10003369 | 3300013105 | Bacteria | 18984 |
| 198 | Ga0157374_10051371 | 3300013296 | Bacteria | 3836 |
| 199 | Ga0157378_10763151 | 3300013297 | Bacteria | 991 |
| 200 | Ga0163162_10000110 | 3300013306 | Bacteria | 73989 |
| 201 | Ga0163162_10210147 | 3300013306 | Bacteria | 2076 |
| 202 | Ga0163162_10752281 | 3300013306 | Bacteria | 1094 |
| 203 | Ga0163162_12338517 | 3300013306 | Bacteria | 614 |
| 204 | Ga0157372_10113515 | 3300013307 | Bacteria | 3105 |
| 205 | Ga0157375_10028467 | 3300013308 | Bacteria | 5237 |
| 206 | Ga0157375_10036930 | 3300013308 | Bacteria | 4676 |
| 207 | Ga0163163_10138673 | 3300014325 | Bacteria | 2474 |
| 208 | Ga0163163_10361097 | 3300014325 | Bacteria | 1509 |
| 209 | Ga0182008_10654775 | 3300014497 | Bacteria | 595 |
| 210 | Ga0157379_10172435 | 3300014968 | Bacteria | 1953 |
| 211 | Ga0157379_11789756 | 3300014968 | Bacteria | 603 |
| 212 | Ga0157376_10026499 | 3300014969 | Bacteria | 4582 |
| 213 | Ga0157376_10104600 | 3300014969 | Bacteria | 2481 |
| 214 | Ga0157376_11968383 | 3300014969 | Bacteria | 622 |
| 215 | Ga0163161_10014561 | 3300017792 | Bacteria | 5474 |
| 216 | Ga0209436_101892 | 3300025208 | Bacteria | 6761 |
| 217 | Ga0209436_105876 | 3300025208 | Bacteria | 2755 |
| 218 | Ga0209672_100230 | 3300025228 | Bacteria | 42658 |
| 219 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 220 | Ga0207425_1000392 | 3300025245 | Bacteria | 29503 |
| 221 | Ga0207425_1002099 | 3300025245 | Bacteria | 7364 |
| 222 | Ga0207425_1063360 | 3300025245 | Bacteria | 648 |
| 223 | Ga0209677_114264 | 3300025253 | Bacteria | 1091 |
| 224 | Ga0209677_123473 | 3300025253 | Bacteria | 684 |
| 225 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 226 | Ga0209148_1027039 | 3300025254 | Bacteria | 886 |
| 227 | Ga0209129_1000111 | 3300025258 | Bacteria | 148853 |
| 228 | Ga0209129_1009569 | 3300025258 | Bacteria | 2531 |
| 229 | Ga0209233_1002734 | 3300025261 | Bacteria | 6354 |
| 230 | Ga0209565_1000146 | 3300025263 | Bacteria | 97720 |
| 231 | Ga0209565_1007086 | 3300025263 | Bacteria | 3064 |
| 232 | Ga0209673_1001463 | 3300025273 | Bacteria | 22194 |
| 233 | Ga0209673_1003920 | 3300025273 | Bacteria | 8347 |
| 234 | Ga0209673_1079023 | 3300025273 | Bacteria | 759 |
| 235 | Ga0209130_1000470 | 3300025284 | Bacteria | 41506 |
| 236 | Ga0209130_1000492 | 3300025284 | Bacteria | 40584 |
| 237 | Ga0209130_1004038 | 3300025284 | Bacteria | 5828 |
| 238 | Ga0209675_1000331 | 3300025291 | Bacteria | 41480 |
| 239 | Ga0209675_1010206 | 3300025291 | Bacteria | 3229 |
| 240 | Ga0209675_1010601 | 3300025291 | Bacteria | 3132 |
| 241 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 242 | Ga0209025_1000116 | 3300025294 | Bacteria | 218293 |
| 243 | Ga0209564_1000155 | 3300025295 | Bacteria | 165859 |
| 244 | Ga0209564_1000292 | 3300025295 | Bacteria | 101735 |
| 245 | Ga0209564_1050065 | 3300025295 | Bacteria | 1026 |
| 246 | Ga0209758_1000107 | 3300025297 | Bacteria | 218293 |
| 247 | Ga0209758_1000560 | 3300025297 | Bacteria | 58586 |
| 248 | Ga0209758_1014068 | 3300025297 | Bacteria | 4296 |
| 249 | Ga0209758_1023566 | 3300025297 | Bacteria | 2779 |
| 250 | Ga0209758_1031638 | 3300025297 | Bacteria | 2166 |
| 251 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 252 | Ga0209256_1000038 | 3300025299 | Bacteria | 375225 |
| 253 | Ga0209256_1000087 | 3300025299 | Bacteria | 218290 |
| 254 | Ga0207426_1000090 | 3300025302 | Bacteria | 280662 |
| 255 | Ga0207426_1000123 | 3300025302 | Bacteria | 218290 |
| 256 | Ga0207426_1000721 | 3300025302 | Bacteria | 38161 |
| 257 | Ga0207426_1002233 | 3300025302 | Bacteria | 12914 |
| 258 | Ga0207426_1054138 | 3300025302 | Bacteria | 1182 |
| 259 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 260 | Ga0209051_1004594 | 3300025303 | Bacteria | 8422 |
| 261 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 262 | Ga0209257_1001961 | 3300025304 | Bacteria | 22193 |
| 263 | Ga0209257_1021240 | 3300025304 | Bacteria | 2367 |
| 264 | Ga0207697_10010315 | 3300025315 | Bacteria | 3999 |
| 265 | Ga0207656_10024934 | 3300025321 | Bacteria | 2424 |
| 266 | Ga0207682_10003155 | 3300025893 | Bacteria | 7221 |
| 267 | Ga0207710_10129595 | 3300025900 | Bacteria | 1211 |
| 268 | Ga0207688_10133648 | 3300025901 | Bacteria | 1455 |
| 269 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 270 | Ga0207647_10011713 | 3300025904 | Bacteria | 6138 |
| 271 | Ga0207645_10026326 | 3300025907 | Bacteria | 3760 |
| 272 | Ga0207645_10298781 | 3300025907 | Bacteria | 1072 |
| 273 | Ga0207643_10004555 | 3300025908 | Bacteria | 7445 |
| 274 | Ga0207705_10023654 | 3300025909 | Bacteria | 4383 |
| 275 | Ga0207705_10027327 | 3300025909 | Bacteria | 4070 |
| 276 | Ga0207684_10005581 | 3300025910 | Bacteria | 11584 |
| 277 | Ga0207654_10050199 | 3300025911 | Bacteria | 2396 |
| 278 | Ga0207654_10811583 | 3300025911 | Bacteria | 676 |
| 279 | Ga0207695_10070556 | 3300025913 | Bacteria | 3571 |
| 280 | Ga0207695_10135301 | 3300025913 | Bacteria | 2418 |
| 281 | Ga0207671_10082541 | 3300025914 | Bacteria | 2412 |
| 282 | Ga0207671_10107312 | 3300025914 | Bacteria | 2121 |
| 283 | Ga0207671_11133110 | 3300025914 | Bacteria | 614 |
| 284 | Ga0207657_10135966 | 3300025919 | Bacteria | 2011 |
| 285 | Ga0207649_10016493 | 3300025920 | Bacteria | 4168 |
| 286 | Ga0207649_10054356 | 3300025920 | Bacteria | 2492 |
| 287 | Ga0207649_11078196 | 3300025920 | Bacteria | 633 |
| 288 | Ga0207646_10800759 | 3300025922 | Bacteria | 839 |
| 289 | Ga0207681_10204591 | 3300025923 | Bacteria | 1518 |
| 290 | Ga0207694_10000187 | 3300025924 | Bacteria | 62967 |
| 291 | Ga0207650_10001814 | 3300025925 | Bacteria | 15112 |
| 292 | Ga0207650_10159196 | 3300025925 | Bacteria | 1788 |
| 293 | Ga0207659_10000544 | 3300025926 | Bacteria | 22498 |
| 294 | Ga0207687_10011700 | 3300025927 | Bacteria | 5739 |
| 295 | Ga0207687_11439329 | 3300025927 | Bacteria | 592 |
| 296 | Ga0207644_10009377 | 3300025931 | Bacteria | 6429 |
| 297 | Ga0207644_10184661 | 3300025931 | Bacteria | 1636 |
| 298 | Ga0207690_10800956 | 3300025932 | Bacteria | 779 |
| 299 | Ga0207706_10093896 | 3300025933 | Bacteria | 2639 |
| 300 | Ga0207706_10155947 | 3300025933 | Bacteria | 2008 |
| 301 | Ga0207706_10766204 | 3300025933 | Bacteria | 821 |
| 302 | Ga0207709_10040458 | 3300025935 | Bacteria | 2791 |
| 303 | Ga0207709_10730037 | 3300025935 | Bacteria | 795 |
| 304 | Ga0207670_10743719 | 3300025936 | Bacteria | 814 |
| 305 | Ga0207669_11845511 | 3300025937 | Bacteria | 516 |
| 306 | Ga0207691_10000186 | 3300025940 | Bacteria | 58949 |
| 307 | Ga0207711_10123427 | 3300025941 | Bacteria | 2314 |
| 308 | Ga0207689_10099054 | 3300025942 | Bacteria | 2395 |
| 309 | Ga0207689_10102890 | 3300025942 | Bacteria | 2347 |
| 310 | Ga0207689_10164947 | 3300025942 | Bacteria | 1826 |
| 311 | Ga0207689_10200495 | 3300025942 | Bacteria | 1647 |
| 312 | Ga0207679_10067762 | 3300025945 | Bacteria | 2679 |
| 313 | Ga0207679_10099579 | 3300025945 | Bacteria | 2270 |
| 314 | Ga0207667_10063180 | 3300025949 | Bacteria | 3869 |
| 315 | Ga0207667_10291743 | 3300025949 | Bacteria | 1666 |
| 316 | Ga0207651_10276936 | 3300025960 | Bacteria | 1384 |
| 317 | Ga0207651_10288782 | 3300025960 | Bacteria | 1359 |
| 318 | Ga0207712_10758076 | 3300025961 | Bacteria | 851 |
| 319 | Ga0207668_10527235 | 3300025972 | Bacteria | 1020 |
| 320 | Ga0207668_11380235 | 3300025972 | Bacteria | 635 |
| 321 | Ga0207640_10057513 | 3300025981 | Bacteria | 2558 |
| 322 | Ga0207640_10587450 | 3300025981 | Bacteria | 941 |
| 323 | Ga0207658_10068331 | 3300025986 | Bacteria | 2681 |
| 324 | Ga0207658_10079792 | 3300025986 | Bacteria | 2505 |
| 325 | Ga0207658_10111212 | 3300025986 | Bacteria | 2166 |
| 326 | Ga0207658_10166589 | 3300025986 | Bacteria | 1811 |
| 327 | Ga0207658_11022758 | 3300025986 | Bacteria | 754 |
| 328 | Ga0207658_11279264 | 3300025986 | Bacteria | 671 |
| 329 | Ga0207658_11819689 | 3300025986 | Bacteria | 555 |
| 330 | Ga0207677_11060663 | 3300026023 | Bacteria | 737 |
| 331 | Ga0207703_10377016 | 3300026035 | Bacteria | 1311 |
| 332 | Ga0207639_10013550 | 3300026041 | Bacteria | 5712 |
| 333 | Ga0207639_10378590 | 3300026041 | Bacteria | 1270 |
| 334 | Ga0207639_10422403 | 3300026041 | Bacteria | 1205 |
| 335 | Ga0207678_10158522 | 3300026067 | Bacteria | 1933 |
| 336 | Ga0207702_10276208 | 3300026078 | Bacteria | 1586 |
| 337 | Ga0207702_10294328 | 3300026078 | Bacteria | 1539 |
| 338 | Ga0207702_10970656 | 3300026078 | Bacteria | 843 |
| 339 | Ga0207641_10093821 | 3300026088 | Bacteria | 2631 |
| 340 | Ga0207641_10254720 | 3300026088 | Bacteria | 1641 |
| 341 | Ga0207641_11843481 | 3300026088 | Bacteria | 606 |
| 342 | Ga0207648_10000629 | 3300026089 | Bacteria | 39533 |
| 343 | Ga0207648_10134043 | 3300026089 | Bacteria | 2181 |
| 344 | Ga0207648_10256265 | 3300026089 | Bacteria | 1560 |
| 345 | Ga0207676_10317132 | 3300026095 | Bacteria | 1429 |
| 346 | Ga0207676_11522550 | 3300026095 | Bacteria | 666 |
| 347 | Ga0207674_10022322 | 3300026116 | Bacteria | 6796 |
| 348 | Ga0207674_10117439 | 3300026116 | Bacteria | 2631 |
| 349 | Ga0207674_10455243 | 3300026116 | Bacteria | 1237 |
| 350 | Ga0207675_101163692 | 3300026118 | Bacteria | 791 |
| 351 | Ga0207683_10010974 | 3300026121 | Bacteria | 7725 |
| 352 | Ga0207683_10187908 | 3300026121 | Bacteria | 1875 |
| 353 | Ga0207698_10149897 | 3300026142 | Bacteria | 2022 |
| 354 | Ga0207698_11105065 | 3300026142 | Bacteria | 806 |
| 355 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 356 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 357 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 358 | Ga0209998_10123498 | 3300027717 | Bacteria | 654 |
| 359 | Ga0209813_10018694 | 3300027866 | Bacteria | 1917 |
| 360 | Ga0209974_10003650 | 3300027876 | Bacteria | 5526 |
| 361 | Ga0268266_10000051 | 3300028379 | Bacteria | 296231 |
| 362 | Ga0268266_10008473 | 3300028379 | Bacteria | 9138 |
| 363 | Ga0268266_10064413 | 3300028379 | Bacteria | 3166 |
| 364 | Ga0268266_10442246 | 3300028379 | Bacteria | 1235 |
| 365 | Ga0268266_10581948 | 3300028379 | Bacteria | 1074 |
| 366 | Ga0268266_11609506 | 3300028379 | Bacteria | 625 |
| 367 | Ga0268266_12231182 | 3300028379 | Bacteria | 519 |
| 368 | Ga0268265_10009645 | 3300028380 | Bacteria | 6518 |
| 369 | Ga0268265_10053454 | 3300028380 | Bacteria | 3060 |
| 370 | Ga0268265_11125856 | 3300028380 | Bacteria | 780 |
| 371 | Ga0268264_10091715 | 3300028381 | Bacteria | 2621 |
| 372 | Ga0268264_10173195 | 3300028381 | Bacteria | 1954 |
| 373 | Ga0268264_10945235 | 3300028381 | Bacteria | 867 |
| 374 | Ga0307517_10000024 | 3300028786 | Bacteria | 185597 |
| 375 | Ga0307517_10221165 | 3300028786 | Bacteria | 1151 |
| 376 | Ga0307515_10000572 | 3300028794 | Bacteria | 86935 |
| 377 | Ga0307515_10039883 | 3300028794 | Bacteria | 7447 |
| 378 | Ga0307515_10048367 | 3300028794 | Bacteria | 6431 |
| 379 | Ga0307515_10097511 | 3300028794 | Bacteria | 3592 |
| 380 | Ga0307515_10827884 | 3300028794 | Bacteria | 550 |
| 381 | Ga0307512_10099062 | 3300030522 | Bacteria | 1986 |
| 382 | Ga0316180_1185350 | 3300030736 | Bacteria | 2733 |
| 383 | Ga0307513_10011603 | 3300031456 | Bacteria | 10940 |
| 384 | Ga0307513_10019885 | 3300031456 | Bacteria | 7978 |
| 385 | Ga0307513_10091911 | 3300031456 | Bacteria | 3091 |
| 386 | Ga0307513_10158103 | 3300031456 | Bacteria | 2163 |
| 387 | Ga0307513_10329066 | 3300031456 | Bacteria | 1283 |
| 388 | Ga0307513_10621626 | 3300031456 | Bacteria | 788 |
| 389 | Ga0307513_11008989 | 3300031456 | Bacteria | 542 |
| 390 | Ga0307509_10000778 | 3300031507 | Bacteria | 54586 |
| 391 | Ga0307509_10089931 | 3300031507 | Bacteria | 3147 |
| 392 | Ga0307508_10017904 | 3300031616 | Bacteria | 6438 |
| 393 | Ga0307516_10011416 | 3300031730 | Bacteria | 9650 |
| 394 | Ga0307516_10014057 | 3300031730 | Bacteria | 8487 |
| 395 | Ga0307516_10082809 | 3300031730 | Bacteria | 3050 |
| 396 | Ga0307516_10179875 | 3300031730 | Bacteria | 1849 |
| 397 | Ga0307406_10499334 | 3300031901 | Bacteria | 986 |
| 398 | Ga0307510_10049877 | 3300033180 | Bacteria | 4448 |
| 399 | Ga0395900_0292066 | 3300037418 | Bacteria | 1619 |
| 400 | Ga0395905_0019296 | 3300037471 | Bacteria | 6464 |
| 401 | Ga0395905_0076843 | 3300037471 | Bacteria | 3129 |
| 402 | Ga0395905_0808610 | 3300037471 | Bacteria | 840 |
| 403 | Ga0395901_0112041 | 3300038443 | Bacteria | 2866 |
| 404 | Ga0395901_0268855 | 3300038443 | Bacteria | 1774 |
| 405 | Ga0451791_1202226 | 3300041451 | Bacteria | 531 |
| 406 | Ga0451793_1617958 | 3300041452 | Bacteria | 1605 |
| 407 | Ga0451804_0864300 | 3300041463 | Bacteria | 732 |
| 408 | Ga0451833_1488514 | 3300041491 | Bacteria | 2254 |
| 409 | Ga0451835_0233361 | 3300041492 | Bacteria | 1219 |
| 410 | Ga0451845_0605482 | 3300041501 | Bacteria | 1067 |
| 411 | Ga0451851_1070308 | 3300041507 | Bacteria | 1038 |
| 412 | Ga0451843_1372200 | 3300041509 | Bacteria | 607 |
| 413 | Ga0451855_1272962 | 3300041511 | Bacteria | 915 |
| 414 | Ga0451853_3203472 | 3300041512 | Bacteria | 1757 |
| 415 | Ga0466969_0001480 | 3300044656 | Bacteria | 12627 |
| 416 | Ga0466969_0004808 | 3300044656 | Bacteria | 7193 |
| 417 | Ga0466969_0014853 | 3300044656 | Bacteria | 4088 |
| 418 | Ga0466972_0000807 | 3300044658 | Bacteria | 14916 |
| 419 | Ga0453683_0905587 | 3300044673 | Bacteria | 583 |
| 420 | Ga0466966_0001348 | 3300044684 | Bacteria | 15776 |
| 421 | Ga0466966_0023654 | 3300044684 | Bacteria | 4021 |
| 422 | Ga0466961_0000120 | 3300044693 | Bacteria | 52569 |
| 423 | Ga0466961_0008103 | 3300044693 | Bacteria | 6692 |
| 424 | Ga0466961_0211955 | 3300044693 | Bacteria | 1195 |
| 425 | Ga0466963_0356664 | 3300044694 | Bacteria | 1030 |
| 426 | Ga0466971_0000095 | 3300044719 | Bacteria | 32391 |
| 427 | Ga0466970_0395994 | 3300044765 | Bacteria | 787 |
| 428 | Ga0466957_0005130 | 3300044842 | Bacteria | 7320 |
| 429 | Ga0466959_0000240 | 3300045049 | Bacteria | 34052 |
| 430 | Ga0466958_0000923 | 3300045836 | Bacteria | 13221 |
| 431 | Ga0495617_158665 | 3300046452 | Bacteria | 718 |
| 432 | Ga0495590_0105262 | 3300046457 | Bacteria | 1004 |
| 433 | Ga0495629_0004834 | 3300046459 | Bacteria | 10101 |
| 434 | Ga0495638_0080378 | 3300046460 | Bacteria | 1981 |
| 435 | Ga0495638_0249562 | 3300046460 | Unclassified | 979 |
| 436 | Ga0495651_0061972 | 3300046462 | Bacteria | 2862 |
| 437 | Ga0495650_0005807 | 3300046471 | Bacteria | 7871 |
| 438 | Ga0495607_0207588 | 3300046501 | Bacteria | 966 |
| 439 | Ga0495606_0054446 | 3300046507 | Bacteria | 2591 |
| 440 | Ga0495606_0209727 | 3300046507 | Bacteria | 1104 |
| 441 | Ga0495620_0027728 | 3300046515 | Bacteria | 2646 |
| 442 | Ga0495620_0362554 | 3300046515 | Bacteria | 549 |
| 443 | Ga0495631_0124431 | 3300046518 | Bacteria | 1109 |
| 444 | Ga0495631_0244360 | 3300046518 | Bacteria | 765 |
| 445 | Ga0495632_0045232 | 3300046519 | Bacteria | 2194 |
| 446 | Ga0495632_0070199 | 3300046519 | Bacteria | 1685 |
| 447 | Ga0495632_0085945 | 3300046519 | Bacteria | 1496 |
| 448 | Ga0495643_0018248 | 3300046522 | Bacteria | 4082 |
| 449 | Ga0495648_0135996 | 3300046524 | Bacteria | 1300 |
| 450 | Ga0495666_0185742 | 3300046526 | Bacteria | 959 |
| 451 | Ga0495656_0011297 | 3300046615 | Bacteria | 3275 |
| 452 | Ga0495668_0083471 | 3300046616 | Bacteria | 1752 |
| 453 | Ga0495668_0086160 | 3300046616 | Bacteria | 1723 |
| 454 | Ga0495668_0278150 | 3300046616 | Bacteria | 917 |
| 455 | Ga0495634_0236678 | 3300046642 | Bacteria | 1122 |
| 456 | Ga0495625_0004298 | 3300046660 | Bacteria | 13552 |
| 457 | Ga0495625_0016332 | 3300046660 | Bacteria | 5845 |
| 458 | Ga0495625_0100603 | 3300046660 | Bacteria | 1987 |
| 459 | Ga0495635_0046740 | 3300046663 | Bacteria | 2985 |
| 460 | Ga0495659_0141034 | 3300046664 | Bacteria | 962 |
| 461 | Ga0495659_0289622 | 3300046664 | Bacteria | 690 |
| 462 | Ga0495588_0042839 | 3300046674 | Bacteria | 2315 |
| 463 | Ga0495657_0139213 | 3300046675 | Bacteria | 1514 |
| 464 | Ga0495646_0112632 | 3300046680 | Bacteria | 1548 |
| 465 | Ga0495624_0840139 | 3300046690 | Bacteria | 542 |
| 466 | Ga0495670_0473822 | 3300046691 | Bacteria | 679 |
| 467 | Ga0495649_0030817 | 3300046694 | Bacteria | 2960 |
| 468 | Ga0495649_0188890 | 3300046694 | Bacteria | 1073 |
| 469 | Ga0495600_0058038 | 3300046809 | Bacteria | 2528 |
| 470 | Ga0495581_0141997 | 3300047315 | Bacteria | 1401 |
| 471 | Ga0495604_0070415 | 3300047317 | Bacteria | 2648 |
| 472 | Ga0495636_0118701 | 3300047318 | Bacteria | 1168 |
| 473 | Ga0495687_011038 | 3300047443 | Bacteria | 4891 |
| 474 | Ga0495673_0176623 | 3300047469 | Bacteria | 811 |
| 475 | Ga0495686_0034809 | 3300047472 | Bacteria | 3241 |
| 476 | Ga0495686_0100780 | 3300047472 | Bacteria | 1742 |
| 477 | Ga0495686_0102336 | 3300047472 | Bacteria | 1726 |
| 478 | Ga0495593_0102751 | 3300047673 | Bacteria | 1465 |
| 479 | Ga0495614_0312453 | 3300048089 | Bacteria | 728 |
| 480 | Ga0496100_0272880 | 3300048903 | Bacteria | 1258 |
| 481 | Ga0496100_0581477 | 3300048903 | Bacteria | 868 |
| 482 | Ga0496101_0129363 | 3300048904 | Bacteria | 1916 |
| 483 | Ga0496101_0506490 | 3300048904 | Bacteria | 954 |
| 484 | Ga0496102_0034116 | 3300048905 | Bacteria | 4576 |
| 485 | Ga0496102_0209752 | 3300048905 | Bacteria | 1837 |
| 486 | Ga0496102_1195943 | 3300048905 | Bacteria | 680 |
| 487 | Ga0496103_0002701 | 3300048906 | Bacteria | 11067 |
| 488 | Ga0496104_0075514 | 3300048907 | Bacteria | 3209 |
| 489 | Ga0496105_0099818 | 3300048908 | Bacteria | 2397 |
| 490 | Ga0496105_0145330 | 3300048908 | Bacteria | 1950 |
| 491 | Ga0496106_0609890 | 3300048909 | Bacteria | 874 |
| 492 | Ga0496107_0651931 | 3300048910 | Bacteria | 776 |
| 493 | Ga0496108_0010766 | 3300048911 | Bacteria | 7425 |
| 494 | Ga0496108_0083771 | 3300048911 | Bacteria | 2705 |
| 495 | Ga0496108_1370920 | 3300048911 | Bacteria | 592 |
| 496 | Ga0496109_0053400 | 3300048912 | Bacteria | 3685 |
| 497 | Ga0496109_1150309 | 3300048912 | Bacteria | 713 |
| 498 | Ga0496112_0111850 | 3300048915 | Bacteria | 2700 |
| 499 | Ga0496112_0134434 | 3300048915 | Bacteria | 2443 |
| 500 | Ga0496112_0256141 | 3300048915 | Bacteria | 1700 |
| 501 | Ga0496113_0111091 | 3300048916 | Bacteria | 2134 |
| 502 | Ga0496113_0121398 | 3300048916 | Bacteria | 2043 |
| 503 | Ga0496113_0438421 | 3300048916 | Bacteria | 1049 |
| 504 | Ga0496115_0146479 | 3300048918 | Bacteria | 1949 |
| 505 | Ga0496115_0560678 | 3300048918 | Bacteria | 912 |
| 506 | Ga0496115_0997367 | 3300048918 | Bacteria | 640 |
| 507 | Ga0496117_0053343 | 3300048920 | Bacteria | 2842 |
| 508 | Ga0496117_0118188 | 3300048920 | Bacteria | 1635 |
| 509 | Ga0496117_0401008 | 3300048920 | Bacteria | 692 |
| 510 | Ga0496118_0018021 | 3300048921 | Bacteria | 6394 |
| 511 | Ga0496118_0026318 | 3300048921 | Bacteria | 4959 |
| 512 | Ga0496118_0056090 | 3300048921 | Bacteria | 2965 |
| 513 | Ga0496118_0068786 | 3300048921 | Bacteria | 2569 |
| 514 | Ga0496118_0149727 | 3300048921 | Bacteria | 1463 |
| 515 | Ga0496119_0011409 | 3300048922 | Bacteria | 7362 |
| 516 | Ga0496119_0082411 | 3300048922 | Bacteria | 1850 |
| 517 | Ga0496119_0147315 | 3300048922 | Bacteria | 1265 |
| 518 | Ga0496120_0110715 | 3300048923 | Bacteria | 1435 |
| 519 | Ga0496121_0209690 | 3300048924 | Bacteria | 1381 |
| 520 | Ga0496121_0352834 | 3300048924 | Bacteria | 979 |
| 521 | Ga0496122_0370153 | 3300048925 | Bacteria | 740 |
| 522 | Ga0496124_0039510 | 3300048927 | Bacteria | 4090 |
| 523 | Ga0496125_0076413 | 3300048928 | Bacteria | 2586 |
| 524 | Ga0496125_0094222 | 3300048928 | Bacteria | 2232 |
| 525 | Ga0496125_0311952 | 3300048928 | Bacteria | 958 |
| 526 | Ga0496126_0048730 | 3300048929 | Bacteria | 3870 |
| 527 | Ga0496126_0063564 | 3300048929 | Bacteria | 3309 |
| 528 | Ga0496126_0108826 | 3300048929 | Bacteria | 2416 |
| 529 | Ga0496126_0440086 | 3300048929 | Bacteria | 1051 |
| 530 | Ga0495682_0344314 | 3300049460 | Bacteria | 525 |
| 531 | Ga0501034_0460748 | 3300049571 | Bacteria | 1188 |
| 532 | Ga0501216_106498 | 3300049660 | Bacteria | 624 |
| 533 | nmdc:mga03683_123032_c1 | 3300050489 | Bacteria | 1155 |
| 534 | nmdc:mga03683_245606_c1 | 3300050489 | Bacteria | 830 |
| 535 | nmdc:mga03683_57034_c1 | 3300050489 | Bacteria | 1643 |
| 536 | nmdc:mga03n38_110225_c1 | 3300050490 | Bacteria | 1339 |
| 537 | nmdc:mga03n38_140241_c1 | 3300050490 | Bacteria | 1206 |
| 538 | nmdc:mga03n38_152399_c1 | 3300050490 | Bacteria | 1164 |
| 539 | nmdc:mga00v17_114811_c1 | 3300050491 | Bacteria | 1711 |
| 540 | nmdc:mga00v17_44386_c1 | 3300050491 | Bacteria | 2680 |
| 541 | nmdc:mga00v17_93241_c1 | 3300050491 | Bacteria | 1893 |
| 542 | nmdc:mga0yw44_11693_c1 | 3300050492 | Bacteria | 4545 |
| 543 | nmdc:mga0yw44_243591_c1 | 3300050492 | Bacteria | 1196 |
| 544 | nmdc:mga0k408_124922_c1 | 3300050493 | Bacteria | 1526 |
| 545 | nmdc:mga0k408_161149_c1 | 3300050493 | Bacteria | 1337 |
| 546 | nmdc:mga0k408_33345_c1 | 3300050493 | Bacteria | 2945 |
| 547 | nmdc:mga0k408_37301_c1 | 3300050493 | Bacteria | 2790 |
| 548 | nmdc:mga0k408_67221_c1 | 3300050493 | Bacteria | 2089 |
| 549 | nmdc:mga06z11_130566_c1 | 3300050494 | Bacteria | 1411 |
| 550 | nmdc:mga06z11_191815_c1 | 3300050494 | Bacteria | 1183 |
| 551 | nmdc:mga06z11_35955_c1 | 3300050494 | Bacteria | 2441 |
| 552 | nmdc:mga06z11_74027_c1 | 3300050494 | Bacteria | 1810 |
| 553 | nmdc:mga06z11_820207_c1 | 3300050494 | Bacteria | 567 |
| 554 | nmdc:mga04h51_123430_c1 | 3300050495 | Bacteria | 967 |
| 555 | nmdc:mga04h51_22238_c1 | 3300050495 | Bacteria | 1917 |
| 556 | nmdc:mga04h51_90079_c1 | 3300050495 | Bacteria | 1102 |
| 557 | nmdc:mga07m45_31269_c1 | 3300050496 | Bacteria | 2950 |
| 558 | nmdc:mga07m45_555983_c1 | 3300050496 | Bacteria | 664 |
| 559 | nmdc:mga07m45_6469_c1 | 3300050496 | Bacteria | 5924 |
| 560 | nmdc:mga07m45_74294_c1 | 3300050496 | Bacteria | 1937 |
| 561 | nmdc:mga0rr50_789168_c1 | 3300050513 | Bacteria | 810 |
| 562 | nmdc:mga0sz30_109954_c1 | 3300050516 | Bacteria | 1208 |
| 563 | nmdc:mga0sz30_183411_c1 | 3300050516 | Bacteria | 929 |
| 564 | nmdc:mga0sz30_248552_c1 | 3300050516 | Bacteria | 792 |
| 565 | nmdc:mga0sz30_27135_c1 | 3300050516 | Bacteria | 2351 |
| 566 | nmdc:mga0sz30_464763_c1 | 3300050516 | Bacteria | 568 |
| 567 | Ga0495601_0734711 | 3300053077 | Bacteria | 629 |
| 568 | Ga0500610_0002738 | 3300053079 | Bacteria | 6585 |
| 569 | Ga0500610_0143202 | 3300053079 | Bacteria | 1205 |
| 570 | Ga0500610_0244925 | 3300053079 | Bacteria | 831 |
| 571 | Ga0495655_0064872 | 3300053083 | Bacteria | 1006 |
| 572 | Ga0495619_1062312 | 3300053085 | Bacteria | 540 |
| 573 | Ga0500578_0098214 | 3300053086 | Bacteria | 1855 |
| 574 | Ga0500578_0124204 | 3300053086 | Bacteria | 1621 |
| 575 | Ga0500647_0138368 | 3300053091 | Bacteria | 1144 |
| 576 | Ga0500647_0201837 | 3300053091 | Bacteria | 901 |
| 577 | Ga0500583_0023891 | 3300053092 | Bacteria | 2584 |
| 578 | Ga0500583_0026123 | 3300053092 | Bacteria | 2503 |
| 579 | Ga0500651_0012808 | 3300053093 | Bacteria | 5091 |
| 580 | Ga0500651_0141773 | 3300053093 | Bacteria | 1448 |
| 581 | Ga0500566_0158471 | 3300053094 | Bacteria | 1182 |
| 582 | Ga0500640_023004 | 3300053095 | Bacteria | 2697 |
| 583 | Ga0500641_0347308 | 3300053096 | Bacteria | 597 |
| 584 | Ga0500648_338574 | 3300053097 | Bacteria | 625 |
| 585 | Ga0500562_016324 | 3300053108 | Bacteria | 1909 |
| 586 | Ga0500562_034602 | 3300053108 | Bacteria | 1337 |
| 587 | Ga0500569_003017 | 3300053109 | Bacteria | 3384 |
| 588 | Ga0500572_106961 | 3300053111 | Bacteria | 897 |
| 589 | Ga0500595_002634 | 3300053119 | Bacteria | 8733 |
| 590 | Ga0500595_013952 | 3300053119 | Bacteria | 3063 |
| 591 | Ga0500595_032100 | 3300053119 | Bacteria | 1756 |
| 592 | Ga0500607_006049 | 3300053121 | Bacteria | 7752 |
| 593 | Ga0500607_011476 | 3300053121 | Bacteria | 5240 |
| 594 | Ga0500608_161459 | 3300053122 | Bacteria | 970 |
| 595 | Ga0500614_179891 | 3300053123 | Bacteria | 646 |
| 596 | Ga0500642_0010960 | 3300053130 | Bacteria | 3221 |
| 597 | Ga0500642_0030447 | 3300053130 | Bacteria | 2245 |
| 598 | Ga0500652_086492 | 3300053131 | Bacteria | 1307 |
| 599 | Ga0500652_097562 | 3300053131 | Bacteria | 1228 |
| 600 | Ga0500658_0053565 | 3300053134 | Bacteria | 1655 |
| 601 | Ga0500658_0086002 | 3300053134 | Bacteria | 1352 |
| 602 | Ga0500658_0166661 | 3300053134 | Unclassified | 999 |
| 603 | Ga0500658_0258836 | 3300053134 | Bacteria | 800 |
| 604 | Ga0500559_0013563 | 3300053136 | Bacteria | 3449 |
| 605 | Ga0500568_0006793 | 3300053139 | Bacteria | 5703 |
| 606 | Ga0500568_0017833 | 3300053139 | Unclassified | 3123 |
| 607 | Ga0500577_0053208 | 3300053142 | Bacteria | 1529 |
| 608 | Ga0500590_137134 | 3300053148 | Bacteria | 1123 |
| 609 | Ga0500604_0003450 | 3300053151 | Bacteria | 4258 |
| 610 | Ga0500616_0099466 | 3300053153 | Bacteria | 1425 |
| 611 | Ga0500616_0189413 | 3300053153 | Bacteria | 920 |
| 612 | Ga0500619_151015 | 3300053154 | Bacteria | 790 |
| 613 | Ga0500620_020852 | 3300053155 | Bacteria | 1950 |
| 614 | Ga0500622_0210600 | 3300053156 | Unclassified | 878 |
| 615 | Ga0500639_217339 | 3300053163 | Bacteria | 802 |
| 616 | Ga0500636_0000076 | 3300053177 | Bacteria | 48321 |
| 617 | Ga0500611_002748 | 3300053727 | Bacteria | 2155 |
| 618 | Ga0500609_001166 | 3300053731 | Bacteria | 3911 |
| 619 | Ga0500599_002866 | 3300053736 | Bacteria | 2090 |
| 620 | Ga0500587_000134 | 3300053739 | Bacteria | 6898 |
| 621 | Ga0500587_022052 | 3300053739 | Bacteria | 836 |
| 622 | Ga0466962_0001879 | 3300061719 | Bacteria | 9888 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025936 | Ga0207670_10743719 | Ga0207670_107437192 | 120 |
| 2 | iso_pu_bacteria | 2739367756 | 2739792169 | 131 |
| 3 | iso_pu_bacteria | 2643221573 | 2643880920 | 132 |
| 4 | iso_pu_bacteria | 2643221720 | 2644661489 | 132 |
| 5 | iso_pu_bacteria | 2643221728 | 2644699570 | 132 |
| 6 | iso_pu_bacteria | 2791355123 | 2792747245 | 132 |
| 7 | iso_pu_bacteria | 2937822353 | 2937825472 | 132 |
| 8 | 3300041509 | Ga0451843_1372200 | Ga0451843_1372200_43_459 | 133 |
| 9 | iso_pu_bacteria | 2507262055 | 2507510025 | 133 |
| 10 | iso_pu_bacteria | 2511231028 | 2511397575 | 133 |
| 11 | iso_pu_bacteria | 2513237095 | 2513649009 | 133 |
| 12 | iso_pu_bacteria | 2513237164 | 2514039146 | 133 |
| 13 | iso_pu_bacteria | 2517093001 | 2517107520 | 133 |
| 14 | iso_pu_bacteria | 2534681796 | 2535520316 | 133 |
| 15 | iso_pu_bacteria | 2582581866 | 2585392343 | 133 |
| 16 | iso_pu_bacteria | 2585428062 | 2587758282 | 133 |
| 17 | iso_pu_bacteria | 2816332527 | 2818241587 | 133 |
| 18 | iso_pu_bacteria | 2824600985 | 2824605609 | 133 |
| 19 | iso_pu_bacteria | 2824609381 | 2824609859 | 133 |
| 20 | iso_pu_bacteria | 2824653114 | 2824655742 | 133 |
| 21 | iso_pu_bacteria | 2824661429 | 2824669451 | 133 |
| 22 | iso_pu_bacteria | 2831265667 | 2831270382 | 133 |
| 23 | iso_pu_bacteria | 2838054893 | 2838056609 | 133 |
| 24 | iso_pu_bacteria | 2841957949 | 2841959494 | 133 |
| 25 | iso_pu_bacteria | 2849076700 | 2849080683 | 133 |
| 26 | iso_pu_bacteria | 2874168670 | 2874172500 | 133 |
| 27 | iso_pu_bacteria | 2874620515 | 2874623216 | 133 |
| 28 | iso_pu_bacteria | 2874628541 | 2874636036 | 133 |
| 29 | iso_pu_bacteria | 2882632389 | 2882635280 | 133 |
| 30 | iso_pu_bacteria | 2885198086 | 2885199782 | 133 |
| 31 | iso_pu_bacteria | 2885211737 | 2885213433 | 133 |
| 32 | iso_pu_bacteria | 2888378607 | 2888382466 | 133 |
| 33 | iso_pu_bacteria | 2888388044 | 2888388223 | 133 |
| 34 | iso_pu_bacteria | 2888419890 | 2888423046 | 133 |
| 35 | iso_pu_bacteria | 2894414249 | 2894417003 | 133 |
| 36 | iso_pu_bacteria | 2904666416 | 2904670036 | 133 |
| 37 | iso_pu_bacteria | 2928037797 | 2928038247 | 133 |
| 38 | iso_pu_bacteria | 2928044640 | 2928046148 | 133 |
| 39 | iso_pu_bacteria | 2928051484 | 2928053843 | 133 |
| 40 | iso_pu_bacteria | 2928521798 | 2928526130 | 133 |
| 41 | iso_pu_bacteria | 2932794094 | 2932797325 | 133 |
| 42 | iso_pu_bacteria | 2932801729 | 2932804790 | 133 |
| 43 | iso_pu_bacteria | 2935616580 | 2935619022 | 133 |
| 44 | iso_pu_bacteria | 2935638405 | 2935643161 | 133 |
| 45 | iso_pu_bacteria | 2935665750 | 2935669787 | 133 |
| 46 | iso_pu_bacteria | 2935675223 | 2935677073 | 133 |
| 47 | iso_pu_bacteria | 2935684952 | 2935693112 | 133 |
| 48 | iso_pu_bacteria | 2935713505 | 2935719720 | 133 |
| 49 | iso_pu_bacteria | 2935722832 | 2935729513 | 133 |
| 50 | iso_pu_bacteria | 2935732158 | 2935739603 | 133 |
| 51 | iso_pu_bacteria | 2935741537 | 2935748641 | 133 |
| 52 | iso_pu_bacteria | 2935750917 | 2935756772 | 133 |
| 53 | iso_pu_bacteria | 2935827899 | 2935832695 | 133 |
| 54 | iso_pu_bacteria | 2935837841 | 2935839226 | 133 |
| 55 | iso_pu_bacteria | 2935855204 | 2935857387 | 133 |
| 56 | iso_pu_bacteria | 2935864058 | 2935864916 | 133 |
| 57 | iso_pu_bacteria | 2935873716 | 2935876694 | 133 |
| 58 | iso_pu_bacteria | 2935883170 | 2935884974 | 133 |
| 59 | iso_pu_bacteria | 2935992306 | 2935998955 | 133 |
| 60 | iso_pu_bacteria | 2940556831 | 2940562686 | 133 |
| 61 | iso_pu_bacteria | 2941538514 | 2941539916 | 133 |
| 62 | iso_pu_bacteria | 2954011201 | 2954014972 | 133 |
| 63 | iso_pu_bacteria | 8005542996 | 8005548060 | 133 |
| 64 | iso_pu_bacteria | 2954767861 | 2954771846 | 134 |
| 65 | iso_pu_bacteria | 2818991446 | 2819596271 | 135 |
| 66 | iso_pu_bacteria | 2899924645 | 2899925652 | 135 |
| 67 | iso_pu_bacteria | 2928064002 | 2928067390 | 135 |
| 68 | 3300005262 | Ga0065165_1000278 | Ga0065165_100027846 | 136 |
| 69 | 3300005548 | Ga0070665_100031156 | Ga0070665_1000311564 | 136 |
| 70 | 3300006038 | Ga0075365_10202781 | Ga0075365_102027812 | 136 |
| 71 | 3300013104 | Ga0157370_10754424 | Ga0157370_107544241 | 136 |
| 72 | 3300025302 | Ga0207426_1054138 | Ga0207426_10541382 | 136 |
| 73 | 3300028379 | Ga0268266_10008473 | Ga0268266_100084739 | 136 |
| 74 | 3300030522 | Ga0307512_10099062 | Ga0307512_100990623 | 136 |
| 75 | 3300031901 | Ga0307406_10499334 | Ga0307406_104993342 | 136 |
| 76 | 3300044656 | Ga0466969_0001480 | Ga0466969_0001480_704_1114 | 136 |
| 77 | 3300044656 | Ga0466969_0004808 | Ga0466969_0004808_557_967 | 136 |
| 78 | 3300044684 | Ga0466966_0023654 | Ga0466966_0023654_3234_3644 | 136 |
| 79 | 3300044693 | Ga0466961_0008103 | Ga0466961_0008103_5926_6336 | 136 |
| 80 | 3300044693 | Ga0466961_0211955 | Ga0466961_0211955_519_929 | 136 |
| 81 | 3300044694 | Ga0466963_0356664 | Ga0466963_0356664_68_478 | 136 |
| 82 | 3300044719 | Ga0466971_0000095 | Ga0466971_0000095_30004_30414 | 136 |
| 83 | 3300044765 | Ga0466970_0395994 | Ga0466970_0395994_355_765 | 136 |
| 84 | 3300044842 | Ga0466957_0005130 | Ga0466957_0005130_6788_7198 | 136 |
| 85 | 3300045049 | Ga0466959_0000240 | Ga0466959_0000240_5371_5781 | 136 |
| 86 | 3300045836 | Ga0466958_0000923 | Ga0466958_0000923_350_760 | 136 |
| 87 | 3300046457 | Ga0495590_0105262 | Ga0495590_0105262_116_526 | 136 |
| 88 | 3300046460 | Ga0495638_0080378 | Ga0495638_0080378_1450_1863 | 136 |
| 89 | 3300046460 | Ga0495638_0249562 | Ga0495638_0249562_432_842 | 136 |
| 90 | 3300047472 | Ga0495686_0102336 | Ga0495686_0102336_1058_1471 | 136 |
| 91 | 3300048905 | Ga0496102_1195943 | Ga0496102_1195943_88_501 | 136 |
| 92 | 3300048918 | Ga0496115_0560678 | Ga0496115_0560678_53_466 | 136 |
| 93 | 3300053083 | Ga0495655_0064872 | Ga0495655_0064872_159_572 | 136 |
| 94 | 3300053086 | Ga0500578_0098214 | Ga0500578_0098214_1130_1540 | 136 |
| 95 | 3300053093 | Ga0500651_0012808 | Ga0500651_0012808_514_924 | 136 |
| 96 | 3300053108 | Ga0500562_016324 | Ga0500562_016324_1049_1462 | 136 |
| 97 | 3300053108 | Ga0500562_034602 | Ga0500562_034602_843_1253 | 136 |
| 98 | 3300053119 | Ga0500595_002634 | Ga0500595_002634_4435_4845 | 136 |
| 99 | 3300053130 | Ga0500642_0010960 | Ga0500642_0010960_237_647 | 136 |
| 100 | 3300053130 | Ga0500642_0030447 | Ga0500642_0030447_1053_1463 | 136 |
| 101 | 3300053131 | Ga0500652_097562 | Ga0500652_097562_361_771 | 136 |
| 102 | 3300053134 | Ga0500658_0053565 | Ga0500658_0053565_1153_1563 | 136 |
| 103 | 3300053134 | Ga0500658_0166661 | Ga0500658_0166661_171_581 | 136 |
| 104 | 3300053134 | Ga0500658_0258836 | Ga0500658_0258836_48_458 | 136 |
| 105 | 3300053139 | Ga0500568_0017833 | Ga0500568_0017833_2412_2822 | 136 |
| 106 | 3300053142 | Ga0500577_0053208 | Ga0500577_0053208_261_671 | 136 |
| 107 | 3300053151 | Ga0500604_0003450 | Ga0500604_0003450_578_988 | 136 |
| 108 | 3300053153 | Ga0500616_0099466 | Ga0500616_0099466_940_1350 | 136 |
| 109 | 3300053156 | Ga0500622_0210600 | Ga0500622_0210600_164_574 | 136 |
| 110 | 3300053731 | Ga0500609_001166 | Ga0500609_001166_1786_2196 | 136 |
| 111 | 3300053736 | Ga0500599_002866 | Ga0500599_002866_1486_1896 | 136 |
| 112 | 3300053739 | Ga0500587_022052 | Ga0500587_022052_190_600 | 136 |
| 113 | 3300061719 | Ga0466962_0001879 | Ga0466962_0001879_8998_9408 | 136 |
| 114 | 2162886012 | MBSR1b_contig_5120920 | MBSR1b_0061.00007640 | 137 |
| 115 | 3300002773 | JGI25152J39213_1000902 | JGI25152J39213_100090218 | 137 |
| 116 | 3300002774 | JGI25150J39212_1000529 | JGI25150J39212_100052918 | 137 |
| 117 | 3300002987 | JGI25159J45721_1000714 | JGI25159J45721_10007144 | 137 |
| 118 | 3300002987 | JGI25159J45721_1015530 | JGI25159J45721_10155303 | 137 |
| 119 | 3300003187 | JGI25151J46595_10001672 | JGI25151J46595_1000167218 | 137 |
| 120 | 3300003215 | JGI25153J46596_10001378 | JGI25153J46596_1000137818 | 137 |
| 121 | 3300003316 | rootH1_10084038 | rootH1_100840382 | 137 |
| 122 | 3300003354 | JGI25160J50197_1000504 | JGI25160J50197_100050414 | 137 |
| 123 | 3300003354 | JGI25160J50197_1001019 | JGI25160J50197_100101918 | 137 |
| 124 | 3300003354 | JGI25160J50197_1016594 | JGI25160J50197_10165942 | 137 |
| 125 | 3300003374 | JGI25161J50226_1001946 | JGI25161J50226_10019466 | 137 |
| 126 | 3300003374 | JGI25161J50226_1007453 | JGI25161J50226_10074532 | 137 |
| 127 | 3300003752 | Ga0055539_1023106 | Ga0055539_10231061 | 137 |
| 128 | 3300003761 | Ga0055535_1000544 | Ga0055535_100054427 | 137 |
| 129 | 3300003762 | Ga0055542_1000004 | Ga0055542_1000004479 | 137 |
| 130 | 3300003771 | Ga0055526_1001885 | Ga0055526_100188518 | 137 |
| 131 | 3300003771 | Ga0055526_1020268 | Ga0055526_10202684 | 137 |
| 132 | 3300003773 | Ga0055537_1000532 | Ga0055537_100053218 | 137 |
| 133 | 3300003773 | Ga0055537_1021503 | Ga0055537_10215032 | 137 |
| 134 | 3300003775 | Ga0055524_1001312 | Ga0055524_100131218 | 137 |
| 135 | 3300003775 | Ga0055524_1003577 | Ga0055524_10035773 | 137 |
| 136 | 3300003775 | Ga0055524_1008003 | Ga0055524_10080034 | 137 |
| 137 | 3300003781 | Ga0055536_1001009 | Ga0055536_100100912 | 137 |
| 138 | 3300003784 | Ga0055534_1000806 | Ga0055534_100080618 | 137 |
| 139 | 3300003784 | Ga0055534_1006267 | Ga0055534_10062672 | 137 |
| 140 | 3300003790 | Ga0055528_1000780 | Ga0055528_100078018 | 137 |
| 141 | 3300003790 | Ga0055528_1016555 | Ga0055528_10165554 | 137 |
| 142 | 3300003791 | Ga0055530_10000730 | Ga0055530_1000073012 | 137 |
| 143 | 3300003791 | Ga0055530_10001183 | Ga0055530_1000118315 | 137 |
| 144 | 3300003792 | Ga0055540_1001469 | Ga0055540_10014696 | 137 |
| 145 | 3300003792 | Ga0055540_1005496 | Ga0055540_10054966 | 137 |
| 146 | 3300003794 | Ga0055531_10002619 | Ga0055531_100026194 | 137 |
| 147 | 3300003794 | Ga0055531_10008256 | Ga0055531_100082564 | 137 |
| 148 | 3300004625 | Ga0055543_1000702 | Ga0055543_100070212 | 137 |
| 149 | 3300004625 | Ga0055543_1001310 | Ga0055543_10013107 | 137 |
| 150 | 3300005262 | Ga0065165_1002519 | Ga0065165_10025194 | 137 |
| 151 | 3300005262 | Ga0065165_1016865 | Ga0065165_10168653 | 137 |
| 152 | 3300005262 | Ga0065165_1024980 | Ga0065165_10249802 | 137 |
| 153 | 3300005288 | Ga0065714_10404806 | Ga0065714_104048061 | 137 |
| 154 | 3300005293 | Ga0065715_10136549 | Ga0065715_101365494 | 137 |
| 155 | 3300005327 | Ga0070658_10005436 | Ga0070658_100054366 | 137 |
| 156 | 3300005328 | Ga0070676_10067141 | Ga0070676_100671414 | 137 |
| 157 | 3300005331 | Ga0070670_100061462 | Ga0070670_1000614621 | 137 |
| 158 | 3300005331 | Ga0070670_100065897 | Ga0070670_1000658973 | 137 |
| 159 | 3300005331 | Ga0070670_100136746 | Ga0070670_1001367462 | 137 |
| 160 | 3300005333 | Ga0070677_10011531 | Ga0070677_100115314 | 137 |
| 161 | 3300005334 | Ga0068869_100367635 | Ga0068869_1003676352 | 137 |
| 162 | 3300005334 | Ga0068869_101690182 | Ga0068869_1016901821 | 137 |
| 163 | 3300005335 | Ga0070666_10000008 | Ga0070666_1000000885 | 137 |
| 164 | 3300005344 | Ga0070661_100013390 | Ga0070661_1000133902 | 137 |
| 165 | 3300005347 | Ga0070668_100026997 | Ga0070668_1000269974 | 137 |
| 166 | 3300005347 | Ga0070668_100787774 | Ga0070668_1007877742 | 137 |
| 167 | 3300005347 | Ga0070668_101231803 | Ga0070668_1012318031 | 137 |
| 168 | 3300005353 | Ga0070669_100022638 | Ga0070669_1000226384 | 137 |
| 169 | 3300005353 | Ga0070669_100118587 | Ga0070669_1001185872 | 137 |
| 170 | 3300005354 | Ga0070675_100000730 | Ga0070675_1000007306 | 137 |
| 171 | 3300005355 | Ga0070671_100002821 | Ga0070671_10000282113 | 137 |
| 172 | 3300005355 | Ga0070671_100034351 | Ga0070671_1000343512 | 137 |
| 173 | 3300005355 | Ga0070671_100234860 | Ga0070671_1002348603 | 137 |
| 174 | 3300005355 | Ga0070671_100781906 | Ga0070671_1007819061 | 137 |
| 175 | 3300005356 | Ga0070674_101268572 | Ga0070674_1012685721 | 137 |
| 176 | 3300005364 | Ga0070673_100016466 | Ga0070673_1000164665 | 137 |
| 177 | 3300005364 | Ga0070673_100087038 | Ga0070673_1000870383 | 137 |
| 178 | 3300005364 | Ga0070673_100429956 | Ga0070673_1004299562 | 137 |
| 179 | 3300005367 | Ga0070667_100023464 | Ga0070667_1000234644 | 137 |
| 180 | 3300005367 | Ga0070667_100035512 | Ga0070667_1000355125 | 137 |
| 181 | 3300005367 | Ga0070667_100230615 | Ga0070667_1002306153 | 137 |
| 182 | 3300005367 | Ga0070667_100412982 | Ga0070667_1004129821 | 137 |
| 183 | 3300005367 | Ga0070667_100457391 | Ga0070667_1004573912 | 137 |
| 184 | 3300005367 | Ga0070667_100701117 | Ga0070667_1007011172 | 137 |
| 185 | 3300005367 | Ga0070667_101396241 | Ga0070667_1013962411 | 137 |
| 186 | 3300005367 | Ga0070667_101416414 | Ga0070667_1014164141 | 137 |
| 187 | 3300005445 | Ga0070708_100173250 | Ga0070708_1001732504 | 137 |
| 188 | 3300005445 | Ga0070708_100289057 | Ga0070708_1002890573 | 137 |
| 189 | 3300005455 | Ga0070663_100003812 | Ga0070663_1000038129 | 137 |
| 190 | 3300005456 | Ga0070678_100011111 | Ga0070678_1000111115 | 137 |
| 191 | 3300005457 | Ga0070662_100224876 | Ga0070662_1002248762 | 137 |
| 192 | 3300005457 | Ga0070662_100403870 | Ga0070662_1004038702 | 137 |
| 193 | 3300005459 | Ga0068867_100001685 | Ga0068867_1000016856 | 137 |
| 194 | 3300005459 | Ga0068867_100020669 | Ga0068867_1000206696 | 137 |
| 195 | 3300005459 | Ga0068867_100243945 | Ga0068867_1002439453 | 137 |
| 196 | 3300005467 | Ga0070706_100000297 | Ga0070706_10000029728 | 137 |
| 197 | 3300005468 | Ga0070707_100016306 | Ga0070707_1000163065 | 137 |
| 198 | 3300005471 | Ga0070698_100156206 | Ga0070698_1001562065 | 137 |
| 199 | 3300005536 | Ga0070697_101469464 | Ga0070697_1014694642 | 137 |
| 200 | 3300005539 | Ga0068853_100001340 | Ga0068853_1000013406 | 137 |
| 201 | 3300005539 | Ga0068853_100059971 | Ga0068853_1000599712 | 137 |
| 202 | 3300005539 | Ga0068853_100398065 | Ga0068853_1003980652 | 137 |
| 203 | 3300005543 | Ga0070672_100000424 | Ga0070672_1000004244 | 137 |
| 204 | 3300005548 | Ga0070665_100009026 | Ga0070665_1000090266 | 137 |
| 205 | 3300005548 | Ga0070665_100363659 | Ga0070665_1003636593 | 137 |
| 206 | 3300005548 | Ga0070665_100687013 | Ga0070665_1006870132 | 137 |
| 207 | 3300005548 | Ga0070665_100841690 | Ga0070665_1008416901 | 137 |
| 208 | 3300005548 | Ga0070665_100932919 | Ga0070665_1009329192 | 137 |
| 209 | 3300005563 | Ga0068855_100123638 | Ga0068855_1001236382 | 137 |
| 210 | 3300005563 | Ga0068855_100150995 | Ga0068855_1001509953 | 137 |
| 211 | 3300005564 | Ga0070664_100096689 | Ga0070664_1000966894 | 137 |
| 212 | 3300005564 | Ga0070664_100457789 | Ga0070664_1004577892 | 137 |
| 213 | 3300005564 | Ga0070664_101272953 | Ga0070664_1012729531 | 137 |
| 214 | 3300005577 | Ga0068857_100018893 | Ga0068857_1000188938 | 137 |
| 215 | 3300005577 | Ga0068857_100285909 | Ga0068857_1002859092 | 137 |
| 216 | 3300005577 | Ga0068857_100763917 | Ga0068857_1007639172 | 137 |
| 217 | 3300005578 | Ga0068854_100073055 | Ga0068854_1000730552 | 137 |
| 218 | 3300005578 | Ga0068854_100649103 | Ga0068854_1006491032 | 137 |
| 219 | 3300005614 | Ga0068856_100482528 | Ga0068856_1004825282 | 137 |
| 220 | 3300005614 | Ga0068856_101101422 | Ga0068856_1011014222 | 137 |
| 221 | 3300005616 | Ga0068852_100045272 | Ga0068852_1000452722 | 137 |
| 222 | 3300005616 | Ga0068852_100172206 | Ga0068852_1001722063 | 137 |
| 223 | 3300005617 | Ga0068859_100538291 | Ga0068859_1005382912 | 137 |
| 224 | 3300005618 | Ga0068864_100022500 | Ga0068864_1000225004 | 137 |
| 225 | 3300005618 | Ga0068864_100240584 | Ga0068864_1002405843 | 137 |
| 226 | 3300005718 | Ga0068866_10043543 | Ga0068866_100435432 | 137 |
| 227 | 3300005719 | Ga0068861_100009698 | Ga0068861_1000096986 | 137 |
| 228 | 3300005834 | Ga0068851_10014519 | Ga0068851_100145193 | 137 |
| 229 | 3300005834 | Ga0068851_10111571 | Ga0068851_101115713 | 137 |
| 230 | 3300005841 | Ga0068863_100276597 | Ga0068863_1002765972 | 137 |
| 231 | 3300005841 | Ga0068863_101031522 | Ga0068863_1010315222 | 137 |
| 232 | 3300005841 | Ga0068863_102127948 | Ga0068863_1021279481 | 137 |
| 233 | 3300005842 | Ga0068858_100252152 | Ga0068858_1002521522 | 137 |
| 234 | 3300005843 | Ga0068860_100134545 | Ga0068860_1001345452 | 137 |
| 235 | 3300005843 | Ga0068860_100262900 | Ga0068860_1002629001 | 137 |
| 236 | 3300005843 | Ga0068860_100304562 | Ga0068860_1003045621 | 137 |
| 237 | 3300005843 | Ga0068860_101225147 | Ga0068860_1012251472 | 137 |
| 238 | 3300005844 | Ga0068862_100114031 | Ga0068862_1001140313 | 137 |
| 239 | 3300005844 | Ga0068862_100177327 | Ga0068862_1001773272 | 137 |
| 240 | 3300005937 | Ga0081455_10779102 | Ga0081455_107791021 | 137 |
| 241 | 3300006038 | Ga0075365_10039463 | Ga0075365_100394634 | 137 |
| 242 | 3300006038 | Ga0075365_10052571 | Ga0075365_100525711 | 137 |
| 243 | 3300006038 | Ga0075365_10239282 | Ga0075365_102392822 | 137 |
| 244 | 3300006042 | Ga0075368_10007174 | Ga0075368_100071746 | 137 |
| 245 | 3300006042 | Ga0075368_10119702 | Ga0075368_101197022 | 137 |
| 246 | 3300006048 | Ga0075363_100001650 | Ga0075363_10000165010 | 137 |
| 247 | 3300006048 | Ga0075363_100373831 | Ga0075363_1003738311 | 137 |
| 248 | 3300006051 | Ga0075364_10160045 | Ga0075364_101600454 | 137 |
| 249 | 3300006051 | Ga0075364_10218217 | Ga0075364_102182172 | 137 |
| 250 | 3300006051 | Ga0075364_10243112 | Ga0075364_102431122 | 137 |
| 251 | 3300006051 | Ga0075364_10869892 | Ga0075364_108698921 | 137 |
| 252 | 3300006177 | Ga0075362_10002752 | Ga0075362_100027524 | 137 |
| 253 | 3300006177 | Ga0075362_10056719 | Ga0075362_100567192 | 137 |
| 254 | 3300006177 | Ga0075362_10589839 | Ga0075362_105898391 | 137 |
| 255 | 3300006178 | Ga0075367_10054447 | Ga0075367_100544472 | 137 |
| 256 | 3300006178 | Ga0075367_10111355 | Ga0075367_101113554 | 137 |
| 257 | 3300006178 | Ga0075367_10116181 | Ga0075367_101161813 | 137 |
| 258 | 3300006178 | Ga0075367_10125088 | Ga0075367_101250882 | 137 |
| 259 | 3300006178 | Ga0075367_10142242 | Ga0075367_101422422 | 137 |
| 260 | 3300006178 | Ga0075367_10217764 | Ga0075367_102177642 | 137 |
| 261 | 3300006178 | Ga0075367_10936405 | Ga0075367_109364051 | 137 |
| 262 | 3300006186 | Ga0075369_10172125 | Ga0075369_101721252 | 137 |
| 263 | 3300006186 | Ga0075369_10184095 | Ga0075369_101840952 | 137 |
| 264 | 3300006195 | Ga0075366_10024798 | Ga0075366_100247984 | 137 |
| 265 | 3300006195 | Ga0075366_10035548 | Ga0075366_100355482 | 137 |
| 266 | 3300006195 | Ga0075366_10169770 | Ga0075366_101697703 | 137 |
| 267 | 3300006237 | Ga0097621_100004522 | Ga0097621_1000045222 | 137 |
| 268 | 3300006237 | Ga0097621_100954044 | Ga0097621_1009540442 | 137 |
| 269 | 3300006353 | Ga0075370_10004005 | Ga0075370_100040054 | 137 |
| 270 | 3300006353 | Ga0075370_10051002 | Ga0075370_100510024 | 137 |
| 271 | 3300006353 | Ga0075370_10112829 | Ga0075370_101128293 | 137 |
| 272 | 3300006358 | Ga0068871_100027319 | Ga0068871_1000273194 | 137 |
| 273 | 3300006358 | Ga0068871_101506224 | Ga0068871_1015062241 | 137 |
| 274 | 3300006931 | Ga0097620_100538283 | Ga0097620_1005382832 | 137 |
| 275 | 3300006942 | Ga0099824_1016622 | Ga0099824_10166228 | 137 |
| 276 | 3300009092 | Ga0105250_10168069 | Ga0105250_101680692 | 137 |
| 277 | 3300009093 | Ga0105240_10024486 | Ga0105240_100244865 | 137 |
| 278 | 3300009093 | Ga0105240_10294803 | Ga0105240_102948032 | 137 |
| 279 | 3300009093 | Ga0105240_10361675 | Ga0105240_103616752 | 137 |
| 280 | 3300009098 | Ga0105245_10136564 | Ga0105245_101365642 | 137 |
| 281 | 3300009098 | Ga0105245_12248933 | Ga0105245_122489331 | 137 |
| 282 | 3300009101 | Ga0105247_10123462 | Ga0105247_101234622 | 137 |
| 283 | 3300009101 | Ga0105247_10573530 | Ga0105247_105735302 | 137 |
| 284 | 3300009148 | Ga0105243_10048008 | Ga0105243_100480084 | 137 |
| 285 | 3300009148 | Ga0105243_10256053 | Ga0105243_102560532 | 137 |
| 286 | 3300009174 | Ga0105241_10089422 | Ga0105241_100894222 | 137 |
| 287 | 3300009174 | Ga0105241_10281550 | Ga0105241_102815502 | 137 |
| 288 | 3300009177 | Ga0105248_10099852 | Ga0105248_100998522 | 137 |
| 289 | 3300009177 | Ga0105248_11194399 | Ga0105248_111943992 | 137 |
| 290 | 3300009545 | Ga0105237_10001770 | Ga0105237_1000177023 | 137 |
| 291 | 3300009545 | Ga0105237_10035674 | Ga0105237_100356744 | 137 |
| 292 | 3300009545 | Ga0105237_10342649 | Ga0105237_103426493 | 137 |
| 293 | 3300009545 | Ga0105237_11699223 | Ga0105237_116992231 | 137 |
| 294 | 3300009551 | Ga0105238_10000178 | Ga0105238_1000017816 | 137 |
| 295 | 3300009553 | Ga0105249_10154357 | Ga0105249_101543572 | 137 |
| 296 | 3300010375 | Ga0105239_10089934 | Ga0105239_100899343 | 137 |
| 297 | 3300010375 | Ga0105239_10233941 | Ga0105239_102339412 | 137 |
| 298 | 3300010375 | Ga0105239_10238225 | Ga0105239_102382251 | 137 |
| 299 | 3300010375 | Ga0105239_11163119 | Ga0105239_111631192 | 137 |
| 300 | 3300010375 | Ga0105239_11571551 | Ga0105239_115715512 | 137 |
| 301 | 3300011119 | Ga0105246_10041441 | Ga0105246_100414412 | 137 |
| 302 | 3300012502 | Ga0157347_1024357 | Ga0157347_10243572 | 137 |
| 303 | 3300013100 | Ga0157373_10926955 | Ga0157373_109269551 | 137 |
| 304 | 3300013102 | Ga0157371_10018923 | Ga0157371_100189235 | 137 |
| 305 | 3300013102 | Ga0157371_10948339 | Ga0157371_109483391 | 137 |
| 306 | 3300013105 | Ga0157369_10003369 | Ga0157369_1000336917 | 137 |
| 307 | 3300013296 | Ga0157374_10051371 | Ga0157374_100513713 | 137 |
| 308 | 3300013297 | Ga0157378_10763151 | Ga0157378_107631512 | 137 |
| 309 | 3300013306 | Ga0163162_10000110 | Ga0163162_100001105 | 137 |
| 310 | 3300013306 | Ga0163162_10210147 | Ga0163162_102101471 | 137 |
| 311 | 3300013306 | Ga0163162_10752281 | Ga0163162_107522812 | 137 |
| 312 | 3300013306 | Ga0163162_12338517 | Ga0163162_123385172 | 137 |
| 313 | 3300013307 | Ga0157372_10113515 | Ga0157372_101135154 | 137 |
| 314 | 3300013308 | Ga0157375_10028467 | Ga0157375_100284672 | 137 |
| 315 | 3300013308 | Ga0157375_10036930 | Ga0157375_100369302 | 137 |
| 316 | 3300014325 | Ga0163163_10138673 | Ga0163163_101386733 | 137 |
| 317 | 3300014325 | Ga0163163_10361097 | Ga0163163_103610972 | 137 |
| 318 | 3300014497 | Ga0182008_10654775 | Ga0182008_106547751 | 137 |
| 319 | 3300014968 | Ga0157379_10172435 | Ga0157379_101724352 | 137 |
| 320 | 3300014968 | Ga0157379_11789756 | Ga0157379_117897561 | 137 |
| 321 | 3300014969 | Ga0157376_10026499 | Ga0157376_100264993 | 137 |
| 322 | 3300014969 | Ga0157376_10104600 | Ga0157376_101046002 | 137 |
| 323 | 3300014969 | Ga0157376_11968383 | Ga0157376_119683831 | 137 |
| 324 | 3300017792 | Ga0163161_10014561 | Ga0163161_100145614 | 137 |
| 325 | 3300025208 | Ga0209436_101892 | Ga0209436_1018924 | 137 |
| 326 | 3300025208 | Ga0209436_105876 | Ga0209436_1058764 | 137 |
| 327 | 3300025228 | Ga0209672_100230 | Ga0209672_1002303 | 137 |
| 328 | 3300025242 | Ga0209258_100022 | Ga0209258_100022479 | 137 |
| 329 | 3300025245 | Ga0207425_1000392 | Ga0207425_100039221 | 137 |
| 330 | 3300025245 | Ga0207425_1002099 | Ga0207425_10020997 | 137 |
| 331 | 3300025245 | Ga0207425_1063360 | Ga0207425_10633601 | 137 |
| 332 | 3300025253 | Ga0209677_114264 | Ga0209677_1142641 | 137 |
| 333 | 3300025253 | Ga0209677_123473 | Ga0209677_1234731 | 137 |
| 334 | 3300025254 | Ga0209148_1000034 | Ga0209148_1000034479 | 137 |
| 335 | 3300025254 | Ga0209148_1027039 | Ga0209148_10270391 | 137 |
| 336 | 3300025258 | Ga0209129_1000111 | Ga0209129_100011135 | 137 |
| 337 | 3300025258 | Ga0209129_1009569 | Ga0209129_10095693 | 137 |
| 338 | 3300025261 | Ga0209233_1002734 | Ga0209233_10027342 | 137 |
| 339 | 3300025263 | Ga0209565_1000146 | Ga0209565_100014643 | 137 |
| 340 | 3300025263 | Ga0209565_1007086 | Ga0209565_10070862 | 137 |
| 341 | 3300025273 | Ga0209673_1001463 | Ga0209673_100146318 | 137 |
| 342 | 3300025273 | Ga0209673_1003920 | Ga0209673_10039202 | 137 |
| 343 | 3300025273 | Ga0209673_1079023 | Ga0209673_10790231 | 137 |
| 344 | 3300025284 | Ga0209130_1000470 | Ga0209130_100047025 | 137 |
| 345 | 3300025284 | Ga0209130_1000492 | Ga0209130_100049215 | 137 |
| 346 | 3300025284 | Ga0209130_1004038 | Ga0209130_10040385 | 137 |
| 347 | 3300025291 | Ga0209675_1000331 | Ga0209675_100033122 | 137 |
| 348 | 3300025291 | Ga0209675_1010206 | Ga0209675_10102062 | 137 |
| 349 | 3300025291 | Ga0209675_1010601 | Ga0209675_10106012 | 137 |
| 350 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005221 | 137 |
| 351 | 3300025294 | Ga0209025_1000116 | Ga0209025_100011643 | 137 |
| 352 | 3300025295 | Ga0209564_1000155 | Ga0209564_100015543 | 137 |
| 353 | 3300025295 | Ga0209564_1000292 | Ga0209564_100029276 | 137 |
| 354 | 3300025295 | Ga0209564_1050065 | Ga0209564_10500652 | 137 |
| 355 | 3300025297 | Ga0209758_1000107 | Ga0209758_100010743 | 137 |
| 356 | 3300025297 | Ga0209758_1000560 | Ga0209758_100056017 | 137 |
| 357 | 3300025297 | Ga0209758_1014068 | Ga0209758_10140684 | 137 |
| 358 | 3300025297 | Ga0209758_1023566 | Ga0209758_10235663 | 137 |
| 359 | 3300025297 | Ga0209758_1031638 | Ga0209758_10316383 | 137 |
| 360 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007876 | 137 |
| 361 | 3300025299 | Ga0209256_1000038 | Ga0209256_100003881 | 137 |
| 362 | 3300025299 | Ga0209256_1000087 | Ga0209256_100008743 | 137 |
| 363 | 3300025302 | Ga0207426_1000090 | Ga0207426_100009032 | 137 |
| 364 | 3300025302 | Ga0207426_1000123 | Ga0207426_100012343 | 137 |
| 365 | 3300025302 | Ga0207426_1000721 | Ga0207426_100072113 | 137 |
| 366 | 3300025302 | Ga0207426_1002233 | Ga0207426_10022336 | 137 |
| 367 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009221 | 137 |
| 368 | 3300025303 | Ga0209051_1004594 | Ga0209051_10045948 | 137 |
| 369 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011195 | 137 |
| 370 | 3300025304 | Ga0209257_1001961 | Ga0209257_100196118 | 137 |
| 371 | 3300025304 | Ga0209257_1021240 | Ga0209257_10212402 | 137 |
| 372 | 3300025315 | Ga0207697_10010315 | Ga0207697_100103152 | 137 |
| 373 | 3300025321 | Ga0207656_10024934 | Ga0207656_100249341 | 137 |
| 374 | 3300025893 | Ga0207682_10003155 | Ga0207682_100031557 | 137 |
| 375 | 3300025900 | Ga0207710_10129595 | Ga0207710_101295951 | 137 |
| 376 | 3300025901 | Ga0207688_10133648 | Ga0207688_101336482 | 137 |
| 377 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005151 | 137 |
| 378 | 3300025904 | Ga0207647_10011713 | Ga0207647_100117136 | 137 |
| 379 | 3300025907 | Ga0207645_10026326 | Ga0207645_100263264 | 137 |
| 380 | 3300025907 | Ga0207645_10298781 | Ga0207645_102987811 | 137 |
| 381 | 3300025908 | Ga0207643_10004555 | Ga0207643_100045552 | 137 |
| 382 | 3300025909 | Ga0207705_10023654 | Ga0207705_100236543 | 137 |
| 383 | 3300025909 | Ga0207705_10027327 | Ga0207705_100273273 | 137 |
| 384 | 3300025910 | Ga0207684_10005581 | Ga0207684_100055818 | 137 |
| 385 | 3300025911 | Ga0207654_10050199 | Ga0207654_100501994 | 137 |
| 386 | 3300025911 | Ga0207654_10811583 | Ga0207654_108115831 | 137 |
| 387 | 3300025913 | Ga0207695_10070556 | Ga0207695_100705562 | 137 |
| 388 | 3300025913 | Ga0207695_10135301 | Ga0207695_101353012 | 137 |
| 389 | 3300025914 | Ga0207671_10082541 | Ga0207671_100825412 | 137 |
| 390 | 3300025914 | Ga0207671_10107312 | Ga0207671_101073123 | 137 |
| 391 | 3300025914 | Ga0207671_11133110 | Ga0207671_111331101 | 137 |
| 392 | 3300025919 | Ga0207657_10135966 | Ga0207657_101359663 | 137 |
| 393 | 3300025920 | Ga0207649_10016493 | Ga0207649_100164936 | 137 |
| 394 | 3300025920 | Ga0207649_10054356 | Ga0207649_100543562 | 137 |
| 395 | 3300025920 | Ga0207649_11078196 | Ga0207649_110781961 | 137 |
| 396 | 3300025922 | Ga0207646_10800759 | Ga0207646_108007592 | 137 |
| 397 | 3300025923 | Ga0207681_10204591 | Ga0207681_102045912 | 137 |
| 398 | 3300025924 | Ga0207694_10000187 | Ga0207694_100001877 | 137 |
| 399 | 3300025925 | Ga0207650_10001814 | Ga0207650_1000181413 | 137 |
| 400 | 3300025925 | Ga0207650_10159196 | Ga0207650_101591963 | 137 |
| 401 | 3300025926 | Ga0207659_10000544 | Ga0207659_100005443 | 137 |
| 402 | 3300025927 | Ga0207687_10011700 | Ga0207687_100117002 | 137 |
| 403 | 3300025927 | Ga0207687_11439329 | Ga0207687_114393291 | 137 |
| 404 | 3300025931 | Ga0207644_10009377 | Ga0207644_100093772 | 137 |
| 405 | 3300025931 | Ga0207644_10184661 | Ga0207644_101846613 | 137 |
| 406 | 3300025932 | Ga0207690_10800956 | Ga0207690_108009562 | 137 |
| 407 | 3300025933 | Ga0207706_10093896 | Ga0207706_100938961 | 137 |
| 408 | 3300025933 | Ga0207706_10155947 | Ga0207706_101559473 | 137 |
| 409 | 3300025933 | Ga0207706_10766204 | Ga0207706_107662042 | 137 |
| 410 | 3300025935 | Ga0207709_10040458 | Ga0207709_100404584 | 137 |
| 411 | 3300025935 | Ga0207709_10730037 | Ga0207709_107300372 | 137 |
| 412 | 3300025937 | Ga0207669_11845511 | Ga0207669_118455111 | 137 |
| 413 | 3300025940 | Ga0207691_10000186 | Ga0207691_1000018625 | 137 |
| 414 | 3300025941 | Ga0207711_10123427 | Ga0207711_101234272 | 137 |
| 415 | 3300025942 | Ga0207689_10099054 | Ga0207689_100990542 | 137 |
| 416 | 3300025942 | Ga0207689_10102890 | Ga0207689_101028904 | 137 |
| 417 | 3300025942 | Ga0207689_10164947 | Ga0207689_101649471 | 137 |
| 418 | 3300025942 | Ga0207689_10200495 | Ga0207689_102004953 | 137 |
| 419 | 3300025945 | Ga0207679_10067762 | Ga0207679_100677622 | 137 |
| 420 | 3300025945 | Ga0207679_10099579 | Ga0207679_100995793 | 137 |
| 421 | 3300025949 | Ga0207667_10063180 | Ga0207667_100631805 | 137 |
| 422 | 3300025949 | Ga0207667_10291743 | Ga0207667_102917433 | 137 |
| 423 | 3300025960 | Ga0207651_10276936 | Ga0207651_102769361 | 137 |
| 424 | 3300025960 | Ga0207651_10288782 | Ga0207651_102887822 | 137 |
| 425 | 3300025961 | Ga0207712_10758076 | Ga0207712_107580762 | 137 |
| 426 | 3300025972 | Ga0207668_10527235 | Ga0207668_105272351 | 137 |
| 427 | 3300025972 | Ga0207668_11380235 | Ga0207668_113802352 | 137 |
| 428 | 3300025981 | Ga0207640_10057513 | Ga0207640_100575134 | 137 |
| 429 | 3300025981 | Ga0207640_10587450 | Ga0207640_105874501 | 137 |
| 430 | 3300025986 | Ga0207658_10068331 | Ga0207658_100683314 | 137 |
| 431 | 3300025986 | Ga0207658_10079792 | Ga0207658_100797922 | 137 |
| 432 | 3300025986 | Ga0207658_10111212 | Ga0207658_101112121 | 137 |
| 433 | 3300025986 | Ga0207658_10166589 | Ga0207658_101665892 | 137 |
| 434 | 3300025986 | Ga0207658_11022758 | Ga0207658_110227582 | 137 |
| 435 | 3300025986 | Ga0207658_11279264 | Ga0207658_112792641 | 137 |
| 436 | 3300025986 | Ga0207658_11819689 | Ga0207658_118196891 | 137 |
| 437 | 3300026023 | Ga0207677_11060663 | Ga0207677_110606632 | 137 |
| 438 | 3300026035 | Ga0207703_10377016 | Ga0207703_103770162 | 137 |
| 439 | 3300026041 | Ga0207639_10013550 | Ga0207639_100135504 | 137 |
| 440 | 3300026041 | Ga0207639_10378590 | Ga0207639_103785902 | 137 |
| 441 | 3300026041 | Ga0207639_10422403 | Ga0207639_104224032 | 137 |
| 442 | 3300026067 | Ga0207678_10158522 | Ga0207678_101585223 | 137 |
| 443 | 3300026078 | Ga0207702_10276208 | Ga0207702_102762083 | 137 |
| 444 | 3300026078 | Ga0207702_10294328 | Ga0207702_102943282 | 137 |
| 445 | 3300026078 | Ga0207702_10970656 | Ga0207702_109706561 | 137 |
| 446 | 3300026088 | Ga0207641_10093821 | Ga0207641_100938212 | 137 |
| 447 | 3300026088 | Ga0207641_10254720 | Ga0207641_102547203 | 137 |
| 448 | 3300026088 | Ga0207641_11843481 | Ga0207641_118434812 | 137 |
| 449 | 3300026089 | Ga0207648_10000629 | Ga0207648_1000062928 | 137 |
| 450 | 3300026089 | Ga0207648_10134043 | Ga0207648_101340432 | 137 |
| 451 | 3300026089 | Ga0207648_10256265 | Ga0207648_102562653 | 137 |
| 452 | 3300026095 | Ga0207676_10317132 | Ga0207676_103171322 | 137 |
| 453 | 3300026095 | Ga0207676_11522550 | Ga0207676_115225501 | 137 |
| 454 | 3300026116 | Ga0207674_10022322 | Ga0207674_100223223 | 137 |
| 455 | 3300026116 | Ga0207674_10117439 | Ga0207674_101174392 | 137 |
| 456 | 3300026116 | Ga0207674_10455243 | Ga0207674_104552432 | 137 |
| 457 | 3300026118 | Ga0207675_101163692 | Ga0207675_1011636921 | 137 |
| 458 | 3300026121 | Ga0207683_10010974 | Ga0207683_100109744 | 137 |
| 459 | 3300026121 | Ga0207683_10187908 | Ga0207683_101879082 | 137 |
| 460 | 3300026142 | Ga0207698_10149897 | Ga0207698_101498973 | 137 |
| 461 | 3300026142 | Ga0207698_11105065 | Ga0207698_111050652 | 137 |
| 462 | 3300027296 | Ga0209389_1000025 | Ga0209389_1000025102 | 137 |
| 463 | 3300027357 | Ga0209589_1000066 | Ga0209589_100006651 | 137 |
| 464 | 3300027361 | Ga0209489_100030 | Ga0209489_10003062 | 137 |
| 465 | 3300027717 | Ga0209998_10123498 | Ga0209998_101234982 | 137 |
| 466 | 3300027866 | Ga0209813_10018694 | Ga0209813_100186942 | 137 |
| 467 | 3300027876 | Ga0209974_10003650 | Ga0209974_100036502 | 137 |
| 468 | 3300028379 | Ga0268266_10000051 | Ga0268266_10000051150 | 137 |
| 469 | 3300028379 | Ga0268266_10064413 | Ga0268266_100644132 | 137 |
| 470 | 3300028379 | Ga0268266_10442246 | Ga0268266_104422462 | 137 |
| 471 | 3300028379 | Ga0268266_10581948 | Ga0268266_105819482 | 137 |
| 472 | 3300028379 | Ga0268266_11609506 | Ga0268266_116095062 | 137 |
| 473 | 3300028379 | Ga0268266_12231182 | Ga0268266_122311821 | 137 |
| 474 | 3300028380 | Ga0268265_10009645 | Ga0268265_100096453 | 137 |
| 475 | 3300028380 | Ga0268265_10053454 | Ga0268265_100534543 | 137 |
| 476 | 3300028380 | Ga0268265_11125856 | Ga0268265_111258562 | 137 |
| 477 | 3300028381 | Ga0268264_10091715 | Ga0268264_100917152 | 137 |
| 478 | 3300028381 | Ga0268264_10173195 | Ga0268264_101731952 | 137 |
| 479 | 3300028381 | Ga0268264_10945235 | Ga0268264_109452351 | 137 |
| 480 | 3300028786 | Ga0307517_10000024 | Ga0307517_1000002472 | 137 |
| 481 | 3300028786 | Ga0307517_10221165 | Ga0307517_102211652 | 137 |
| 482 | 3300028794 | Ga0307515_10000572 | Ga0307515_1000057233 | 137 |
| 483 | 3300028794 | Ga0307515_10039883 | Ga0307515_100398839 | 137 |
| 484 | 3300028794 | Ga0307515_10048367 | Ga0307515_100483678 | 137 |
| 485 | 3300028794 | Ga0307515_10097511 | Ga0307515_100975115 | 137 |
| 486 | 3300028794 | Ga0307515_10827884 | Ga0307515_108278842 | 137 |
| 487 | 3300030736 | Ga0316180_1185350 | Ga0316180_11853504 | 137 |
| 488 | 3300031456 | Ga0307513_10011603 | Ga0307513_100116031 | 137 |
| 489 | 3300031456 | Ga0307513_10019885 | Ga0307513_100198858 | 137 |
| 490 | 3300031456 | Ga0307513_10091911 | Ga0307513_100919112 | 137 |
| 491 | 3300031456 | Ga0307513_10158103 | Ga0307513_101581033 | 137 |
| 492 | 3300031456 | Ga0307513_10329066 | Ga0307513_103290662 | 137 |
| 493 | 3300031456 | Ga0307513_10621626 | Ga0307513_106216261 | 137 |
| 494 | 3300031456 | Ga0307513_11008989 | Ga0307513_110089891 | 137 |
| 495 | 3300031507 | Ga0307509_10000778 | Ga0307509_1000077842 | 137 |
| 496 | 3300031507 | Ga0307509_10089931 | Ga0307509_100899313 | 137 |
| 497 | 3300031616 | Ga0307508_10017904 | Ga0307508_100179044 | 137 |
| 498 | 3300031730 | Ga0307516_10011416 | Ga0307516_100114165 | 137 |
| 499 | 3300031730 | Ga0307516_10014057 | Ga0307516_100140575 | 137 |
| 500 | 3300031730 | Ga0307516_10082809 | Ga0307516_100828092 | 137 |
| 501 | 3300031730 | Ga0307516_10179875 | Ga0307516_101798752 | 137 |
| 502 | 3300033180 | Ga0307510_10049877 | Ga0307510_100498773 | 137 |
| 503 | 3300037418 | Ga0395900_0292066 | Ga0395900_0292066_631_1044 | 137 |
| 504 | 3300037471 | Ga0395905_0019296 | Ga0395905_0019296_4946_5359 | 137 |
| 505 | 3300037471 | Ga0395905_0076843 | Ga0395905_0076843_1128_1541 | 137 |
| 506 | 3300037471 | Ga0395905_0808610 | Ga0395905_0808610_34_447 | 137 |
| 507 | 3300038443 | Ga0395901_0112041 | Ga0395901_0112041_678_1091 | 137 |
| 508 | 3300038443 | Ga0395901_0268855 | Ga0395901_0268855_574_987 | 137 |
| 509 | 3300041451 | Ga0451791_1202226 | Ga0451791_1202226_34_447 | 137 |
| 510 | 3300041452 | Ga0451793_1617958 | Ga0451793_1617958_448_861 | 137 |
| 511 | 3300041463 | Ga0451804_0864300 | Ga0451804_0864300_216_629 | 137 |
| 512 | 3300041491 | Ga0451833_1488514 | Ga0451833_1488514_119_532 | 137 |
| 513 | 3300041492 | Ga0451835_0233361 | Ga0451835_0233361_505_918 | 137 |
| 514 | 3300041501 | Ga0451845_0605482 | Ga0451845_0605482_377_790 | 137 |
| 515 | 3300041507 | Ga0451851_1070308 | Ga0451851_1070308_222_635 | 137 |
| 516 | 3300041511 | Ga0451855_1272962 | Ga0451855_1272962_326_739 | 137 |
| 517 | 3300041512 | Ga0451853_3203472 | Ga0451853_3203472_141_554 | 137 |
| 518 | 3300044656 | Ga0466969_0014853 | Ga0466969_0014853_1759_2172 | 137 |
| 519 | 3300044658 | Ga0466972_0000807 | Ga0466972_0000807_4552_4965 | 137 |
| 520 | 3300044673 | Ga0453683_0905587 | Ga0453683_0905587_32_445 | 137 |
| 521 | 3300044684 | Ga0466966_0001348 | Ga0466966_0001348_10136_10549 | 137 |
| 522 | 3300044693 | Ga0466961_0000120 | Ga0466961_0000120_38843_39256 | 137 |
| 523 | 3300046452 | Ga0495617_158665 | Ga0495617_158665_269_694 | 137 |
| 524 | 3300046459 | Ga0495629_0004834 | Ga0495629_0004834_8464_8877 | 137 |
| 525 | 3300046462 | Ga0495651_0061972 | Ga0495651_0061972_1370_1783 | 137 |
| 526 | 3300046471 | Ga0495650_0005807 | Ga0495650_0005807_2632_3045 | 137 |
| 527 | 3300046501 | Ga0495607_0207588 | Ga0495607_0207588_503_916 | 137 |
| 528 | 3300046507 | Ga0495606_0054446 | Ga0495606_0054446_936_1349 | 137 |
| 529 | 3300046507 | Ga0495606_0209727 | Ga0495606_0209727_397_810 | 137 |
| 530 | 3300046515 | Ga0495620_0027728 | Ga0495620_0027728_1309_1722 | 137 |
| 531 | 3300046515 | Ga0495620_0362554 | Ga0495620_0362554_95_508 | 137 |
| 532 | 3300046518 | Ga0495631_0124431 | Ga0495631_0124431_492_905 | 137 |
| 533 | 3300046518 | Ga0495631_0244360 | Ga0495631_0244360_326_739 | 137 |
| 534 | 3300046519 | Ga0495632_0045232 | Ga0495632_0045232_1033_1446 | 137 |
| 535 | 3300046519 | Ga0495632_0070199 | Ga0495632_0070199_307_720 | 137 |
| 536 | 3300046519 | Ga0495632_0085945 | Ga0495632_0085945_685_1098 | 137 |
| 537 | 3300046522 | Ga0495643_0018248 | Ga0495643_0018248_240_653 | 137 |
| 538 | 3300046524 | Ga0495648_0135996 | Ga0495648_0135996_10_423 | 137 |
| 539 | 3300046526 | Ga0495666_0185742 | Ga0495666_0185742_40_486 | 137 |
| 540 | 3300046615 | Ga0495656_0011297 | Ga0495656_0011297_1249_1662 | 137 |
| 541 | 3300046616 | Ga0495668_0083471 | Ga0495668_0083471_99_512 | 137 |
| 542 | 3300046616 | Ga0495668_0086160 | Ga0495668_0086160_687_1100 | 137 |
| 543 | 3300046616 | Ga0495668_0278150 | Ga0495668_0278150_23_436 | 137 |
| 544 | 3300046642 | Ga0495634_0236678 | Ga0495634_0236678_521_934 | 137 |
| 545 | 3300046660 | Ga0495625_0004298 | Ga0495625_0004298_2555_2968 | 137 |
| 546 | 3300046660 | Ga0495625_0016332 | Ga0495625_0016332_1462_1875 | 137 |
| 547 | 3300046660 | Ga0495625_0100603 | Ga0495625_0100603_1273_1686 | 137 |
| 548 | 3300046663 | Ga0495635_0046740 | Ga0495635_0046740_1012_1425 | 137 |
| 549 | 3300046664 | Ga0495659_0141034 | Ga0495659_0141034_153_566 | 137 |
| 550 | 3300046664 | Ga0495659_0289622 | Ga0495659_0289622_211_624 | 137 |
| 551 | 3300046674 | Ga0495588_0042839 | Ga0495588_0042839_313_726 | 137 |
| 552 | 3300046675 | Ga0495657_0139213 | Ga0495657_0139213_530_943 | 137 |
| 553 | 3300046680 | Ga0495646_0112632 | Ga0495646_0112632_877_1290 | 137 |
| 554 | 3300046690 | Ga0495624_0840139 | Ga0495624_0840139_91_504 | 137 |
| 555 | 3300046691 | Ga0495670_0473822 | Ga0495670_0473822_175_588 | 137 |
| 556 | 3300046694 | Ga0495649_0030817 | Ga0495649_0030817_2432_2845 | 137 |
| 557 | 3300046694 | Ga0495649_0188890 | Ga0495649_0188890_502_915 | 137 |
| 558 | 3300046809 | Ga0495600_0058038 | Ga0495600_0058038_780_1193 | 137 |
| 559 | 3300047315 | Ga0495581_0141997 | Ga0495581_0141997_496_909 | 137 |
| 560 | 3300047317 | Ga0495604_0070415 | Ga0495604_0070415_899_1312 | 137 |
| 561 | 3300047318 | Ga0495636_0118701 | Ga0495636_0118701_91_504 | 137 |
| 562 | 3300047443 | Ga0495687_011038 | Ga0495687_011038_3206_3619 | 137 |
| 563 | 3300047469 | Ga0495673_0176623 | Ga0495673_0176623_230_643 | 137 |
| 564 | 3300047472 | Ga0495686_0034809 | Ga0495686_0034809_2767_3180 | 137 |
| 565 | 3300047472 | Ga0495686_0100780 | Ga0495686_0100780_248_661 | 137 |
| 566 | 3300047673 | Ga0495593_0102751 | Ga0495593_0102751_213_626 | 137 |
| 567 | 3300048089 | Ga0495614_0312453 | Ga0495614_0312453_203_616 | 137 |
| 568 | 3300048903 | Ga0496100_0272880 | Ga0496100_0272880_772_1185 | 137 |
| 569 | 3300048903 | Ga0496100_0581477 | Ga0496100_0581477_302_715 | 137 |
| 570 | 3300048904 | Ga0496101_0129363 | Ga0496101_0129363_538_951 | 137 |
| 571 | 3300048904 | Ga0496101_0506490 | Ga0496101_0506490_234_647 | 137 |
| 572 | 3300048905 | Ga0496102_0034116 | Ga0496102_0034116_1887_2300 | 137 |
| 573 | 3300048905 | Ga0496102_0209752 | Ga0496102_0209752_553_966 | 137 |
| 574 | 3300048906 | Ga0496103_0002701 | Ga0496103_0002701_658_1071 | 137 |
| 575 | 3300048907 | Ga0496104_0075514 | Ga0496104_0075514_1457_1870 | 137 |
| 576 | 3300048908 | Ga0496105_0099818 | Ga0496105_0099818_187_600 | 137 |
| 577 | 3300048908 | Ga0496105_0145330 | Ga0496105_0145330_702_1115 | 137 |
| 578 | 3300048909 | Ga0496106_0609890 | Ga0496106_0609890_12_425 | 137 |
| 579 | 3300048910 | Ga0496107_0651931 | Ga0496107_0651931_116_529 | 137 |
| 580 | 3300048911 | Ga0496108_0010766 | Ga0496108_0010766_6967_7380 | 137 |
| 581 | 3300048911 | Ga0496108_0083771 | Ga0496108_0083771_821_1234 | 137 |
| 582 | 3300048911 | Ga0496108_1370920 | Ga0496108_1370920_159_581 | 137 |
| 583 | 3300048912 | Ga0496109_0053400 | Ga0496109_0053400_3104_3517 | 137 |
| 584 | 3300048912 | Ga0496109_1150309 | Ga0496109_1150309_260_685 | 137 |
| 585 | 3300048915 | Ga0496112_0111850 | Ga0496112_0111850_742_1155 | 137 |
| 586 | 3300048915 | Ga0496112_0134434 | Ga0496112_0134434_1522_1935 | 137 |
| 587 | 3300048915 | Ga0496112_0256141 | Ga0496112_0256141_715_1128 | 137 |
| 588 | 3300048916 | Ga0496113_0111091 | Ga0496113_0111091_1074_1487 | 137 |
| 589 | 3300048916 | Ga0496113_0121398 | Ga0496113_0121398_629_1042 | 137 |
| 590 | 3300048916 | Ga0496113_0438421 | Ga0496113_0438421_325_738 | 137 |
| 591 | 3300048918 | Ga0496115_0146479 | Ga0496115_0146479_740_1153 | 137 |
| 592 | 3300048918 | Ga0496115_0997367 | Ga0496115_0997367_43_456 | 137 |
| 593 | 3300048920 | Ga0496117_0053343 | Ga0496117_0053343_1858_2280 | 137 |
| 594 | 3300048920 | Ga0496117_0118188 | Ga0496117_0118188_562_975 | 137 |
| 595 | 3300048920 | Ga0496117_0401008 | Ga0496117_0401008_193_606 | 137 |
| 596 | 3300048921 | Ga0496118_0018021 | Ga0496118_0018021_4646_5059 | 137 |
| 597 | 3300048921 | Ga0496118_0026318 | Ga0496118_0026318_4094_4516 | 137 |
| 598 | 3300048921 | Ga0496118_0056090 | Ga0496118_0056090_109_522 | 137 |
| 599 | 3300048921 | Ga0496118_0068786 | Ga0496118_0068786_1725_2138 | 137 |
| 600 | 3300048921 | Ga0496118_0149727 | Ga0496118_0149727_877_1293 | 137 |
| 601 | 3300048922 | Ga0496119_0011409 | Ga0496119_0011409_1225_1638 | 137 |
| 602 | 3300048922 | Ga0496119_0082411 | Ga0496119_0082411_253_666 | 137 |
| 603 | 3300048922 | Ga0496119_0147315 | Ga0496119_0147315_672_1085 | 137 |
| 604 | 3300048923 | Ga0496120_0110715 | Ga0496120_0110715_255_668 | 137 |
| 605 | 3300048924 | Ga0496121_0209690 | Ga0496121_0209690_743_1156 | 137 |
| 606 | 3300048924 | Ga0496121_0352834 | Ga0496121_0352834_358_771 | 137 |
| 607 | 3300048925 | Ga0496122_0370153 | Ga0496122_0370153_163_576 | 137 |
| 608 | 3300048927 | Ga0496124_0039510 | Ga0496124_0039510_2913_3335 | 137 |
| 609 | 3300048928 | Ga0496125_0076413 | Ga0496125_0076413_1694_2116 | 137 |
| 610 | 3300048928 | Ga0496125_0094222 | Ga0496125_0094222_1548_1961 | 137 |
| 611 | 3300048928 | Ga0496125_0311952 | Ga0496125_0311952_48_461 | 137 |
| 612 | 3300048929 | Ga0496126_0048730 | Ga0496126_0048730_2488_2901 | 137 |
| 613 | 3300048929 | Ga0496126_0063564 | Ga0496126_0063564_2645_3058 | 137 |
| 614 | 3300048929 | Ga0496126_0108826 | Ga0496126_0108826_567_980 | 137 |
| 615 | 3300048929 | Ga0496126_0440086 | Ga0496126_0440086_105_518 | 137 |
| 616 | 3300049460 | Ga0495682_0344314 | Ga0495682_0344314_41_454 | 137 |
| 617 | 3300049571 | Ga0501034_0460748 | Ga0501034_0460748_261_680 | 137 |
| 618 | 3300049660 | Ga0501216_106498 | Ga0501216_106498_63_491 | 137 |
| 619 | 3300050489 | nmdc:mga03683_123032_c1 | nmdc:mga03683_123032_c1_153_566 | 137 |
| 620 | 3300050489 | nmdc:mga03683_245606_c1 | nmdc:mga03683_245606_c1_272_685 | 137 |
| 621 | 3300050489 | nmdc:mga03683_57034_c1 | nmdc:mga03683_57034_c1_1155_1568 | 137 |
| 622 | 3300050490 | nmdc:mga03n38_110225_c1 | nmdc:mga03n38_110225_c1_699_1112 | 137 |
| 623 | 3300050490 | nmdc:mga03n38_140241_c1 | nmdc:mga03n38_140241_c1_420_833 | 137 |
| 624 | 3300050490 | nmdc:mga03n38_152399_c1 | nmdc:mga03n38_152399_c1_44_457 | 137 |
| 625 | 3300050491 | nmdc:mga00v17_114811_c1 | nmdc:mga00v17_114811_c1_1183_1596 | 137 |
| 626 | 3300050491 | nmdc:mga00v17_44386_c1 | nmdc:mga00v17_44386_c1_1698_2111 | 137 |
| 627 | 3300050491 | nmdc:mga00v17_93241_c1 | nmdc:mga00v17_93241_c1_899_1312 | 137 |
| 628 | 3300050492 | nmdc:mga0yw44_11693_c1 | nmdc:mga0yw44_11693_c1_260_673 | 137 |
| 629 | 3300050492 | nmdc:mga0yw44_243591_c1 | nmdc:mga0yw44_243591_c1_717_1130 | 137 |
| 630 | 3300050493 | nmdc:mga0k408_124922_c1 | nmdc:mga0k408_124922_c1_307_720 | 137 |
| 631 | 3300050493 | nmdc:mga0k408_161149_c1 | nmdc:mga0k408_161149_c1_552_965 | 137 |
| 632 | 3300050493 | nmdc:mga0k408_33345_c1 | nmdc:mga0k408_33345_c1_1259_1672 | 137 |
| 633 | 3300050493 | nmdc:mga0k408_37301_c1 | nmdc:mga0k408_37301_c1_154_624 | 137 |
| 634 | 3300050493 | nmdc:mga0k408_67221_c1 | nmdc:mga0k408_67221_c1_650_1063 | 137 |
| 635 | 3300050494 | nmdc:mga06z11_130566_c1 | nmdc:mga06z11_130566_c1_717_1130 | 137 |
| 636 | 3300050494 | nmdc:mga06z11_191815_c1 | nmdc:mga06z11_191815_c1_407_877 | 137 |
| 637 | 3300050494 | nmdc:mga06z11_35955_c1 | nmdc:mga06z11_35955_c1_331_744 | 137 |
| 638 | 3300050494 | nmdc:mga06z11_74027_c1 | nmdc:mga06z11_74027_c1_696_1109 | 137 |
| 639 | 3300050494 | nmdc:mga06z11_820207_c1 | nmdc:mga06z11_820207_c1_60_473 | 137 |
| 640 | 3300050495 | nmdc:mga04h51_123430_c1 | nmdc:mga04h51_123430_c1_423_836 | 137 |
| 641 | 3300050495 | nmdc:mga04h51_22238_c1 | nmdc:mga04h51_22238_c1_497_910 | 137 |
| 642 | 3300050495 | nmdc:mga04h51_90079_c1 | nmdc:mga04h51_90079_c1_106_519 | 137 |
| 643 | 3300050496 | nmdc:mga07m45_31269_c1 | nmdc:mga07m45_31269_c1_2023_2493 | 137 |
| 644 | 3300050496 | nmdc:mga07m45_555983_c1 | nmdc:mga07m45_555983_c1_92_505 | 137 |
| 645 | 3300050496 | nmdc:mga07m45_6469_c1 | nmdc:mga07m45_6469_c1_3981_4394 | 137 |
| 646 | 3300050496 | nmdc:mga07m45_74294_c1 | nmdc:mga07m45_74294_c1_808_1221 | 137 |
| 647 | 3300050513 | nmdc:mga0rr50_789168_c1 | nmdc:mga0rr50_789168_c1_217_687 | 137 |
| 648 | 3300050516 | nmdc:mga0sz30_109954_c1 | nmdc:mga0sz30_109954_c1_67_480 | 137 |
| 649 | 3300050516 | nmdc:mga0sz30_183411_c1 | nmdc:mga0sz30_183411_c1_385_798 | 137 |
| 650 | 3300050516 | nmdc:mga0sz30_248552_c1 | nmdc:mga0sz30_248552_c1_278_748 | 137 |
| 651 | 3300050516 | nmdc:mga0sz30_27135_c1 | nmdc:mga0sz30_27135_c1_1565_1978 | 137 |
| 652 | 3300050516 | nmdc:mga0sz30_464763_c1 | nmdc:mga0sz30_464763_c1_73_498 | 137 |
| 653 | 3300053077 | Ga0495601_0734711 | Ga0495601_0734711_110_523 | 137 |
| 654 | 3300053079 | Ga0500610_0002738 | Ga0500610_0002738_4286_4699 | 137 |
| 655 | 3300053079 | Ga0500610_0143202 | Ga0500610_0143202_374_859 | 137 |
| 656 | 3300053079 | Ga0500610_0244925 | Ga0500610_0244925_266_679 | 137 |
| 657 | 3300053085 | Ga0495619_1062312 | Ga0495619_1062312_88_501 | 137 |
| 658 | 3300053086 | Ga0500578_0124204 | Ga0500578_0124204_465_878 | 137 |
| 659 | 3300053091 | Ga0500647_0138368 | Ga0500647_0138368_184_597 | 137 |
| 660 | 3300053091 | Ga0500647_0201837 | Ga0500647_0201837_41_454 | 137 |
| 661 | 3300053092 | Ga0500583_0023891 | Ga0500583_0023891_520_933 | 137 |
| 662 | 3300053092 | Ga0500583_0026123 | Ga0500583_0026123_1250_1663 | 137 |
| 663 | 3300053093 | Ga0500651_0141773 | Ga0500651_0141773_902_1315 | 137 |
| 664 | 3300053094 | Ga0500566_0158471 | Ga0500566_0158471_293_706 | 137 |
| 665 | 3300053095 | Ga0500640_023004 | Ga0500640_023004_1545_1958 | 137 |
| 666 | 3300053096 | Ga0500641_0347308 | Ga0500641_0347308_89_502 | 137 |
| 667 | 3300053097 | Ga0500648_338574 | Ga0500648_338574_178_591 | 137 |
| 668 | 3300053109 | Ga0500569_003017 | Ga0500569_003017_2175_2588 | 137 |
| 669 | 3300053111 | Ga0500572_106961 | Ga0500572_106961_250_663 | 137 |
| 670 | 3300053119 | Ga0500595_013952 | Ga0500595_013952_554_967 | 137 |
| 671 | 3300053119 | Ga0500595_032100 | Ga0500595_032100_185_598 | 137 |
| 672 | 3300053121 | Ga0500607_006049 | Ga0500607_006049_5992_6405 | 137 |
| 673 | 3300053121 | Ga0500607_011476 | Ga0500607_011476_907_1320 | 137 |
| 674 | 3300053122 | Ga0500608_161459 | Ga0500608_161459_540_953 | 137 |
| 675 | 3300053123 | Ga0500614_179891 | Ga0500614_179891_110_523 | 137 |
| 676 | 3300053131 | Ga0500652_086492 | Ga0500652_086492_807_1232 | 137 |
| 677 | 3300053134 | Ga0500658_0086002 | Ga0500658_0086002_253_666 | 137 |
| 678 | 3300053136 | Ga0500559_0013563 | Ga0500559_0013563_1671_2084 | 137 |
| 679 | 3300053139 | Ga0500568_0006793 | Ga0500568_0006793_1640_2053 | 137 |
| 680 | 3300053148 | Ga0500590_137134 | Ga0500590_137134_102_515 | 137 |
| 681 | 3300053153 | Ga0500616_0189413 | Ga0500616_0189413_120_533 | 137 |
| 682 | 3300053154 | Ga0500619_151015 | Ga0500619_151015_134_547 | 137 |
| 683 | 3300053155 | Ga0500620_020852 | Ga0500620_020852_709_1122 | 137 |
| 684 | 3300053163 | Ga0500639_217339 | Ga0500639_217339_175_588 | 137 |
| 685 | 3300053177 | Ga0500636_0000076 | Ga0500636_0000076_36213_36626 | 137 |
| 686 | 3300053727 | Ga0500611_002748 | Ga0500611_002748_765_1178 | 137 |
| 687 | 3300053739 | Ga0500587_000134 | Ga0500587_000134_6040_6453 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.9163 | 3 | 137 |
| 4hr6-assembly1.cif.gz_B | crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips | 0.8514 | 58 | 88 |
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.8509 | 3 | 137 |
| 2jjr-assembly1.cif.gz_A | v232k, n236d-trichosanthin | 0.8495 | 58 | 86 |
| 5y42-assembly2.cif.gz_E | native-crystal structure of three chain non-toxic type ii ribosome inactivating protein purified from the seeds of trichosanthes anguina | 0.8482 | 58 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hr6B01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.8514 | 58 | 88 | 3.40.420.10 |
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.8266 | 4 | 131 | 3.90.1590.10 |
| 1ahbA01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.825 | 58 | 85 | 3.40.420.10 |
| 3ku0B01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.8227 | 58 | 87 | 3.40.420.10 |
| 1yf8A01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.8055 | 58 | 86 | 3.40.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S3RGJ6-F1-model_v4 | GFA family protein | 0.9795 | 5 | 112 |
GO:0016846
GO:0046872 |
| AF-A0A7C9G102-F1-model_v4 | Aldehyde-activating protein | 0.9781 | 5 | 137 |
GO:0016846
GO:0046872 |
| AF-A0A4R3JFK9-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9771 | 2 | 136 |
GO:0016846
GO:0046872 |
| AF-A5EH59-F1-model_v4 | deleted | 0.9749 | 24 | 137 |
|
| AF-A0A2P2DRP6-F1-model_v4 | deleted | 0.9748 | 38 | 137 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar