F475289

General Info

Members Datasets Scaffolds Average Seq Length
687 394 622 137

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_37301_c1|nmdc:mga0k408_37301_c1_154_624
Length 156
Sequence MSRAKPVDRIGTGIFRTTQMSQTYTGGCACGAIRYEISGEPIFQNHCQCRDCQRKSGTGHGSYLTFARDGVKHSGQATPWAIVADSGNVKTRAFCPTCGSPVYMTFSAMPDIFTVHAASLDDPGRYRPQAVTYTVRGPEWDCLDPALPKFDKMPAT

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
6 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
7 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
8 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
9 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
10 2643221573 Lysobacter sp. Root604 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221728 Lysobacter sp. Root983 Isolate Unclassified
13 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
14 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
15 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
16 2818991446 Variovorax sp. 1180 Isolate Unclassified
17 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
18 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
19 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
20 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
21 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
22 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
23 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
24 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
25 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
26 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
27 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
28 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
29 2885198086 Variovorax sp. 679 Isolate Unclassified
30 2885211737 Variovorax sp. 553 Isolate Unclassified
31 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
32 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
33 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
34 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
35 2899924645 Variovorax sp. 369 Isolate Unclassified
36 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
37 2928037797 Variovorax sp. 1126 Isolate Unclassified
38 2928044640 Variovorax sp. 1128 Isolate Unclassified
39 2928051484 Variovorax sp. 1133 Isolate Unclassified
40 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
41 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
42 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
43 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
44 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
45 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
46 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
47 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
48 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
49 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
50 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
51 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
52 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
53 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
54 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
55 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
56 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
57 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
58 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
59 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
60 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
61 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
62 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
63 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
64 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
65 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
66 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
67 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
68 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
69 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
70 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
71 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
74 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
75 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
76 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
77 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
78 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
79 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
80 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
81 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
82 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
83 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
84 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
85 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
86 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
87 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
88 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
89 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
90 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
91 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
92 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
93 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
94 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
95 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
98 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
99 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
100 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
101 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
104 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
110 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
111 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
112 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
113 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
114 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
118 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
119 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
120 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
121 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
122 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
123 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
124 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
125 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
126 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
129 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
130 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
133 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
134 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
140 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
142 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
145 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
152 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
153 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
154 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
158 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
159 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
160 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
161 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
162 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
173 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
176 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
179 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
180 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
188 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
244 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
245 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
246 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
248 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
253 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
254 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
255 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
266 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
267 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
268 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
269 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
270 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
271 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
272 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
273 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
274 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
275 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
276 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
277 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
278 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
279 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
280 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
281 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
282 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
317 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
337 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
346 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
358 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
361 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
362 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
363 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
364 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
365 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
366 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
367 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
368 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
369 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
370 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
371 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
372 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
373 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
374 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
375 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
376 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
377 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
378 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
379 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
380 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
381 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
385 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
390 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
391 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
392 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
393 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
394 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.54
Metatranscriptomes 0
Isolates 9.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.4
Nodule 5.24
Rhizoplane 4.37
Rhizosphere 49.64
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5120920 2162886012 Bacteria 1100
2 JGI25152J39213_1000902 3300002773 Bacteria 14533
3 JGI25150J39212_1000529 3300002774 Bacteria 15578
4 JGI25159J45721_1000714 3300002987 Bacteria 14510
5 JGI25159J45721_1015530 3300002987 Bacteria 1663
6 JGI25151J46595_10001672 3300003187 Bacteria 14533
7 JGI25153J46596_10001378 3300003215 Bacteria 14533
8 rootH1_10084038 3300003316 Bacteria 2213
9 JGI25160J50197_1000504 3300003354 Bacteria 23228
10 JGI25160J50197_1001019 3300003354 Bacteria 14510
11 JGI25160J50197_1016594 3300003354 Bacteria 2367
12 JGI25161J50226_1001946 3300003374 Bacteria 5689
13 JGI25161J50226_1007453 3300003374 Bacteria 1830
14 Ga0055539_1023106 3300003752 Bacteria 732
15 Ga0055535_1000544 3300003761 Bacteria 32432
16 Ga0055542_1000004 3300003762 Bacteria 553532
17 Ga0055526_1001885 3300003771 Bacteria 14533
18 Ga0055526_1020268 3300003771 Bacteria 2375
19 Ga0055537_1000532 3300003773 Bacteria 22142
20 Ga0055537_1021503 3300003773 Bacteria 957
21 Ga0055524_1001312 3300003775 Bacteria 14533
22 Ga0055524_1003577 3300003775 Bacteria 7490
23 Ga0055524_1008003 3300003775 Bacteria 4434
24 Ga0055536_1001009 3300003781 Bacteria 17895
25 Ga0055534_1000806 3300003784 Bacteria 14533
26 Ga0055534_1006267 3300003784 Bacteria 3023
27 Ga0055528_1000780 3300003790 Bacteria 22142
28 Ga0055528_1016555 3300003790 Bacteria 2599
29 Ga0055530_10000730 3300003791 Bacteria 27505
30 Ga0055530_10001183 3300003791 Bacteria 20158
31 Ga0055540_1001469 3300003792 Bacteria 14046
32 Ga0055540_1005496 3300003792 Bacteria 5306
33 Ga0055531_10002619 3300003794 Bacteria 11919
34 Ga0055531_10008256 3300003794 Bacteria 5535
35 Ga0055543_1000702 3300004625 Bacteria 17034
36 Ga0055543_1001310 3300004625 Bacteria 10206
37 Ga0065165_1000278 3300005262 Bacteria 87353
38 Ga0065165_1002519 3300005262 Bacteria 15255
39 Ga0065165_1016865 3300005262 Bacteria 2714
40 Ga0065165_1024980 3300005262 Bacteria 1996
41 Ga0065714_10404806 3300005288 Bacteria 587
42 Ga0065715_10136549 3300005293 Bacteria 1920
43 Ga0070658_10005436 3300005327 Bacteria 10336
44 Ga0070676_10067141 3300005328 Bacteria 2144
45 Ga0070670_100061462 3300005331 Bacteria 3224
46 Ga0070670_100065897 3300005331 Bacteria 3108
47 Ga0070670_100136746 3300005331 Bacteria 2118
48 Ga0070677_10011531 3300005333 Bacteria 3051
49 Ga0068869_100367635 3300005334 Bacteria 1176
50 Ga0068869_101690182 3300005334 Bacteria 565
51 Ga0070666_10000008 3300005335 Bacteria 293415
52 Ga0070661_100013390 3300005344 Bacteria 5757
53 Ga0070668_100026997 3300005347 Bacteria 4359
54 Ga0070668_100787774 3300005347 Bacteria 844
55 Ga0070668_101231803 3300005347 Bacteria 679
56 Ga0070669_100022638 3300005353 Bacteria 4494
57 Ga0070669_100118587 3300005353 Bacteria 2016
58 Ga0070675_100000730 3300005354 Bacteria 22896
59 Ga0070671_100002821 3300005355 Bacteria 13508
60 Ga0070671_100034351 3300005355 Bacteria 4197
61 Ga0070671_100234860 3300005355 Bacteria 1556
62 Ga0070671_100781906 3300005355 Bacteria 830
63 Ga0070674_101268572 3300005356 Bacteria 656
64 Ga0070673_100016466 3300005364 Bacteria 5229
65 Ga0070673_100087038 3300005364 Bacteria 2546
66 Ga0070673_100429956 3300005364 Bacteria 1185
67 Ga0070667_100023464 3300005367 Bacteria 5118
68 Ga0070667_100035512 3300005367 Bacteria 4177
69 Ga0070667_100230615 3300005367 Bacteria 1651
70 Ga0070667_100412982 3300005367 Bacteria 1230
71 Ga0070667_100457391 3300005367 Bacteria 1167
72 Ga0070667_100701117 3300005367 Bacteria 937
73 Ga0070667_101396241 3300005367 Bacteria 657
74 Ga0070667_101416414 3300005367 Bacteria 652
75 Ga0070708_100173250 3300005445 Bacteria 2015
76 Ga0070708_100289057 3300005445 Bacteria 1543
77 Ga0070663_100003812 3300005455 Bacteria 8775
78 Ga0070678_100011111 3300005456 Bacteria 5538
79 Ga0070662_100224876 3300005457 Bacteria 1499
80 Ga0070662_100403870 3300005457 Bacteria 1128
81 Ga0068867_100001685 3300005459 Bacteria 15414
82 Ga0068867_100020669 3300005459 Bacteria 4691
83 Ga0068867_100243945 3300005459 Bacteria 1458
84 Ga0070706_100000297 3300005467 Bacteria 60441
85 Ga0070707_100016306 3300005468 Bacteria 6974
86 Ga0070698_100156206 3300005471 Bacteria 2227
87 Ga0070697_101469464 3300005536 Bacteria 609
88 Ga0068853_100001340 3300005539 Bacteria 17741
89 Ga0068853_100059971 3300005539 Bacteria 3287
90 Ga0068853_100398065 3300005539 Bacteria 1288
91 Ga0070672_100000424 3300005543 Bacteria 24646
92 Ga0070665_100009026 3300005548 Bacteria 10100
93 Ga0070665_100031156 3300005548 Bacteria 5368
94 Ga0070665_100363659 3300005548 Bacteria 1453
95 Ga0070665_100687013 3300005548 Bacteria 1036
96 Ga0070665_100841690 3300005548 Bacteria 930
97 Ga0070665_100932919 3300005548 Bacteria 880
98 Ga0068855_100123638 3300005563 Bacteria 2960
99 Ga0068855_100150995 3300005563 Bacteria 2642
100 Ga0070664_100096689 3300005564 Bacteria 2563
101 Ga0070664_100457789 3300005564 Bacteria 1172
102 Ga0070664_101272953 3300005564 Bacteria 694
103 Ga0068857_100018893 3300005577 Bacteria 6048
104 Ga0068857_100285909 3300005577 Bacteria 1518
105 Ga0068857_100763917 3300005577 Bacteria 921
106 Ga0068854_100073055 3300005578 Bacteria 2513
107 Ga0068854_100649103 3300005578 Bacteria 906
108 Ga0068856_100482528 3300005614 Bacteria 1260
109 Ga0068856_101101422 3300005614 Bacteria 811
110 Ga0068852_100045272 3300005616 Bacteria 3742
111 Ga0068852_100172206 3300005616 Bacteria 2030
112 Ga0068859_100538291 3300005617 Bacteria 1262
113 Ga0068864_100022500 3300005618 Bacteria 5285
114 Ga0068864_100240584 3300005618 Bacteria 1677
115 Ga0068866_10043543 3300005718 Bacteria 2241
116 Ga0068861_100009698 3300005719 Bacteria 6657
117 Ga0068851_10014519 3300005834 Bacteria 3741
118 Ga0068851_10111571 3300005834 Bacteria 1460
119 Ga0068863_100276597 3300005841 Bacteria 1626
120 Ga0068863_101031522 3300005841 Bacteria 826
121 Ga0068863_102127948 3300005841 Bacteria 571
122 Ga0068858_100252152 3300005842 Bacteria 1676
123 Ga0068860_100134545 3300005843 Bacteria 2374
124 Ga0068860_100262900 3300005843 Bacteria 1682
125 Ga0068860_100304562 3300005843 Bacteria 1562
126 Ga0068860_101225147 3300005843 Bacteria 771
127 Ga0068862_100114031 3300005844 Bacteria 2375
128 Ga0068862_100177327 3300005844 Bacteria 1911
129 Ga0081455_10779102 3300005937 Bacteria 602
130 Ga0075365_10039463 3300006038 Bacteria 3074
131 Ga0075365_10052571 3300006038 Bacteria 2695
132 Ga0075365_10202781 3300006038 Bacteria 1390
133 Ga0075365_10239282 3300006038 Bacteria 1275
134 Ga0075368_10007174 3300006042 Bacteria 3927
135 Ga0075368_10119702 3300006042 Bacteria 1090
136 Ga0075363_100001650 3300006048 Bacteria 8628
137 Ga0075363_100373831 3300006048 Bacteria 835
138 Ga0075364_10160045 3300006051 Bacteria 1520
139 Ga0075364_10218217 3300006051 Bacteria 1294
140 Ga0075364_10243112 3300006051 Bacteria 1223
141 Ga0075364_10869892 3300006051 Bacteria 614
142 Ga0075362_10002752 3300006177 Bacteria 5996
143 Ga0075362_10056719 3300006177 Bacteria 1764
144 Ga0075362_10589839 3300006177 Bacteria 574
145 Ga0075367_10054447 3300006178 Bacteria 2372
146 Ga0075367_10111355 3300006178 Bacteria 1680
147 Ga0075367_10116181 3300006178 Bacteria 1646
148 Ga0075367_10125088 3300006178 Bacteria 1586
149 Ga0075367_10142242 3300006178 Bacteria 1486
150 Ga0075367_10217764 3300006178 Bacteria 1194
151 Ga0075367_10936405 3300006178 Bacteria 553
152 Ga0075369_10172125 3300006186 Bacteria 995
153 Ga0075369_10184095 3300006186 Bacteria 961
154 Ga0075366_10024798 3300006195 Bacteria 3498
155 Ga0075366_10035548 3300006195 Bacteria 2937
156 Ga0075366_10169770 3300006195 Bacteria 1323
157 Ga0097621_100004522 3300006237 Bacteria 9692
158 Ga0097621_100954044 3300006237 Bacteria 801
159 Ga0075370_10004005 3300006353 Bacteria 7080
160 Ga0075370_10051002 3300006353 Bacteria 2347
161 Ga0075370_10112829 3300006353 Bacteria 1579
162 Ga0068871_100027319 3300006358 Bacteria 4463
163 Ga0068871_101506224 3300006358 Bacteria 636
164 Ga0097620_100538283 3300006931 Bacteria 1262
165 Ga0099824_1016622 3300006942 Bacteria 6617
166 Ga0105250_10168069 3300009092 Bacteria 917
167 Ga0105240_10024486 3300009093 Bacteria 7953
168 Ga0105240_10294803 3300009093 Bacteria 1858
169 Ga0105240_10361675 3300009093 Bacteria 1643
170 Ga0105245_10136564 3300009098 Bacteria 2305
171 Ga0105245_12248933 3300009098 Bacteria 599
172 Ga0105247_10123462 3300009101 Bacteria 1680
173 Ga0105247_10573530 3300009101 Bacteria 833
174 Ga0105243_10048008 3300009148 Bacteria 3364
175 Ga0105243_10256053 3300009148 Bacteria 1565
176 Ga0105241_10089422 3300009174 Bacteria 2426
177 Ga0105241_10281550 3300009174 Bacteria 1420
178 Ga0105248_10099852 3300009177 Bacteria 3270
179 Ga0105248_11194399 3300009177 Bacteria 860
180 Ga0105237_10001770 3300009545 Bacteria 27892
181 Ga0105237_10035674 3300009545 Bacteria 5031
182 Ga0105237_10342649 3300009545 Bacteria 1499
183 Ga0105237_11699223 3300009545 Bacteria 638
184 Ga0105238_10000178 3300009551 Bacteria 69458
185 Ga0105249_10154357 3300009553 Bacteria 2213
186 Ga0105239_10089934 3300010375 Bacteria 3386
187 Ga0105239_10233941 3300010375 Bacteria 2062
188 Ga0105239_10238225 3300010375 Bacteria 2042
189 Ga0105239_11163119 3300010375 Bacteria 889
190 Ga0105239_11571551 3300010375 Bacteria 760
191 Ga0105246_10041441 3300011119 Bacteria 3112
192 Ga0157347_1024357 3300012502 Bacteria 726
193 Ga0157373_10926955 3300013100 Bacteria 647
194 Ga0157371_10018923 3300013102 Bacteria 5084
195 Ga0157371_10948339 3300013102 Bacteria 654
196 Ga0157370_10754424 3300013104 Unclassified 887
197 Ga0157369_10003369 3300013105 Bacteria 18984
198 Ga0157374_10051371 3300013296 Bacteria 3836
199 Ga0157378_10763151 3300013297 Bacteria 991
200 Ga0163162_10000110 3300013306 Bacteria 73989
201 Ga0163162_10210147 3300013306 Bacteria 2076
202 Ga0163162_10752281 3300013306 Bacteria 1094
203 Ga0163162_12338517 3300013306 Bacteria 614
204 Ga0157372_10113515 3300013307 Bacteria 3105
205 Ga0157375_10028467 3300013308 Bacteria 5237
206 Ga0157375_10036930 3300013308 Bacteria 4676
207 Ga0163163_10138673 3300014325 Bacteria 2474
208 Ga0163163_10361097 3300014325 Bacteria 1509
209 Ga0182008_10654775 3300014497 Bacteria 595
210 Ga0157379_10172435 3300014968 Bacteria 1953
211 Ga0157379_11789756 3300014968 Bacteria 603
212 Ga0157376_10026499 3300014969 Bacteria 4582
213 Ga0157376_10104600 3300014969 Bacteria 2481
214 Ga0157376_11968383 3300014969 Bacteria 622
215 Ga0163161_10014561 3300017792 Bacteria 5474
216 Ga0209436_101892 3300025208 Bacteria 6761
217 Ga0209436_105876 3300025208 Bacteria 2755
218 Ga0209672_100230 3300025228 Bacteria 42658
219 Ga0209258_100022 3300025242 Bacteria 553584
220 Ga0207425_1000392 3300025245 Bacteria 29503
221 Ga0207425_1002099 3300025245 Bacteria 7364
222 Ga0207425_1063360 3300025245 Bacteria 648
223 Ga0209677_114264 3300025253 Bacteria 1091
224 Ga0209677_123473 3300025253 Bacteria 684
225 Ga0209148_1000034 3300025254 Bacteria 553584
226 Ga0209148_1027039 3300025254 Bacteria 886
227 Ga0209129_1000111 3300025258 Bacteria 148853
228 Ga0209129_1009569 3300025258 Bacteria 2531
229 Ga0209233_1002734 3300025261 Bacteria 6354
230 Ga0209565_1000146 3300025263 Bacteria 97720
231 Ga0209565_1007086 3300025263 Bacteria 3064
232 Ga0209673_1001463 3300025273 Bacteria 22194
233 Ga0209673_1003920 3300025273 Bacteria 8347
234 Ga0209673_1079023 3300025273 Bacteria 759
235 Ga0209130_1000470 3300025284 Bacteria 41506
236 Ga0209130_1000492 3300025284 Bacteria 40584
237 Ga0209130_1004038 3300025284 Bacteria 5828
238 Ga0209675_1000331 3300025291 Bacteria 41480
239 Ga0209675_1010206 3300025291 Bacteria 3229
240 Ga0209675_1010601 3300025291 Bacteria 3132
241 Ga0209676_1000005 3300025292 Bacteria 1076001
242 Ga0209025_1000116 3300025294 Bacteria 218293
243 Ga0209564_1000155 3300025295 Bacteria 165859
244 Ga0209564_1000292 3300025295 Bacteria 101735
245 Ga0209564_1050065 3300025295 Bacteria 1026
246 Ga0209758_1000107 3300025297 Bacteria 218293
247 Ga0209758_1000560 3300025297 Bacteria 58586
248 Ga0209758_1014068 3300025297 Bacteria 4296
249 Ga0209758_1023566 3300025297 Bacteria 2779
250 Ga0209758_1031638 3300025297 Bacteria 2166
251 Ga0209050_1000007 3300025298 Bacteria 1187891
252 Ga0209256_1000038 3300025299 Bacteria 375225
253 Ga0209256_1000087 3300025299 Bacteria 218290
254 Ga0207426_1000090 3300025302 Bacteria 280662
255 Ga0207426_1000123 3300025302 Bacteria 218290
256 Ga0207426_1000721 3300025302 Bacteria 38161
257 Ga0207426_1002233 3300025302 Bacteria 12914
258 Ga0207426_1054138 3300025302 Bacteria 1182
259 Ga0209051_1000009 3300025303 Bacteria 706778
260 Ga0209051_1004594 3300025303 Bacteria 8422
261 Ga0209257_1000011 3300025304 Bacteria 1112630
262 Ga0209257_1001961 3300025304 Bacteria 22193
263 Ga0209257_1021240 3300025304 Bacteria 2367
264 Ga0207697_10010315 3300025315 Bacteria 3999
265 Ga0207656_10024934 3300025321 Bacteria 2424
266 Ga0207682_10003155 3300025893 Bacteria 7221
267 Ga0207710_10129595 3300025900 Bacteria 1211
268 Ga0207688_10133648 3300025901 Bacteria 1455
269 Ga0207680_10000005 3300025903 Bacteria 660983
270 Ga0207647_10011713 3300025904 Bacteria 6138
271 Ga0207645_10026326 3300025907 Bacteria 3760
272 Ga0207645_10298781 3300025907 Bacteria 1072
273 Ga0207643_10004555 3300025908 Bacteria 7445
274 Ga0207705_10023654 3300025909 Bacteria 4383
275 Ga0207705_10027327 3300025909 Bacteria 4070
276 Ga0207684_10005581 3300025910 Bacteria 11584
277 Ga0207654_10050199 3300025911 Bacteria 2396
278 Ga0207654_10811583 3300025911 Bacteria 676
279 Ga0207695_10070556 3300025913 Bacteria 3571
280 Ga0207695_10135301 3300025913 Bacteria 2418
281 Ga0207671_10082541 3300025914 Bacteria 2412
282 Ga0207671_10107312 3300025914 Bacteria 2121
283 Ga0207671_11133110 3300025914 Bacteria 614
284 Ga0207657_10135966 3300025919 Bacteria 2011
285 Ga0207649_10016493 3300025920 Bacteria 4168
286 Ga0207649_10054356 3300025920 Bacteria 2492
287 Ga0207649_11078196 3300025920 Bacteria 633
288 Ga0207646_10800759 3300025922 Bacteria 839
289 Ga0207681_10204591 3300025923 Bacteria 1518
290 Ga0207694_10000187 3300025924 Bacteria 62967
291 Ga0207650_10001814 3300025925 Bacteria 15112
292 Ga0207650_10159196 3300025925 Bacteria 1788
293 Ga0207659_10000544 3300025926 Bacteria 22498
294 Ga0207687_10011700 3300025927 Bacteria 5739
295 Ga0207687_11439329 3300025927 Bacteria 592
296 Ga0207644_10009377 3300025931 Bacteria 6429
297 Ga0207644_10184661 3300025931 Bacteria 1636
298 Ga0207690_10800956 3300025932 Bacteria 779
299 Ga0207706_10093896 3300025933 Bacteria 2639
300 Ga0207706_10155947 3300025933 Bacteria 2008
301 Ga0207706_10766204 3300025933 Bacteria 821
302 Ga0207709_10040458 3300025935 Bacteria 2791
303 Ga0207709_10730037 3300025935 Bacteria 795
304 Ga0207670_10743719 3300025936 Bacteria 814
305 Ga0207669_11845511 3300025937 Bacteria 516
306 Ga0207691_10000186 3300025940 Bacteria 58949
307 Ga0207711_10123427 3300025941 Bacteria 2314
308 Ga0207689_10099054 3300025942 Bacteria 2395
309 Ga0207689_10102890 3300025942 Bacteria 2347
310 Ga0207689_10164947 3300025942 Bacteria 1826
311 Ga0207689_10200495 3300025942 Bacteria 1647
312 Ga0207679_10067762 3300025945 Bacteria 2679
313 Ga0207679_10099579 3300025945 Bacteria 2270
314 Ga0207667_10063180 3300025949 Bacteria 3869
315 Ga0207667_10291743 3300025949 Bacteria 1666
316 Ga0207651_10276936 3300025960 Bacteria 1384
317 Ga0207651_10288782 3300025960 Bacteria 1359
318 Ga0207712_10758076 3300025961 Bacteria 851
319 Ga0207668_10527235 3300025972 Bacteria 1020
320 Ga0207668_11380235 3300025972 Bacteria 635
321 Ga0207640_10057513 3300025981 Bacteria 2558
322 Ga0207640_10587450 3300025981 Bacteria 941
323 Ga0207658_10068331 3300025986 Bacteria 2681
324 Ga0207658_10079792 3300025986 Bacteria 2505
325 Ga0207658_10111212 3300025986 Bacteria 2166
326 Ga0207658_10166589 3300025986 Bacteria 1811
327 Ga0207658_11022758 3300025986 Bacteria 754
328 Ga0207658_11279264 3300025986 Bacteria 671
329 Ga0207658_11819689 3300025986 Bacteria 555
330 Ga0207677_11060663 3300026023 Bacteria 737
331 Ga0207703_10377016 3300026035 Bacteria 1311
332 Ga0207639_10013550 3300026041 Bacteria 5712
333 Ga0207639_10378590 3300026041 Bacteria 1270
334 Ga0207639_10422403 3300026041 Bacteria 1205
335 Ga0207678_10158522 3300026067 Bacteria 1933
336 Ga0207702_10276208 3300026078 Bacteria 1586
337 Ga0207702_10294328 3300026078 Bacteria 1539
338 Ga0207702_10970656 3300026078 Bacteria 843
339 Ga0207641_10093821 3300026088 Bacteria 2631
340 Ga0207641_10254720 3300026088 Bacteria 1641
341 Ga0207641_11843481 3300026088 Bacteria 606
342 Ga0207648_10000629 3300026089 Bacteria 39533
343 Ga0207648_10134043 3300026089 Bacteria 2181
344 Ga0207648_10256265 3300026089 Bacteria 1560
345 Ga0207676_10317132 3300026095 Bacteria 1429
346 Ga0207676_11522550 3300026095 Bacteria 666
347 Ga0207674_10022322 3300026116 Bacteria 6796
348 Ga0207674_10117439 3300026116 Bacteria 2631
349 Ga0207674_10455243 3300026116 Bacteria 1237
350 Ga0207675_101163692 3300026118 Bacteria 791
351 Ga0207683_10010974 3300026121 Bacteria 7725
352 Ga0207683_10187908 3300026121 Bacteria 1875
353 Ga0207698_10149897 3300026142 Bacteria 2022
354 Ga0207698_11105065 3300026142 Bacteria 806
355 Ga0209389_1000025 3300027296 Bacteria 149588
356 Ga0209589_1000066 3300027357 Bacteria 100795
357 Ga0209489_100030 3300027361 Bacteria 185999
358 Ga0209998_10123498 3300027717 Bacteria 654
359 Ga0209813_10018694 3300027866 Bacteria 1917
360 Ga0209974_10003650 3300027876 Bacteria 5526
361 Ga0268266_10000051 3300028379 Bacteria 296231
362 Ga0268266_10008473 3300028379 Bacteria 9138
363 Ga0268266_10064413 3300028379 Bacteria 3166
364 Ga0268266_10442246 3300028379 Bacteria 1235
365 Ga0268266_10581948 3300028379 Bacteria 1074
366 Ga0268266_11609506 3300028379 Bacteria 625
367 Ga0268266_12231182 3300028379 Bacteria 519
368 Ga0268265_10009645 3300028380 Bacteria 6518
369 Ga0268265_10053454 3300028380 Bacteria 3060
370 Ga0268265_11125856 3300028380 Bacteria 780
371 Ga0268264_10091715 3300028381 Bacteria 2621
372 Ga0268264_10173195 3300028381 Bacteria 1954
373 Ga0268264_10945235 3300028381 Bacteria 867
374 Ga0307517_10000024 3300028786 Bacteria 185597
375 Ga0307517_10221165 3300028786 Bacteria 1151
376 Ga0307515_10000572 3300028794 Bacteria 86935
377 Ga0307515_10039883 3300028794 Bacteria 7447
378 Ga0307515_10048367 3300028794 Bacteria 6431
379 Ga0307515_10097511 3300028794 Bacteria 3592
380 Ga0307515_10827884 3300028794 Bacteria 550
381 Ga0307512_10099062 3300030522 Bacteria 1986
382 Ga0316180_1185350 3300030736 Bacteria 2733
383 Ga0307513_10011603 3300031456 Bacteria 10940
384 Ga0307513_10019885 3300031456 Bacteria 7978
385 Ga0307513_10091911 3300031456 Bacteria 3091
386 Ga0307513_10158103 3300031456 Bacteria 2163
387 Ga0307513_10329066 3300031456 Bacteria 1283
388 Ga0307513_10621626 3300031456 Bacteria 788
389 Ga0307513_11008989 3300031456 Bacteria 542
390 Ga0307509_10000778 3300031507 Bacteria 54586
391 Ga0307509_10089931 3300031507 Bacteria 3147
392 Ga0307508_10017904 3300031616 Bacteria 6438
393 Ga0307516_10011416 3300031730 Bacteria 9650
394 Ga0307516_10014057 3300031730 Bacteria 8487
395 Ga0307516_10082809 3300031730 Bacteria 3050
396 Ga0307516_10179875 3300031730 Bacteria 1849
397 Ga0307406_10499334 3300031901 Bacteria 986
398 Ga0307510_10049877 3300033180 Bacteria 4448
399 Ga0395900_0292066 3300037418 Bacteria 1619
400 Ga0395905_0019296 3300037471 Bacteria 6464
401 Ga0395905_0076843 3300037471 Bacteria 3129
402 Ga0395905_0808610 3300037471 Bacteria 840
403 Ga0395901_0112041 3300038443 Bacteria 2866
404 Ga0395901_0268855 3300038443 Bacteria 1774
405 Ga0451791_1202226 3300041451 Bacteria 531
406 Ga0451793_1617958 3300041452 Bacteria 1605
407 Ga0451804_0864300 3300041463 Bacteria 732
408 Ga0451833_1488514 3300041491 Bacteria 2254
409 Ga0451835_0233361 3300041492 Bacteria 1219
410 Ga0451845_0605482 3300041501 Bacteria 1067
411 Ga0451851_1070308 3300041507 Bacteria 1038
412 Ga0451843_1372200 3300041509 Bacteria 607
413 Ga0451855_1272962 3300041511 Bacteria 915
414 Ga0451853_3203472 3300041512 Bacteria 1757
415 Ga0466969_0001480 3300044656 Bacteria 12627
416 Ga0466969_0004808 3300044656 Bacteria 7193
417 Ga0466969_0014853 3300044656 Bacteria 4088
418 Ga0466972_0000807 3300044658 Bacteria 14916
419 Ga0453683_0905587 3300044673 Bacteria 583
420 Ga0466966_0001348 3300044684 Bacteria 15776
421 Ga0466966_0023654 3300044684 Bacteria 4021
422 Ga0466961_0000120 3300044693 Bacteria 52569
423 Ga0466961_0008103 3300044693 Bacteria 6692
424 Ga0466961_0211955 3300044693 Bacteria 1195
425 Ga0466963_0356664 3300044694 Bacteria 1030
426 Ga0466971_0000095 3300044719 Bacteria 32391
427 Ga0466970_0395994 3300044765 Bacteria 787
428 Ga0466957_0005130 3300044842 Bacteria 7320
429 Ga0466959_0000240 3300045049 Bacteria 34052
430 Ga0466958_0000923 3300045836 Bacteria 13221
431 Ga0495617_158665 3300046452 Bacteria 718
432 Ga0495590_0105262 3300046457 Bacteria 1004
433 Ga0495629_0004834 3300046459 Bacteria 10101
434 Ga0495638_0080378 3300046460 Bacteria 1981
435 Ga0495638_0249562 3300046460 Unclassified 979
436 Ga0495651_0061972 3300046462 Bacteria 2862
437 Ga0495650_0005807 3300046471 Bacteria 7871
438 Ga0495607_0207588 3300046501 Bacteria 966
439 Ga0495606_0054446 3300046507 Bacteria 2591
440 Ga0495606_0209727 3300046507 Bacteria 1104
441 Ga0495620_0027728 3300046515 Bacteria 2646
442 Ga0495620_0362554 3300046515 Bacteria 549
443 Ga0495631_0124431 3300046518 Bacteria 1109
444 Ga0495631_0244360 3300046518 Bacteria 765
445 Ga0495632_0045232 3300046519 Bacteria 2194
446 Ga0495632_0070199 3300046519 Bacteria 1685
447 Ga0495632_0085945 3300046519 Bacteria 1496
448 Ga0495643_0018248 3300046522 Bacteria 4082
449 Ga0495648_0135996 3300046524 Bacteria 1300
450 Ga0495666_0185742 3300046526 Bacteria 959
451 Ga0495656_0011297 3300046615 Bacteria 3275
452 Ga0495668_0083471 3300046616 Bacteria 1752
453 Ga0495668_0086160 3300046616 Bacteria 1723
454 Ga0495668_0278150 3300046616 Bacteria 917
455 Ga0495634_0236678 3300046642 Bacteria 1122
456 Ga0495625_0004298 3300046660 Bacteria 13552
457 Ga0495625_0016332 3300046660 Bacteria 5845
458 Ga0495625_0100603 3300046660 Bacteria 1987
459 Ga0495635_0046740 3300046663 Bacteria 2985
460 Ga0495659_0141034 3300046664 Bacteria 962
461 Ga0495659_0289622 3300046664 Bacteria 690
462 Ga0495588_0042839 3300046674 Bacteria 2315
463 Ga0495657_0139213 3300046675 Bacteria 1514
464 Ga0495646_0112632 3300046680 Bacteria 1548
465 Ga0495624_0840139 3300046690 Bacteria 542
466 Ga0495670_0473822 3300046691 Bacteria 679
467 Ga0495649_0030817 3300046694 Bacteria 2960
468 Ga0495649_0188890 3300046694 Bacteria 1073
469 Ga0495600_0058038 3300046809 Bacteria 2528
470 Ga0495581_0141997 3300047315 Bacteria 1401
471 Ga0495604_0070415 3300047317 Bacteria 2648
472 Ga0495636_0118701 3300047318 Bacteria 1168
473 Ga0495687_011038 3300047443 Bacteria 4891
474 Ga0495673_0176623 3300047469 Bacteria 811
475 Ga0495686_0034809 3300047472 Bacteria 3241
476 Ga0495686_0100780 3300047472 Bacteria 1742
477 Ga0495686_0102336 3300047472 Bacteria 1726
478 Ga0495593_0102751 3300047673 Bacteria 1465
479 Ga0495614_0312453 3300048089 Bacteria 728
480 Ga0496100_0272880 3300048903 Bacteria 1258
481 Ga0496100_0581477 3300048903 Bacteria 868
482 Ga0496101_0129363 3300048904 Bacteria 1916
483 Ga0496101_0506490 3300048904 Bacteria 954
484 Ga0496102_0034116 3300048905 Bacteria 4576
485 Ga0496102_0209752 3300048905 Bacteria 1837
486 Ga0496102_1195943 3300048905 Bacteria 680
487 Ga0496103_0002701 3300048906 Bacteria 11067
488 Ga0496104_0075514 3300048907 Bacteria 3209
489 Ga0496105_0099818 3300048908 Bacteria 2397
490 Ga0496105_0145330 3300048908 Bacteria 1950
491 Ga0496106_0609890 3300048909 Bacteria 874
492 Ga0496107_0651931 3300048910 Bacteria 776
493 Ga0496108_0010766 3300048911 Bacteria 7425
494 Ga0496108_0083771 3300048911 Bacteria 2705
495 Ga0496108_1370920 3300048911 Bacteria 592
496 Ga0496109_0053400 3300048912 Bacteria 3685
497 Ga0496109_1150309 3300048912 Bacteria 713
498 Ga0496112_0111850 3300048915 Bacteria 2700
499 Ga0496112_0134434 3300048915 Bacteria 2443
500 Ga0496112_0256141 3300048915 Bacteria 1700
501 Ga0496113_0111091 3300048916 Bacteria 2134
502 Ga0496113_0121398 3300048916 Bacteria 2043
503 Ga0496113_0438421 3300048916 Bacteria 1049
504 Ga0496115_0146479 3300048918 Bacteria 1949
505 Ga0496115_0560678 3300048918 Bacteria 912
506 Ga0496115_0997367 3300048918 Bacteria 640
507 Ga0496117_0053343 3300048920 Bacteria 2842
508 Ga0496117_0118188 3300048920 Bacteria 1635
509 Ga0496117_0401008 3300048920 Bacteria 692
510 Ga0496118_0018021 3300048921 Bacteria 6394
511 Ga0496118_0026318 3300048921 Bacteria 4959
512 Ga0496118_0056090 3300048921 Bacteria 2965
513 Ga0496118_0068786 3300048921 Bacteria 2569
514 Ga0496118_0149727 3300048921 Bacteria 1463
515 Ga0496119_0011409 3300048922 Bacteria 7362
516 Ga0496119_0082411 3300048922 Bacteria 1850
517 Ga0496119_0147315 3300048922 Bacteria 1265
518 Ga0496120_0110715 3300048923 Bacteria 1435
519 Ga0496121_0209690 3300048924 Bacteria 1381
520 Ga0496121_0352834 3300048924 Bacteria 979
521 Ga0496122_0370153 3300048925 Bacteria 740
522 Ga0496124_0039510 3300048927 Bacteria 4090
523 Ga0496125_0076413 3300048928 Bacteria 2586
524 Ga0496125_0094222 3300048928 Bacteria 2232
525 Ga0496125_0311952 3300048928 Bacteria 958
526 Ga0496126_0048730 3300048929 Bacteria 3870
527 Ga0496126_0063564 3300048929 Bacteria 3309
528 Ga0496126_0108826 3300048929 Bacteria 2416
529 Ga0496126_0440086 3300048929 Bacteria 1051
530 Ga0495682_0344314 3300049460 Bacteria 525
531 Ga0501034_0460748 3300049571 Bacteria 1188
532 Ga0501216_106498 3300049660 Bacteria 624
533 nmdc:mga03683_123032_c1 3300050489 Bacteria 1155
534 nmdc:mga03683_245606_c1 3300050489 Bacteria 830
535 nmdc:mga03683_57034_c1 3300050489 Bacteria 1643
536 nmdc:mga03n38_110225_c1 3300050490 Bacteria 1339
537 nmdc:mga03n38_140241_c1 3300050490 Bacteria 1206
538 nmdc:mga03n38_152399_c1 3300050490 Bacteria 1164
539 nmdc:mga00v17_114811_c1 3300050491 Bacteria 1711
540 nmdc:mga00v17_44386_c1 3300050491 Bacteria 2680
541 nmdc:mga00v17_93241_c1 3300050491 Bacteria 1893
542 nmdc:mga0yw44_11693_c1 3300050492 Bacteria 4545
543 nmdc:mga0yw44_243591_c1 3300050492 Bacteria 1196
544 nmdc:mga0k408_124922_c1 3300050493 Bacteria 1526
545 nmdc:mga0k408_161149_c1 3300050493 Bacteria 1337
546 nmdc:mga0k408_33345_c1 3300050493 Bacteria 2945
547 nmdc:mga0k408_37301_c1 3300050493 Bacteria 2790
548 nmdc:mga0k408_67221_c1 3300050493 Bacteria 2089
549 nmdc:mga06z11_130566_c1 3300050494 Bacteria 1411
550 nmdc:mga06z11_191815_c1 3300050494 Bacteria 1183
551 nmdc:mga06z11_35955_c1 3300050494 Bacteria 2441
552 nmdc:mga06z11_74027_c1 3300050494 Bacteria 1810
553 nmdc:mga06z11_820207_c1 3300050494 Bacteria 567
554 nmdc:mga04h51_123430_c1 3300050495 Bacteria 967
555 nmdc:mga04h51_22238_c1 3300050495 Bacteria 1917
556 nmdc:mga04h51_90079_c1 3300050495 Bacteria 1102
557 nmdc:mga07m45_31269_c1 3300050496 Bacteria 2950
558 nmdc:mga07m45_555983_c1 3300050496 Bacteria 664
559 nmdc:mga07m45_6469_c1 3300050496 Bacteria 5924
560 nmdc:mga07m45_74294_c1 3300050496 Bacteria 1937
561 nmdc:mga0rr50_789168_c1 3300050513 Bacteria 810
562 nmdc:mga0sz30_109954_c1 3300050516 Bacteria 1208
563 nmdc:mga0sz30_183411_c1 3300050516 Bacteria 929
564 nmdc:mga0sz30_248552_c1 3300050516 Bacteria 792
565 nmdc:mga0sz30_27135_c1 3300050516 Bacteria 2351
566 nmdc:mga0sz30_464763_c1 3300050516 Bacteria 568
567 Ga0495601_0734711 3300053077 Bacteria 629
568 Ga0500610_0002738 3300053079 Bacteria 6585
569 Ga0500610_0143202 3300053079 Bacteria 1205
570 Ga0500610_0244925 3300053079 Bacteria 831
571 Ga0495655_0064872 3300053083 Bacteria 1006
572 Ga0495619_1062312 3300053085 Bacteria 540
573 Ga0500578_0098214 3300053086 Bacteria 1855
574 Ga0500578_0124204 3300053086 Bacteria 1621
575 Ga0500647_0138368 3300053091 Bacteria 1144
576 Ga0500647_0201837 3300053091 Bacteria 901
577 Ga0500583_0023891 3300053092 Bacteria 2584
578 Ga0500583_0026123 3300053092 Bacteria 2503
579 Ga0500651_0012808 3300053093 Bacteria 5091
580 Ga0500651_0141773 3300053093 Bacteria 1448
581 Ga0500566_0158471 3300053094 Bacteria 1182
582 Ga0500640_023004 3300053095 Bacteria 2697
583 Ga0500641_0347308 3300053096 Bacteria 597
584 Ga0500648_338574 3300053097 Bacteria 625
585 Ga0500562_016324 3300053108 Bacteria 1909
586 Ga0500562_034602 3300053108 Bacteria 1337
587 Ga0500569_003017 3300053109 Bacteria 3384
588 Ga0500572_106961 3300053111 Bacteria 897
589 Ga0500595_002634 3300053119 Bacteria 8733
590 Ga0500595_013952 3300053119 Bacteria 3063
591 Ga0500595_032100 3300053119 Bacteria 1756
592 Ga0500607_006049 3300053121 Bacteria 7752
593 Ga0500607_011476 3300053121 Bacteria 5240
594 Ga0500608_161459 3300053122 Bacteria 970
595 Ga0500614_179891 3300053123 Bacteria 646
596 Ga0500642_0010960 3300053130 Bacteria 3221
597 Ga0500642_0030447 3300053130 Bacteria 2245
598 Ga0500652_086492 3300053131 Bacteria 1307
599 Ga0500652_097562 3300053131 Bacteria 1228
600 Ga0500658_0053565 3300053134 Bacteria 1655
601 Ga0500658_0086002 3300053134 Bacteria 1352
602 Ga0500658_0166661 3300053134 Unclassified 999
603 Ga0500658_0258836 3300053134 Bacteria 800
604 Ga0500559_0013563 3300053136 Bacteria 3449
605 Ga0500568_0006793 3300053139 Bacteria 5703
606 Ga0500568_0017833 3300053139 Unclassified 3123
607 Ga0500577_0053208 3300053142 Bacteria 1529
608 Ga0500590_137134 3300053148 Bacteria 1123
609 Ga0500604_0003450 3300053151 Bacteria 4258
610 Ga0500616_0099466 3300053153 Bacteria 1425
611 Ga0500616_0189413 3300053153 Bacteria 920
612 Ga0500619_151015 3300053154 Bacteria 790
613 Ga0500620_020852 3300053155 Bacteria 1950
614 Ga0500622_0210600 3300053156 Unclassified 878
615 Ga0500639_217339 3300053163 Bacteria 802
616 Ga0500636_0000076 3300053177 Bacteria 48321
617 Ga0500611_002748 3300053727 Bacteria 2155
618 Ga0500609_001166 3300053731 Bacteria 3911
619 Ga0500599_002866 3300053736 Bacteria 2090
620 Ga0500587_000134 3300053739 Bacteria 6898
621 Ga0500587_022052 3300053739 Bacteria 836
622 Ga0466962_0001879 3300061719 Bacteria 9888

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025936 Ga0207670_10743719 Ga0207670_107437192 120
2 iso_pu_bacteria 2739367756 2739792169 131
3 iso_pu_bacteria 2643221573 2643880920 132
4 iso_pu_bacteria 2643221720 2644661489 132
5 iso_pu_bacteria 2643221728 2644699570 132
6 iso_pu_bacteria 2791355123 2792747245 132
7 iso_pu_bacteria 2937822353 2937825472 132
8 3300041509 Ga0451843_1372200 Ga0451843_1372200_43_459 133
9 iso_pu_bacteria 2507262055 2507510025 133
10 iso_pu_bacteria 2511231028 2511397575 133
11 iso_pu_bacteria 2513237095 2513649009 133
12 iso_pu_bacteria 2513237164 2514039146 133
13 iso_pu_bacteria 2517093001 2517107520 133
14 iso_pu_bacteria 2534681796 2535520316 133
15 iso_pu_bacteria 2582581866 2585392343 133
16 iso_pu_bacteria 2585428062 2587758282 133
17 iso_pu_bacteria 2816332527 2818241587 133
18 iso_pu_bacteria 2824600985 2824605609 133
19 iso_pu_bacteria 2824609381 2824609859 133
20 iso_pu_bacteria 2824653114 2824655742 133
21 iso_pu_bacteria 2824661429 2824669451 133
22 iso_pu_bacteria 2831265667 2831270382 133
23 iso_pu_bacteria 2838054893 2838056609 133
24 iso_pu_bacteria 2841957949 2841959494 133
25 iso_pu_bacteria 2849076700 2849080683 133
26 iso_pu_bacteria 2874168670 2874172500 133
27 iso_pu_bacteria 2874620515 2874623216 133
28 iso_pu_bacteria 2874628541 2874636036 133
29 iso_pu_bacteria 2882632389 2882635280 133
30 iso_pu_bacteria 2885198086 2885199782 133
31 iso_pu_bacteria 2885211737 2885213433 133
32 iso_pu_bacteria 2888378607 2888382466 133
33 iso_pu_bacteria 2888388044 2888388223 133
34 iso_pu_bacteria 2888419890 2888423046 133
35 iso_pu_bacteria 2894414249 2894417003 133
36 iso_pu_bacteria 2904666416 2904670036 133
37 iso_pu_bacteria 2928037797 2928038247 133
38 iso_pu_bacteria 2928044640 2928046148 133
39 iso_pu_bacteria 2928051484 2928053843 133
40 iso_pu_bacteria 2928521798 2928526130 133
41 iso_pu_bacteria 2932794094 2932797325 133
42 iso_pu_bacteria 2932801729 2932804790 133
43 iso_pu_bacteria 2935616580 2935619022 133
44 iso_pu_bacteria 2935638405 2935643161 133
45 iso_pu_bacteria 2935665750 2935669787 133
46 iso_pu_bacteria 2935675223 2935677073 133
47 iso_pu_bacteria 2935684952 2935693112 133
48 iso_pu_bacteria 2935713505 2935719720 133
49 iso_pu_bacteria 2935722832 2935729513 133
50 iso_pu_bacteria 2935732158 2935739603 133
51 iso_pu_bacteria 2935741537 2935748641 133
52 iso_pu_bacteria 2935750917 2935756772 133
53 iso_pu_bacteria 2935827899 2935832695 133
54 iso_pu_bacteria 2935837841 2935839226 133
55 iso_pu_bacteria 2935855204 2935857387 133
56 iso_pu_bacteria 2935864058 2935864916 133
57 iso_pu_bacteria 2935873716 2935876694 133
58 iso_pu_bacteria 2935883170 2935884974 133
59 iso_pu_bacteria 2935992306 2935998955 133
60 iso_pu_bacteria 2940556831 2940562686 133
61 iso_pu_bacteria 2941538514 2941539916 133
62 iso_pu_bacteria 2954011201 2954014972 133
63 iso_pu_bacteria 8005542996 8005548060 133
64 iso_pu_bacteria 2954767861 2954771846 134
65 iso_pu_bacteria 2818991446 2819596271 135
66 iso_pu_bacteria 2899924645 2899925652 135
67 iso_pu_bacteria 2928064002 2928067390 135
68 3300005262 Ga0065165_1000278 Ga0065165_100027846 136
69 3300005548 Ga0070665_100031156 Ga0070665_1000311564 136
70 3300006038 Ga0075365_10202781 Ga0075365_102027812 136
71 3300013104 Ga0157370_10754424 Ga0157370_107544241 136
72 3300025302 Ga0207426_1054138 Ga0207426_10541382 136
73 3300028379 Ga0268266_10008473 Ga0268266_100084739 136
74 3300030522 Ga0307512_10099062 Ga0307512_100990623 136
75 3300031901 Ga0307406_10499334 Ga0307406_104993342 136
76 3300044656 Ga0466969_0001480 Ga0466969_0001480_704_1114 136
77 3300044656 Ga0466969_0004808 Ga0466969_0004808_557_967 136
78 3300044684 Ga0466966_0023654 Ga0466966_0023654_3234_3644 136
79 3300044693 Ga0466961_0008103 Ga0466961_0008103_5926_6336 136
80 3300044693 Ga0466961_0211955 Ga0466961_0211955_519_929 136
81 3300044694 Ga0466963_0356664 Ga0466963_0356664_68_478 136
82 3300044719 Ga0466971_0000095 Ga0466971_0000095_30004_30414 136
83 3300044765 Ga0466970_0395994 Ga0466970_0395994_355_765 136
84 3300044842 Ga0466957_0005130 Ga0466957_0005130_6788_7198 136
85 3300045049 Ga0466959_0000240 Ga0466959_0000240_5371_5781 136
86 3300045836 Ga0466958_0000923 Ga0466958_0000923_350_760 136
87 3300046457 Ga0495590_0105262 Ga0495590_0105262_116_526 136
88 3300046460 Ga0495638_0080378 Ga0495638_0080378_1450_1863 136
89 3300046460 Ga0495638_0249562 Ga0495638_0249562_432_842 136
90 3300047472 Ga0495686_0102336 Ga0495686_0102336_1058_1471 136
91 3300048905 Ga0496102_1195943 Ga0496102_1195943_88_501 136
92 3300048918 Ga0496115_0560678 Ga0496115_0560678_53_466 136
93 3300053083 Ga0495655_0064872 Ga0495655_0064872_159_572 136
94 3300053086 Ga0500578_0098214 Ga0500578_0098214_1130_1540 136
95 3300053093 Ga0500651_0012808 Ga0500651_0012808_514_924 136
96 3300053108 Ga0500562_016324 Ga0500562_016324_1049_1462 136
97 3300053108 Ga0500562_034602 Ga0500562_034602_843_1253 136
98 3300053119 Ga0500595_002634 Ga0500595_002634_4435_4845 136
99 3300053130 Ga0500642_0010960 Ga0500642_0010960_237_647 136
100 3300053130 Ga0500642_0030447 Ga0500642_0030447_1053_1463 136
101 3300053131 Ga0500652_097562 Ga0500652_097562_361_771 136
102 3300053134 Ga0500658_0053565 Ga0500658_0053565_1153_1563 136
103 3300053134 Ga0500658_0166661 Ga0500658_0166661_171_581 136
104 3300053134 Ga0500658_0258836 Ga0500658_0258836_48_458 136
105 3300053139 Ga0500568_0017833 Ga0500568_0017833_2412_2822 136
106 3300053142 Ga0500577_0053208 Ga0500577_0053208_261_671 136
107 3300053151 Ga0500604_0003450 Ga0500604_0003450_578_988 136
108 3300053153 Ga0500616_0099466 Ga0500616_0099466_940_1350 136
109 3300053156 Ga0500622_0210600 Ga0500622_0210600_164_574 136
110 3300053731 Ga0500609_001166 Ga0500609_001166_1786_2196 136
111 3300053736 Ga0500599_002866 Ga0500599_002866_1486_1896 136
112 3300053739 Ga0500587_022052 Ga0500587_022052_190_600 136
113 3300061719 Ga0466962_0001879 Ga0466962_0001879_8998_9408 136
114 2162886012 MBSR1b_contig_5120920 MBSR1b_0061.00007640 137
115 3300002773 JGI25152J39213_1000902 JGI25152J39213_100090218 137
116 3300002774 JGI25150J39212_1000529 JGI25150J39212_100052918 137
117 3300002987 JGI25159J45721_1000714 JGI25159J45721_10007144 137
118 3300002987 JGI25159J45721_1015530 JGI25159J45721_10155303 137
119 3300003187 JGI25151J46595_10001672 JGI25151J46595_1000167218 137
120 3300003215 JGI25153J46596_10001378 JGI25153J46596_1000137818 137
121 3300003316 rootH1_10084038 rootH1_100840382 137
122 3300003354 JGI25160J50197_1000504 JGI25160J50197_100050414 137
123 3300003354 JGI25160J50197_1001019 JGI25160J50197_100101918 137
124 3300003354 JGI25160J50197_1016594 JGI25160J50197_10165942 137
125 3300003374 JGI25161J50226_1001946 JGI25161J50226_10019466 137
126 3300003374 JGI25161J50226_1007453 JGI25161J50226_10074532 137
127 3300003752 Ga0055539_1023106 Ga0055539_10231061 137
128 3300003761 Ga0055535_1000544 Ga0055535_100054427 137
129 3300003762 Ga0055542_1000004 Ga0055542_1000004479 137
130 3300003771 Ga0055526_1001885 Ga0055526_100188518 137
131 3300003771 Ga0055526_1020268 Ga0055526_10202684 137
132 3300003773 Ga0055537_1000532 Ga0055537_100053218 137
133 3300003773 Ga0055537_1021503 Ga0055537_10215032 137
134 3300003775 Ga0055524_1001312 Ga0055524_100131218 137
135 3300003775 Ga0055524_1003577 Ga0055524_10035773 137
136 3300003775 Ga0055524_1008003 Ga0055524_10080034 137
137 3300003781 Ga0055536_1001009 Ga0055536_100100912 137
138 3300003784 Ga0055534_1000806 Ga0055534_100080618 137
139 3300003784 Ga0055534_1006267 Ga0055534_10062672 137
140 3300003790 Ga0055528_1000780 Ga0055528_100078018 137
141 3300003790 Ga0055528_1016555 Ga0055528_10165554 137
142 3300003791 Ga0055530_10000730 Ga0055530_1000073012 137
143 3300003791 Ga0055530_10001183 Ga0055530_1000118315 137
144 3300003792 Ga0055540_1001469 Ga0055540_10014696 137
145 3300003792 Ga0055540_1005496 Ga0055540_10054966 137
146 3300003794 Ga0055531_10002619 Ga0055531_100026194 137
147 3300003794 Ga0055531_10008256 Ga0055531_100082564 137
148 3300004625 Ga0055543_1000702 Ga0055543_100070212 137
149 3300004625 Ga0055543_1001310 Ga0055543_10013107 137
150 3300005262 Ga0065165_1002519 Ga0065165_10025194 137
151 3300005262 Ga0065165_1016865 Ga0065165_10168653 137
152 3300005262 Ga0065165_1024980 Ga0065165_10249802 137
153 3300005288 Ga0065714_10404806 Ga0065714_104048061 137
154 3300005293 Ga0065715_10136549 Ga0065715_101365494 137
155 3300005327 Ga0070658_10005436 Ga0070658_100054366 137
156 3300005328 Ga0070676_10067141 Ga0070676_100671414 137
157 3300005331 Ga0070670_100061462 Ga0070670_1000614621 137
158 3300005331 Ga0070670_100065897 Ga0070670_1000658973 137
159 3300005331 Ga0070670_100136746 Ga0070670_1001367462 137
160 3300005333 Ga0070677_10011531 Ga0070677_100115314 137
161 3300005334 Ga0068869_100367635 Ga0068869_1003676352 137
162 3300005334 Ga0068869_101690182 Ga0068869_1016901821 137
163 3300005335 Ga0070666_10000008 Ga0070666_1000000885 137
164 3300005344 Ga0070661_100013390 Ga0070661_1000133902 137
165 3300005347 Ga0070668_100026997 Ga0070668_1000269974 137
166 3300005347 Ga0070668_100787774 Ga0070668_1007877742 137
167 3300005347 Ga0070668_101231803 Ga0070668_1012318031 137
168 3300005353 Ga0070669_100022638 Ga0070669_1000226384 137
169 3300005353 Ga0070669_100118587 Ga0070669_1001185872 137
170 3300005354 Ga0070675_100000730 Ga0070675_1000007306 137
171 3300005355 Ga0070671_100002821 Ga0070671_10000282113 137
172 3300005355 Ga0070671_100034351 Ga0070671_1000343512 137
173 3300005355 Ga0070671_100234860 Ga0070671_1002348603 137
174 3300005355 Ga0070671_100781906 Ga0070671_1007819061 137
175 3300005356 Ga0070674_101268572 Ga0070674_1012685721 137
176 3300005364 Ga0070673_100016466 Ga0070673_1000164665 137
177 3300005364 Ga0070673_100087038 Ga0070673_1000870383 137
178 3300005364 Ga0070673_100429956 Ga0070673_1004299562 137
179 3300005367 Ga0070667_100023464 Ga0070667_1000234644 137
180 3300005367 Ga0070667_100035512 Ga0070667_1000355125 137
181 3300005367 Ga0070667_100230615 Ga0070667_1002306153 137
182 3300005367 Ga0070667_100412982 Ga0070667_1004129821 137
183 3300005367 Ga0070667_100457391 Ga0070667_1004573912 137
184 3300005367 Ga0070667_100701117 Ga0070667_1007011172 137
185 3300005367 Ga0070667_101396241 Ga0070667_1013962411 137
186 3300005367 Ga0070667_101416414 Ga0070667_1014164141 137
187 3300005445 Ga0070708_100173250 Ga0070708_1001732504 137
188 3300005445 Ga0070708_100289057 Ga0070708_1002890573 137
189 3300005455 Ga0070663_100003812 Ga0070663_1000038129 137
190 3300005456 Ga0070678_100011111 Ga0070678_1000111115 137
191 3300005457 Ga0070662_100224876 Ga0070662_1002248762 137
192 3300005457 Ga0070662_100403870 Ga0070662_1004038702 137
193 3300005459 Ga0068867_100001685 Ga0068867_1000016856 137
194 3300005459 Ga0068867_100020669 Ga0068867_1000206696 137
195 3300005459 Ga0068867_100243945 Ga0068867_1002439453 137
196 3300005467 Ga0070706_100000297 Ga0070706_10000029728 137
197 3300005468 Ga0070707_100016306 Ga0070707_1000163065 137
198 3300005471 Ga0070698_100156206 Ga0070698_1001562065 137
199 3300005536 Ga0070697_101469464 Ga0070697_1014694642 137
200 3300005539 Ga0068853_100001340 Ga0068853_1000013406 137
201 3300005539 Ga0068853_100059971 Ga0068853_1000599712 137
202 3300005539 Ga0068853_100398065 Ga0068853_1003980652 137
203 3300005543 Ga0070672_100000424 Ga0070672_1000004244 137
204 3300005548 Ga0070665_100009026 Ga0070665_1000090266 137
205 3300005548 Ga0070665_100363659 Ga0070665_1003636593 137
206 3300005548 Ga0070665_100687013 Ga0070665_1006870132 137
207 3300005548 Ga0070665_100841690 Ga0070665_1008416901 137
208 3300005548 Ga0070665_100932919 Ga0070665_1009329192 137
209 3300005563 Ga0068855_100123638 Ga0068855_1001236382 137
210 3300005563 Ga0068855_100150995 Ga0068855_1001509953 137
211 3300005564 Ga0070664_100096689 Ga0070664_1000966894 137
212 3300005564 Ga0070664_100457789 Ga0070664_1004577892 137
213 3300005564 Ga0070664_101272953 Ga0070664_1012729531 137
214 3300005577 Ga0068857_100018893 Ga0068857_1000188938 137
215 3300005577 Ga0068857_100285909 Ga0068857_1002859092 137
216 3300005577 Ga0068857_100763917 Ga0068857_1007639172 137
217 3300005578 Ga0068854_100073055 Ga0068854_1000730552 137
218 3300005578 Ga0068854_100649103 Ga0068854_1006491032 137
219 3300005614 Ga0068856_100482528 Ga0068856_1004825282 137
220 3300005614 Ga0068856_101101422 Ga0068856_1011014222 137
221 3300005616 Ga0068852_100045272 Ga0068852_1000452722 137
222 3300005616 Ga0068852_100172206 Ga0068852_1001722063 137
223 3300005617 Ga0068859_100538291 Ga0068859_1005382912 137
224 3300005618 Ga0068864_100022500 Ga0068864_1000225004 137
225 3300005618 Ga0068864_100240584 Ga0068864_1002405843 137
226 3300005718 Ga0068866_10043543 Ga0068866_100435432 137
227 3300005719 Ga0068861_100009698 Ga0068861_1000096986 137
228 3300005834 Ga0068851_10014519 Ga0068851_100145193 137
229 3300005834 Ga0068851_10111571 Ga0068851_101115713 137
230 3300005841 Ga0068863_100276597 Ga0068863_1002765972 137
231 3300005841 Ga0068863_101031522 Ga0068863_1010315222 137
232 3300005841 Ga0068863_102127948 Ga0068863_1021279481 137
233 3300005842 Ga0068858_100252152 Ga0068858_1002521522 137
234 3300005843 Ga0068860_100134545 Ga0068860_1001345452 137
235 3300005843 Ga0068860_100262900 Ga0068860_1002629001 137
236 3300005843 Ga0068860_100304562 Ga0068860_1003045621 137
237 3300005843 Ga0068860_101225147 Ga0068860_1012251472 137
238 3300005844 Ga0068862_100114031 Ga0068862_1001140313 137
239 3300005844 Ga0068862_100177327 Ga0068862_1001773272 137
240 3300005937 Ga0081455_10779102 Ga0081455_107791021 137
241 3300006038 Ga0075365_10039463 Ga0075365_100394634 137
242 3300006038 Ga0075365_10052571 Ga0075365_100525711 137
243 3300006038 Ga0075365_10239282 Ga0075365_102392822 137
244 3300006042 Ga0075368_10007174 Ga0075368_100071746 137
245 3300006042 Ga0075368_10119702 Ga0075368_101197022 137
246 3300006048 Ga0075363_100001650 Ga0075363_10000165010 137
247 3300006048 Ga0075363_100373831 Ga0075363_1003738311 137
248 3300006051 Ga0075364_10160045 Ga0075364_101600454 137
249 3300006051 Ga0075364_10218217 Ga0075364_102182172 137
250 3300006051 Ga0075364_10243112 Ga0075364_102431122 137
251 3300006051 Ga0075364_10869892 Ga0075364_108698921 137
252 3300006177 Ga0075362_10002752 Ga0075362_100027524 137
253 3300006177 Ga0075362_10056719 Ga0075362_100567192 137
254 3300006177 Ga0075362_10589839 Ga0075362_105898391 137
255 3300006178 Ga0075367_10054447 Ga0075367_100544472 137
256 3300006178 Ga0075367_10111355 Ga0075367_101113554 137
257 3300006178 Ga0075367_10116181 Ga0075367_101161813 137
258 3300006178 Ga0075367_10125088 Ga0075367_101250882 137
259 3300006178 Ga0075367_10142242 Ga0075367_101422422 137
260 3300006178 Ga0075367_10217764 Ga0075367_102177642 137
261 3300006178 Ga0075367_10936405 Ga0075367_109364051 137
262 3300006186 Ga0075369_10172125 Ga0075369_101721252 137
263 3300006186 Ga0075369_10184095 Ga0075369_101840952 137
264 3300006195 Ga0075366_10024798 Ga0075366_100247984 137
265 3300006195 Ga0075366_10035548 Ga0075366_100355482 137
266 3300006195 Ga0075366_10169770 Ga0075366_101697703 137
267 3300006237 Ga0097621_100004522 Ga0097621_1000045222 137
268 3300006237 Ga0097621_100954044 Ga0097621_1009540442 137
269 3300006353 Ga0075370_10004005 Ga0075370_100040054 137
270 3300006353 Ga0075370_10051002 Ga0075370_100510024 137
271 3300006353 Ga0075370_10112829 Ga0075370_101128293 137
272 3300006358 Ga0068871_100027319 Ga0068871_1000273194 137
273 3300006358 Ga0068871_101506224 Ga0068871_1015062241 137
274 3300006931 Ga0097620_100538283 Ga0097620_1005382832 137
275 3300006942 Ga0099824_1016622 Ga0099824_10166228 137
276 3300009092 Ga0105250_10168069 Ga0105250_101680692 137
277 3300009093 Ga0105240_10024486 Ga0105240_100244865 137
278 3300009093 Ga0105240_10294803 Ga0105240_102948032 137
279 3300009093 Ga0105240_10361675 Ga0105240_103616752 137
280 3300009098 Ga0105245_10136564 Ga0105245_101365642 137
281 3300009098 Ga0105245_12248933 Ga0105245_122489331 137
282 3300009101 Ga0105247_10123462 Ga0105247_101234622 137
283 3300009101 Ga0105247_10573530 Ga0105247_105735302 137
284 3300009148 Ga0105243_10048008 Ga0105243_100480084 137
285 3300009148 Ga0105243_10256053 Ga0105243_102560532 137
286 3300009174 Ga0105241_10089422 Ga0105241_100894222 137
287 3300009174 Ga0105241_10281550 Ga0105241_102815502 137
288 3300009177 Ga0105248_10099852 Ga0105248_100998522 137
289 3300009177 Ga0105248_11194399 Ga0105248_111943992 137
290 3300009545 Ga0105237_10001770 Ga0105237_1000177023 137
291 3300009545 Ga0105237_10035674 Ga0105237_100356744 137
292 3300009545 Ga0105237_10342649 Ga0105237_103426493 137
293 3300009545 Ga0105237_11699223 Ga0105237_116992231 137
294 3300009551 Ga0105238_10000178 Ga0105238_1000017816 137
295 3300009553 Ga0105249_10154357 Ga0105249_101543572 137
296 3300010375 Ga0105239_10089934 Ga0105239_100899343 137
297 3300010375 Ga0105239_10233941 Ga0105239_102339412 137
298 3300010375 Ga0105239_10238225 Ga0105239_102382251 137
299 3300010375 Ga0105239_11163119 Ga0105239_111631192 137
300 3300010375 Ga0105239_11571551 Ga0105239_115715512 137
301 3300011119 Ga0105246_10041441 Ga0105246_100414412 137
302 3300012502 Ga0157347_1024357 Ga0157347_10243572 137
303 3300013100 Ga0157373_10926955 Ga0157373_109269551 137
304 3300013102 Ga0157371_10018923 Ga0157371_100189235 137
305 3300013102 Ga0157371_10948339 Ga0157371_109483391 137
306 3300013105 Ga0157369_10003369 Ga0157369_1000336917 137
307 3300013296 Ga0157374_10051371 Ga0157374_100513713 137
308 3300013297 Ga0157378_10763151 Ga0157378_107631512 137
309 3300013306 Ga0163162_10000110 Ga0163162_100001105 137
310 3300013306 Ga0163162_10210147 Ga0163162_102101471 137
311 3300013306 Ga0163162_10752281 Ga0163162_107522812 137
312 3300013306 Ga0163162_12338517 Ga0163162_123385172 137
313 3300013307 Ga0157372_10113515 Ga0157372_101135154 137
314 3300013308 Ga0157375_10028467 Ga0157375_100284672 137
315 3300013308 Ga0157375_10036930 Ga0157375_100369302 137
316 3300014325 Ga0163163_10138673 Ga0163163_101386733 137
317 3300014325 Ga0163163_10361097 Ga0163163_103610972 137
318 3300014497 Ga0182008_10654775 Ga0182008_106547751 137
319 3300014968 Ga0157379_10172435 Ga0157379_101724352 137
320 3300014968 Ga0157379_11789756 Ga0157379_117897561 137
321 3300014969 Ga0157376_10026499 Ga0157376_100264993 137
322 3300014969 Ga0157376_10104600 Ga0157376_101046002 137
323 3300014969 Ga0157376_11968383 Ga0157376_119683831 137
324 3300017792 Ga0163161_10014561 Ga0163161_100145614 137
325 3300025208 Ga0209436_101892 Ga0209436_1018924 137
326 3300025208 Ga0209436_105876 Ga0209436_1058764 137
327 3300025228 Ga0209672_100230 Ga0209672_1002303 137
328 3300025242 Ga0209258_100022 Ga0209258_100022479 137
329 3300025245 Ga0207425_1000392 Ga0207425_100039221 137
330 3300025245 Ga0207425_1002099 Ga0207425_10020997 137
331 3300025245 Ga0207425_1063360 Ga0207425_10633601 137
332 3300025253 Ga0209677_114264 Ga0209677_1142641 137
333 3300025253 Ga0209677_123473 Ga0209677_1234731 137
334 3300025254 Ga0209148_1000034 Ga0209148_1000034479 137
335 3300025254 Ga0209148_1027039 Ga0209148_10270391 137
336 3300025258 Ga0209129_1000111 Ga0209129_100011135 137
337 3300025258 Ga0209129_1009569 Ga0209129_10095693 137
338 3300025261 Ga0209233_1002734 Ga0209233_10027342 137
339 3300025263 Ga0209565_1000146 Ga0209565_100014643 137
340 3300025263 Ga0209565_1007086 Ga0209565_10070862 137
341 3300025273 Ga0209673_1001463 Ga0209673_100146318 137
342 3300025273 Ga0209673_1003920 Ga0209673_10039202 137
343 3300025273 Ga0209673_1079023 Ga0209673_10790231 137
344 3300025284 Ga0209130_1000470 Ga0209130_100047025 137
345 3300025284 Ga0209130_1000492 Ga0209130_100049215 137
346 3300025284 Ga0209130_1004038 Ga0209130_10040385 137
347 3300025291 Ga0209675_1000331 Ga0209675_100033122 137
348 3300025291 Ga0209675_1010206 Ga0209675_10102062 137
349 3300025291 Ga0209675_1010601 Ga0209675_10106012 137
350 3300025292 Ga0209676_1000005 Ga0209676_1000005221 137
351 3300025294 Ga0209025_1000116 Ga0209025_100011643 137
352 3300025295 Ga0209564_1000155 Ga0209564_100015543 137
353 3300025295 Ga0209564_1000292 Ga0209564_100029276 137
354 3300025295 Ga0209564_1050065 Ga0209564_10500652 137
355 3300025297 Ga0209758_1000107 Ga0209758_100010743 137
356 3300025297 Ga0209758_1000560 Ga0209758_100056017 137
357 3300025297 Ga0209758_1014068 Ga0209758_10140684 137
358 3300025297 Ga0209758_1023566 Ga0209758_10235663 137
359 3300025297 Ga0209758_1031638 Ga0209758_10316383 137
360 3300025298 Ga0209050_1000007 Ga0209050_1000007876 137
361 3300025299 Ga0209256_1000038 Ga0209256_100003881 137
362 3300025299 Ga0209256_1000087 Ga0209256_100008743 137
363 3300025302 Ga0207426_1000090 Ga0207426_100009032 137
364 3300025302 Ga0207426_1000123 Ga0207426_100012343 137
365 3300025302 Ga0207426_1000721 Ga0207426_100072113 137
366 3300025302 Ga0207426_1002233 Ga0207426_10022336 137
367 3300025303 Ga0209051_1000009 Ga0209051_1000009221 137
368 3300025303 Ga0209051_1004594 Ga0209051_10045948 137
369 3300025304 Ga0209257_1000011 Ga0209257_1000011195 137
370 3300025304 Ga0209257_1001961 Ga0209257_100196118 137
371 3300025304 Ga0209257_1021240 Ga0209257_10212402 137
372 3300025315 Ga0207697_10010315 Ga0207697_100103152 137
373 3300025321 Ga0207656_10024934 Ga0207656_100249341 137
374 3300025893 Ga0207682_10003155 Ga0207682_100031557 137
375 3300025900 Ga0207710_10129595 Ga0207710_101295951 137
376 3300025901 Ga0207688_10133648 Ga0207688_101336482 137
377 3300025903 Ga0207680_10000005 Ga0207680_10000005151 137
378 3300025904 Ga0207647_10011713 Ga0207647_100117136 137
379 3300025907 Ga0207645_10026326 Ga0207645_100263264 137
380 3300025907 Ga0207645_10298781 Ga0207645_102987811 137
381 3300025908 Ga0207643_10004555 Ga0207643_100045552 137
382 3300025909 Ga0207705_10023654 Ga0207705_100236543 137
383 3300025909 Ga0207705_10027327 Ga0207705_100273273 137
384 3300025910 Ga0207684_10005581 Ga0207684_100055818 137
385 3300025911 Ga0207654_10050199 Ga0207654_100501994 137
386 3300025911 Ga0207654_10811583 Ga0207654_108115831 137
387 3300025913 Ga0207695_10070556 Ga0207695_100705562 137
388 3300025913 Ga0207695_10135301 Ga0207695_101353012 137
389 3300025914 Ga0207671_10082541 Ga0207671_100825412 137
390 3300025914 Ga0207671_10107312 Ga0207671_101073123 137
391 3300025914 Ga0207671_11133110 Ga0207671_111331101 137
392 3300025919 Ga0207657_10135966 Ga0207657_101359663 137
393 3300025920 Ga0207649_10016493 Ga0207649_100164936 137
394 3300025920 Ga0207649_10054356 Ga0207649_100543562 137
395 3300025920 Ga0207649_11078196 Ga0207649_110781961 137
396 3300025922 Ga0207646_10800759 Ga0207646_108007592 137
397 3300025923 Ga0207681_10204591 Ga0207681_102045912 137
398 3300025924 Ga0207694_10000187 Ga0207694_100001877 137
399 3300025925 Ga0207650_10001814 Ga0207650_1000181413 137
400 3300025925 Ga0207650_10159196 Ga0207650_101591963 137
401 3300025926 Ga0207659_10000544 Ga0207659_100005443 137
402 3300025927 Ga0207687_10011700 Ga0207687_100117002 137
403 3300025927 Ga0207687_11439329 Ga0207687_114393291 137
404 3300025931 Ga0207644_10009377 Ga0207644_100093772 137
405 3300025931 Ga0207644_10184661 Ga0207644_101846613 137
406 3300025932 Ga0207690_10800956 Ga0207690_108009562 137
407 3300025933 Ga0207706_10093896 Ga0207706_100938961 137
408 3300025933 Ga0207706_10155947 Ga0207706_101559473 137
409 3300025933 Ga0207706_10766204 Ga0207706_107662042 137
410 3300025935 Ga0207709_10040458 Ga0207709_100404584 137
411 3300025935 Ga0207709_10730037 Ga0207709_107300372 137
412 3300025937 Ga0207669_11845511 Ga0207669_118455111 137
413 3300025940 Ga0207691_10000186 Ga0207691_1000018625 137
414 3300025941 Ga0207711_10123427 Ga0207711_101234272 137
415 3300025942 Ga0207689_10099054 Ga0207689_100990542 137
416 3300025942 Ga0207689_10102890 Ga0207689_101028904 137
417 3300025942 Ga0207689_10164947 Ga0207689_101649471 137
418 3300025942 Ga0207689_10200495 Ga0207689_102004953 137
419 3300025945 Ga0207679_10067762 Ga0207679_100677622 137
420 3300025945 Ga0207679_10099579 Ga0207679_100995793 137
421 3300025949 Ga0207667_10063180 Ga0207667_100631805 137
422 3300025949 Ga0207667_10291743 Ga0207667_102917433 137
423 3300025960 Ga0207651_10276936 Ga0207651_102769361 137
424 3300025960 Ga0207651_10288782 Ga0207651_102887822 137
425 3300025961 Ga0207712_10758076 Ga0207712_107580762 137
426 3300025972 Ga0207668_10527235 Ga0207668_105272351 137
427 3300025972 Ga0207668_11380235 Ga0207668_113802352 137
428 3300025981 Ga0207640_10057513 Ga0207640_100575134 137
429 3300025981 Ga0207640_10587450 Ga0207640_105874501 137
430 3300025986 Ga0207658_10068331 Ga0207658_100683314 137
431 3300025986 Ga0207658_10079792 Ga0207658_100797922 137
432 3300025986 Ga0207658_10111212 Ga0207658_101112121 137
433 3300025986 Ga0207658_10166589 Ga0207658_101665892 137
434 3300025986 Ga0207658_11022758 Ga0207658_110227582 137
435 3300025986 Ga0207658_11279264 Ga0207658_112792641 137
436 3300025986 Ga0207658_11819689 Ga0207658_118196891 137
437 3300026023 Ga0207677_11060663 Ga0207677_110606632 137
438 3300026035 Ga0207703_10377016 Ga0207703_103770162 137
439 3300026041 Ga0207639_10013550 Ga0207639_100135504 137
440 3300026041 Ga0207639_10378590 Ga0207639_103785902 137
441 3300026041 Ga0207639_10422403 Ga0207639_104224032 137
442 3300026067 Ga0207678_10158522 Ga0207678_101585223 137
443 3300026078 Ga0207702_10276208 Ga0207702_102762083 137
444 3300026078 Ga0207702_10294328 Ga0207702_102943282 137
445 3300026078 Ga0207702_10970656 Ga0207702_109706561 137
446 3300026088 Ga0207641_10093821 Ga0207641_100938212 137
447 3300026088 Ga0207641_10254720 Ga0207641_102547203 137
448 3300026088 Ga0207641_11843481 Ga0207641_118434812 137
449 3300026089 Ga0207648_10000629 Ga0207648_1000062928 137
450 3300026089 Ga0207648_10134043 Ga0207648_101340432 137
451 3300026089 Ga0207648_10256265 Ga0207648_102562653 137
452 3300026095 Ga0207676_10317132 Ga0207676_103171322 137
453 3300026095 Ga0207676_11522550 Ga0207676_115225501 137
454 3300026116 Ga0207674_10022322 Ga0207674_100223223 137
455 3300026116 Ga0207674_10117439 Ga0207674_101174392 137
456 3300026116 Ga0207674_10455243 Ga0207674_104552432 137
457 3300026118 Ga0207675_101163692 Ga0207675_1011636921 137
458 3300026121 Ga0207683_10010974 Ga0207683_100109744 137
459 3300026121 Ga0207683_10187908 Ga0207683_101879082 137
460 3300026142 Ga0207698_10149897 Ga0207698_101498973 137
461 3300026142 Ga0207698_11105065 Ga0207698_111050652 137
462 3300027296 Ga0209389_1000025 Ga0209389_1000025102 137
463 3300027357 Ga0209589_1000066 Ga0209589_100006651 137
464 3300027361 Ga0209489_100030 Ga0209489_10003062 137
465 3300027717 Ga0209998_10123498 Ga0209998_101234982 137
466 3300027866 Ga0209813_10018694 Ga0209813_100186942 137
467 3300027876 Ga0209974_10003650 Ga0209974_100036502 137
468 3300028379 Ga0268266_10000051 Ga0268266_10000051150 137
469 3300028379 Ga0268266_10064413 Ga0268266_100644132 137
470 3300028379 Ga0268266_10442246 Ga0268266_104422462 137
471 3300028379 Ga0268266_10581948 Ga0268266_105819482 137
472 3300028379 Ga0268266_11609506 Ga0268266_116095062 137
473 3300028379 Ga0268266_12231182 Ga0268266_122311821 137
474 3300028380 Ga0268265_10009645 Ga0268265_100096453 137
475 3300028380 Ga0268265_10053454 Ga0268265_100534543 137
476 3300028380 Ga0268265_11125856 Ga0268265_111258562 137
477 3300028381 Ga0268264_10091715 Ga0268264_100917152 137
478 3300028381 Ga0268264_10173195 Ga0268264_101731952 137
479 3300028381 Ga0268264_10945235 Ga0268264_109452351 137
480 3300028786 Ga0307517_10000024 Ga0307517_1000002472 137
481 3300028786 Ga0307517_10221165 Ga0307517_102211652 137
482 3300028794 Ga0307515_10000572 Ga0307515_1000057233 137
483 3300028794 Ga0307515_10039883 Ga0307515_100398839 137
484 3300028794 Ga0307515_10048367 Ga0307515_100483678 137
485 3300028794 Ga0307515_10097511 Ga0307515_100975115 137
486 3300028794 Ga0307515_10827884 Ga0307515_108278842 137
487 3300030736 Ga0316180_1185350 Ga0316180_11853504 137
488 3300031456 Ga0307513_10011603 Ga0307513_100116031 137
489 3300031456 Ga0307513_10019885 Ga0307513_100198858 137
490 3300031456 Ga0307513_10091911 Ga0307513_100919112 137
491 3300031456 Ga0307513_10158103 Ga0307513_101581033 137
492 3300031456 Ga0307513_10329066 Ga0307513_103290662 137
493 3300031456 Ga0307513_10621626 Ga0307513_106216261 137
494 3300031456 Ga0307513_11008989 Ga0307513_110089891 137
495 3300031507 Ga0307509_10000778 Ga0307509_1000077842 137
496 3300031507 Ga0307509_10089931 Ga0307509_100899313 137
497 3300031616 Ga0307508_10017904 Ga0307508_100179044 137
498 3300031730 Ga0307516_10011416 Ga0307516_100114165 137
499 3300031730 Ga0307516_10014057 Ga0307516_100140575 137
500 3300031730 Ga0307516_10082809 Ga0307516_100828092 137
501 3300031730 Ga0307516_10179875 Ga0307516_101798752 137
502 3300033180 Ga0307510_10049877 Ga0307510_100498773 137
503 3300037418 Ga0395900_0292066 Ga0395900_0292066_631_1044 137
504 3300037471 Ga0395905_0019296 Ga0395905_0019296_4946_5359 137
505 3300037471 Ga0395905_0076843 Ga0395905_0076843_1128_1541 137
506 3300037471 Ga0395905_0808610 Ga0395905_0808610_34_447 137
507 3300038443 Ga0395901_0112041 Ga0395901_0112041_678_1091 137
508 3300038443 Ga0395901_0268855 Ga0395901_0268855_574_987 137
509 3300041451 Ga0451791_1202226 Ga0451791_1202226_34_447 137
510 3300041452 Ga0451793_1617958 Ga0451793_1617958_448_861 137
511 3300041463 Ga0451804_0864300 Ga0451804_0864300_216_629 137
512 3300041491 Ga0451833_1488514 Ga0451833_1488514_119_532 137
513 3300041492 Ga0451835_0233361 Ga0451835_0233361_505_918 137
514 3300041501 Ga0451845_0605482 Ga0451845_0605482_377_790 137
515 3300041507 Ga0451851_1070308 Ga0451851_1070308_222_635 137
516 3300041511 Ga0451855_1272962 Ga0451855_1272962_326_739 137
517 3300041512 Ga0451853_3203472 Ga0451853_3203472_141_554 137
518 3300044656 Ga0466969_0014853 Ga0466969_0014853_1759_2172 137
519 3300044658 Ga0466972_0000807 Ga0466972_0000807_4552_4965 137
520 3300044673 Ga0453683_0905587 Ga0453683_0905587_32_445 137
521 3300044684 Ga0466966_0001348 Ga0466966_0001348_10136_10549 137
522 3300044693 Ga0466961_0000120 Ga0466961_0000120_38843_39256 137
523 3300046452 Ga0495617_158665 Ga0495617_158665_269_694 137
524 3300046459 Ga0495629_0004834 Ga0495629_0004834_8464_8877 137
525 3300046462 Ga0495651_0061972 Ga0495651_0061972_1370_1783 137
526 3300046471 Ga0495650_0005807 Ga0495650_0005807_2632_3045 137
527 3300046501 Ga0495607_0207588 Ga0495607_0207588_503_916 137
528 3300046507 Ga0495606_0054446 Ga0495606_0054446_936_1349 137
529 3300046507 Ga0495606_0209727 Ga0495606_0209727_397_810 137
530 3300046515 Ga0495620_0027728 Ga0495620_0027728_1309_1722 137
531 3300046515 Ga0495620_0362554 Ga0495620_0362554_95_508 137
532 3300046518 Ga0495631_0124431 Ga0495631_0124431_492_905 137
533 3300046518 Ga0495631_0244360 Ga0495631_0244360_326_739 137
534 3300046519 Ga0495632_0045232 Ga0495632_0045232_1033_1446 137
535 3300046519 Ga0495632_0070199 Ga0495632_0070199_307_720 137
536 3300046519 Ga0495632_0085945 Ga0495632_0085945_685_1098 137
537 3300046522 Ga0495643_0018248 Ga0495643_0018248_240_653 137
538 3300046524 Ga0495648_0135996 Ga0495648_0135996_10_423 137
539 3300046526 Ga0495666_0185742 Ga0495666_0185742_40_486 137
540 3300046615 Ga0495656_0011297 Ga0495656_0011297_1249_1662 137
541 3300046616 Ga0495668_0083471 Ga0495668_0083471_99_512 137
542 3300046616 Ga0495668_0086160 Ga0495668_0086160_687_1100 137
543 3300046616 Ga0495668_0278150 Ga0495668_0278150_23_436 137
544 3300046642 Ga0495634_0236678 Ga0495634_0236678_521_934 137
545 3300046660 Ga0495625_0004298 Ga0495625_0004298_2555_2968 137
546 3300046660 Ga0495625_0016332 Ga0495625_0016332_1462_1875 137
547 3300046660 Ga0495625_0100603 Ga0495625_0100603_1273_1686 137
548 3300046663 Ga0495635_0046740 Ga0495635_0046740_1012_1425 137
549 3300046664 Ga0495659_0141034 Ga0495659_0141034_153_566 137
550 3300046664 Ga0495659_0289622 Ga0495659_0289622_211_624 137
551 3300046674 Ga0495588_0042839 Ga0495588_0042839_313_726 137
552 3300046675 Ga0495657_0139213 Ga0495657_0139213_530_943 137
553 3300046680 Ga0495646_0112632 Ga0495646_0112632_877_1290 137
554 3300046690 Ga0495624_0840139 Ga0495624_0840139_91_504 137
555 3300046691 Ga0495670_0473822 Ga0495670_0473822_175_588 137
556 3300046694 Ga0495649_0030817 Ga0495649_0030817_2432_2845 137
557 3300046694 Ga0495649_0188890 Ga0495649_0188890_502_915 137
558 3300046809 Ga0495600_0058038 Ga0495600_0058038_780_1193 137
559 3300047315 Ga0495581_0141997 Ga0495581_0141997_496_909 137
560 3300047317 Ga0495604_0070415 Ga0495604_0070415_899_1312 137
561 3300047318 Ga0495636_0118701 Ga0495636_0118701_91_504 137
562 3300047443 Ga0495687_011038 Ga0495687_011038_3206_3619 137
563 3300047469 Ga0495673_0176623 Ga0495673_0176623_230_643 137
564 3300047472 Ga0495686_0034809 Ga0495686_0034809_2767_3180 137
565 3300047472 Ga0495686_0100780 Ga0495686_0100780_248_661 137
566 3300047673 Ga0495593_0102751 Ga0495593_0102751_213_626 137
567 3300048089 Ga0495614_0312453 Ga0495614_0312453_203_616 137
568 3300048903 Ga0496100_0272880 Ga0496100_0272880_772_1185 137
569 3300048903 Ga0496100_0581477 Ga0496100_0581477_302_715 137
570 3300048904 Ga0496101_0129363 Ga0496101_0129363_538_951 137
571 3300048904 Ga0496101_0506490 Ga0496101_0506490_234_647 137
572 3300048905 Ga0496102_0034116 Ga0496102_0034116_1887_2300 137
573 3300048905 Ga0496102_0209752 Ga0496102_0209752_553_966 137
574 3300048906 Ga0496103_0002701 Ga0496103_0002701_658_1071 137
575 3300048907 Ga0496104_0075514 Ga0496104_0075514_1457_1870 137
576 3300048908 Ga0496105_0099818 Ga0496105_0099818_187_600 137
577 3300048908 Ga0496105_0145330 Ga0496105_0145330_702_1115 137
578 3300048909 Ga0496106_0609890 Ga0496106_0609890_12_425 137
579 3300048910 Ga0496107_0651931 Ga0496107_0651931_116_529 137
580 3300048911 Ga0496108_0010766 Ga0496108_0010766_6967_7380 137
581 3300048911 Ga0496108_0083771 Ga0496108_0083771_821_1234 137
582 3300048911 Ga0496108_1370920 Ga0496108_1370920_159_581 137
583 3300048912 Ga0496109_0053400 Ga0496109_0053400_3104_3517 137
584 3300048912 Ga0496109_1150309 Ga0496109_1150309_260_685 137
585 3300048915 Ga0496112_0111850 Ga0496112_0111850_742_1155 137
586 3300048915 Ga0496112_0134434 Ga0496112_0134434_1522_1935 137
587 3300048915 Ga0496112_0256141 Ga0496112_0256141_715_1128 137
588 3300048916 Ga0496113_0111091 Ga0496113_0111091_1074_1487 137
589 3300048916 Ga0496113_0121398 Ga0496113_0121398_629_1042 137
590 3300048916 Ga0496113_0438421 Ga0496113_0438421_325_738 137
591 3300048918 Ga0496115_0146479 Ga0496115_0146479_740_1153 137
592 3300048918 Ga0496115_0997367 Ga0496115_0997367_43_456 137
593 3300048920 Ga0496117_0053343 Ga0496117_0053343_1858_2280 137
594 3300048920 Ga0496117_0118188 Ga0496117_0118188_562_975 137
595 3300048920 Ga0496117_0401008 Ga0496117_0401008_193_606 137
596 3300048921 Ga0496118_0018021 Ga0496118_0018021_4646_5059 137
597 3300048921 Ga0496118_0026318 Ga0496118_0026318_4094_4516 137
598 3300048921 Ga0496118_0056090 Ga0496118_0056090_109_522 137
599 3300048921 Ga0496118_0068786 Ga0496118_0068786_1725_2138 137
600 3300048921 Ga0496118_0149727 Ga0496118_0149727_877_1293 137
601 3300048922 Ga0496119_0011409 Ga0496119_0011409_1225_1638 137
602 3300048922 Ga0496119_0082411 Ga0496119_0082411_253_666 137
603 3300048922 Ga0496119_0147315 Ga0496119_0147315_672_1085 137
604 3300048923 Ga0496120_0110715 Ga0496120_0110715_255_668 137
605 3300048924 Ga0496121_0209690 Ga0496121_0209690_743_1156 137
606 3300048924 Ga0496121_0352834 Ga0496121_0352834_358_771 137
607 3300048925 Ga0496122_0370153 Ga0496122_0370153_163_576 137
608 3300048927 Ga0496124_0039510 Ga0496124_0039510_2913_3335 137
609 3300048928 Ga0496125_0076413 Ga0496125_0076413_1694_2116 137
610 3300048928 Ga0496125_0094222 Ga0496125_0094222_1548_1961 137
611 3300048928 Ga0496125_0311952 Ga0496125_0311952_48_461 137
612 3300048929 Ga0496126_0048730 Ga0496126_0048730_2488_2901 137
613 3300048929 Ga0496126_0063564 Ga0496126_0063564_2645_3058 137
614 3300048929 Ga0496126_0108826 Ga0496126_0108826_567_980 137
615 3300048929 Ga0496126_0440086 Ga0496126_0440086_105_518 137
616 3300049460 Ga0495682_0344314 Ga0495682_0344314_41_454 137
617 3300049571 Ga0501034_0460748 Ga0501034_0460748_261_680 137
618 3300049660 Ga0501216_106498 Ga0501216_106498_63_491 137
619 3300050489 nmdc:mga03683_123032_c1 nmdc:mga03683_123032_c1_153_566 137
620 3300050489 nmdc:mga03683_245606_c1 nmdc:mga03683_245606_c1_272_685 137
621 3300050489 nmdc:mga03683_57034_c1 nmdc:mga03683_57034_c1_1155_1568 137
622 3300050490 nmdc:mga03n38_110225_c1 nmdc:mga03n38_110225_c1_699_1112 137
623 3300050490 nmdc:mga03n38_140241_c1 nmdc:mga03n38_140241_c1_420_833 137
624 3300050490 nmdc:mga03n38_152399_c1 nmdc:mga03n38_152399_c1_44_457 137
625 3300050491 nmdc:mga00v17_114811_c1 nmdc:mga00v17_114811_c1_1183_1596 137
626 3300050491 nmdc:mga00v17_44386_c1 nmdc:mga00v17_44386_c1_1698_2111 137
627 3300050491 nmdc:mga00v17_93241_c1 nmdc:mga00v17_93241_c1_899_1312 137
628 3300050492 nmdc:mga0yw44_11693_c1 nmdc:mga0yw44_11693_c1_260_673 137
629 3300050492 nmdc:mga0yw44_243591_c1 nmdc:mga0yw44_243591_c1_717_1130 137
630 3300050493 nmdc:mga0k408_124922_c1 nmdc:mga0k408_124922_c1_307_720 137
631 3300050493 nmdc:mga0k408_161149_c1 nmdc:mga0k408_161149_c1_552_965 137
632 3300050493 nmdc:mga0k408_33345_c1 nmdc:mga0k408_33345_c1_1259_1672 137
633 3300050493 nmdc:mga0k408_37301_c1 nmdc:mga0k408_37301_c1_154_624 137
634 3300050493 nmdc:mga0k408_67221_c1 nmdc:mga0k408_67221_c1_650_1063 137
635 3300050494 nmdc:mga06z11_130566_c1 nmdc:mga06z11_130566_c1_717_1130 137
636 3300050494 nmdc:mga06z11_191815_c1 nmdc:mga06z11_191815_c1_407_877 137
637 3300050494 nmdc:mga06z11_35955_c1 nmdc:mga06z11_35955_c1_331_744 137
638 3300050494 nmdc:mga06z11_74027_c1 nmdc:mga06z11_74027_c1_696_1109 137
639 3300050494 nmdc:mga06z11_820207_c1 nmdc:mga06z11_820207_c1_60_473 137
640 3300050495 nmdc:mga04h51_123430_c1 nmdc:mga04h51_123430_c1_423_836 137
641 3300050495 nmdc:mga04h51_22238_c1 nmdc:mga04h51_22238_c1_497_910 137
642 3300050495 nmdc:mga04h51_90079_c1 nmdc:mga04h51_90079_c1_106_519 137
643 3300050496 nmdc:mga07m45_31269_c1 nmdc:mga07m45_31269_c1_2023_2493 137
644 3300050496 nmdc:mga07m45_555983_c1 nmdc:mga07m45_555983_c1_92_505 137
645 3300050496 nmdc:mga07m45_6469_c1 nmdc:mga07m45_6469_c1_3981_4394 137
646 3300050496 nmdc:mga07m45_74294_c1 nmdc:mga07m45_74294_c1_808_1221 137
647 3300050513 nmdc:mga0rr50_789168_c1 nmdc:mga0rr50_789168_c1_217_687 137
648 3300050516 nmdc:mga0sz30_109954_c1 nmdc:mga0sz30_109954_c1_67_480 137
649 3300050516 nmdc:mga0sz30_183411_c1 nmdc:mga0sz30_183411_c1_385_798 137
650 3300050516 nmdc:mga0sz30_248552_c1 nmdc:mga0sz30_248552_c1_278_748 137
651 3300050516 nmdc:mga0sz30_27135_c1 nmdc:mga0sz30_27135_c1_1565_1978 137
652 3300050516 nmdc:mga0sz30_464763_c1 nmdc:mga0sz30_464763_c1_73_498 137
653 3300053077 Ga0495601_0734711 Ga0495601_0734711_110_523 137
654 3300053079 Ga0500610_0002738 Ga0500610_0002738_4286_4699 137
655 3300053079 Ga0500610_0143202 Ga0500610_0143202_374_859 137
656 3300053079 Ga0500610_0244925 Ga0500610_0244925_266_679 137
657 3300053085 Ga0495619_1062312 Ga0495619_1062312_88_501 137
658 3300053086 Ga0500578_0124204 Ga0500578_0124204_465_878 137
659 3300053091 Ga0500647_0138368 Ga0500647_0138368_184_597 137
660 3300053091 Ga0500647_0201837 Ga0500647_0201837_41_454 137
661 3300053092 Ga0500583_0023891 Ga0500583_0023891_520_933 137
662 3300053092 Ga0500583_0026123 Ga0500583_0026123_1250_1663 137
663 3300053093 Ga0500651_0141773 Ga0500651_0141773_902_1315 137
664 3300053094 Ga0500566_0158471 Ga0500566_0158471_293_706 137
665 3300053095 Ga0500640_023004 Ga0500640_023004_1545_1958 137
666 3300053096 Ga0500641_0347308 Ga0500641_0347308_89_502 137
667 3300053097 Ga0500648_338574 Ga0500648_338574_178_591 137
668 3300053109 Ga0500569_003017 Ga0500569_003017_2175_2588 137
669 3300053111 Ga0500572_106961 Ga0500572_106961_250_663 137
670 3300053119 Ga0500595_013952 Ga0500595_013952_554_967 137
671 3300053119 Ga0500595_032100 Ga0500595_032100_185_598 137
672 3300053121 Ga0500607_006049 Ga0500607_006049_5992_6405 137
673 3300053121 Ga0500607_011476 Ga0500607_011476_907_1320 137
674 3300053122 Ga0500608_161459 Ga0500608_161459_540_953 137
675 3300053123 Ga0500614_179891 Ga0500614_179891_110_523 137
676 3300053131 Ga0500652_086492 Ga0500652_086492_807_1232 137
677 3300053134 Ga0500658_0086002 Ga0500658_0086002_253_666 137
678 3300053136 Ga0500559_0013563 Ga0500559_0013563_1671_2084 137
679 3300053139 Ga0500568_0006793 Ga0500568_0006793_1640_2053 137
680 3300053148 Ga0500590_137134 Ga0500590_137134_102_515 137
681 3300053153 Ga0500616_0189413 Ga0500616_0189413_120_533 137
682 3300053154 Ga0500619_151015 Ga0500619_151015_134_547 137
683 3300053155 Ga0500620_020852 Ga0500620_020852_709_1122 137
684 3300053163 Ga0500639_217339 Ga0500639_217339_175_588 137
685 3300053177 Ga0500636_0000076 Ga0500636_0000076_36213_36626 137
686 3300053727 Ga0500611_002748 Ga0500611_002748_765_1178 137
687 3300053739 Ga0500587_000134 Ga0500587_000134_6040_6453 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

45

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.9163 3 137
4hr6-assembly1.cif.gz_B crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips 0.8514 58 88
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8509 3 137
2jjr-assembly1.cif.gz_A v232k, n236d-trichosanthin 0.8495 58 86
5y42-assembly2.cif.gz_E native-crystal structure of three chain non-toxic type ii ribosome inactivating protein purified from the seeds of trichosanthes anguina 0.8482 58 88
ID Description Score Start End Superfamily
4hr6B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8514 58 88 3.40.420.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8266 4 131 3.90.1590.10
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.825 58 85 3.40.420.10
3ku0B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8227 58 87 3.40.420.10
1yf8A01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8055 58 86 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A3S3RGJ6-F1-model_v4 GFA family protein 0.9795 5 112 GO:0016846
GO:0046872
AF-A0A7C9G102-F1-model_v4 Aldehyde-activating protein 0.9781 5 137 GO:0016846
GO:0046872
AF-A0A4R3JFK9-F1-model_v4 CENP-V/GFA domain-containing protein 0.9771 2 136 GO:0016846
GO:0046872
AF-A5EH59-F1-model_v4 deleted 0.9749 24 137
AF-A0A2P2DRP6-F1-model_v4 deleted 0.9748 38 137

Feature Viewer

pLDDT pTM Quality
93.74 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map