F475310

General Info

Members Datasets Scaffolds Average Seq Length
688 253 1376 259

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100319050|Ga0068853_1003190502
Length 280
Sequence LNRFVIRPPSFVIFIVSRYLEIYWMMIRNSLIREMSFKANFLLWIVVEFLWFVGQVVFLEVIYGHVDNIAGWSKWECVLLIGTHQITSQIFQAFFYVNLAELPELVRTGRLDLNLLLPVDAQFAVSTRKFGMDNIVNALVGVAIVVFSLAKLHVVPSAMQIALYIVAVGFGVAIHYAVLFGLATAAFWIVRAQGLIYGYFNVFNIARFPESIFPYSIFKIVFSYFIPVIIVANVPAITLARSFQSPWAGLAQLVVATVFIVSLTRAFWHFALRRYSSASS

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 7.41
Rhizosphere 91.57
Stem 0
Stem Tuber 0
Unclassified 25.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100319050 3300005539 Bacteria 1440
2 SwRhRL2b_contig_2929379 2162886007 Unclassified 1668
3 SwRhRL2b_contig_3225193 2162886007 Unclassified 3032
4 SwRhRL2b_contig_3559768 2162886007 Unclassified 2989
5 CNXas_1000054 3300000545 Bacteria 21918
6 JGI24746J21847_1004506 3300001977 Unclassified 2195
7 JGI24737J22298_10014965 3300001990 Bacteria 2513
8 JGI24750J21931_1023983 3300002070 Unclassified 868
9 JGI24035J26624_1000831 3300002126 Unclassified 2915
10 JGI24035J26624_1001587 3300002126 Unclassified 2148
11 JGI24035J26624_1005740 3300002126 Bacteria 1190
12 JGI24035J26624_1006431 3300002126 Bacteria 1134
13 JGI24034J26672_10029203 3300002239 Bacteria 892
14 JGI25406J46586_10000023 3300003203 Bacteria 76640
15 JGI25404J52841_10007566 3300003659 Bacteria 2300
16 JGI25405J52794_10004719 3300003911 Bacteria 2440
17 JGI25405J52794_10010745 3300003911 Bacteria 1746
18 Ga0065703_1019827 3300005272 Unclassified 2346
19 Ga0065704_10007112 3300005289 Bacteria 2370
20 Ga0065704_10078626 3300005289 Bacteria 4378
21 Ga0065704_10112617 3300005289 Bacteria 1913
22 Ga0065712_10008183 3300005290 Unclassified 2326
23 Ga0065712_10079225 3300005290 Bacteria 3243
24 Ga0065712_10098032 3300005290 Bacteria 2132
25 Ga0065712_10099310 3300005290 Bacteria 2095
26 Ga0065712_10172837 3300005290 Bacteria 1234
27 Ga0065712_10199461 3300005290 Unclassified 1114
28 Ga0065715_10000634 3300005293 Bacteria 10072
29 Ga0065715_10006297 3300005293 Bacteria 3460
30 Ga0065715_10010746 3300005293 Bacteria 2625
31 Ga0065715_10131347 3300005293 Bacteria 2009
32 Ga0065715_10184365 3300005293 Bacteria 1417
33 Ga0065715_10205606 3300005293 Bacteria 1329
34 Ga0065715_10216202 3300005293 Unclassified 1292
35 Ga0065715_10395014 3300005293 Bacteria 889
36 Ga0065707_10007784 3300005295 Bacteria 6660
37 Ga0065707_10290155 3300005295 Bacteria 1027
38 Ga0065707_10328605 3300005295 Unclassified 953
39 Ga0070658_10000314 3300005327 Bacteria 41791
40 Ga0070658_10028042 3300005327 Unclassified 4519
41 Ga0070658_10109062 3300005327 Unclassified 2292
42 Ga0070676_10000759 3300005328 Bacteria 15860
43 Ga0070676_10003127 3300005328 Bacteria 8550
44 Ga0070676_10004090 3300005328 Bacteria 7667
45 Ga0070676_10103501 3300005328 Bacteria 1763
46 Ga0070676_10120206 3300005328 Bacteria 1648
47 Ga0070683_100084083 3300005329 Bacteria 2982
48 Ga0070683_100353845 3300005329 Bacteria 1399
49 Ga0070690_100126582 3300005330 Bacteria 1720
50 Ga0070670_100008345 3300005331 Bacteria 8830
51 Ga0070677_10033266 3300005333 Bacteria 1984
52 Ga0070666_10014771 3300005335 Bacteria 4975
53 Ga0070666_10017399 3300005335 Bacteria 4608
54 Ga0070666_10036328 3300005335 Bacteria 3270
55 Ga0070666_10066312 3300005335 Bacteria 2449
56 Ga0070666_10127690 3300005335 Bacteria 1765
57 Ga0070682_100211792 3300005337 Unclassified 1374
58 Ga0068868_100035263 3300005338 Bacteria 3866
59 Ga0068868_100040543 3300005338 Unclassified 3624
60 Ga0068868_100138806 3300005338 Bacteria 1994
61 Ga0068868_100154326 3300005338 Bacteria 1893
62 Ga0070660_100099471 3300005339 Bacteria 2303
63 Ga0070689_100001923 3300005340 Bacteria 13432
64 Ga0070689_100002311 3300005340 Bacteria 12406
65 Ga0070689_100005623 3300005340 Bacteria 8583
66 Ga0070689_100266532 3300005340 Bacteria 1417
67 Ga0070689_100484642 3300005340 Bacteria 1057
68 Ga0070687_100000585 3300005343 Bacteria 12125
69 Ga0070687_100210657 3300005343 Bacteria 1184
70 Ga0070661_100374226 3300005344 Bacteria 1122
71 Ga0070668_100004269 3300005347 Bacteria 10602
72 Ga0070668_100004794 3300005347 Bacteria 10026
73 Ga0070668_100096261 3300005347 Bacteria 2339
74 Ga0070668_100294538 3300005347 Unclassified 1359
75 Ga0070669_100004777 3300005353 Bacteria 9775
76 Ga0070669_100023284 3300005353 Bacteria 4435
77 Ga0070669_100051535 3300005353 Unclassified 3009
78 Ga0070669_100074737 3300005353 Bacteria 2512
79 Ga0070669_100189808 3300005353 Bacteria 1611
80 Ga0070669_100222792 3300005353 Bacteria 1492
81 Ga0070669_100384727 3300005353 Unclassified 1145
82 Ga0070675_100003641 3300005354 Bacteria 11721
83 Ga0070675_100005459 3300005354 Bacteria 9726
84 Ga0070675_100018755 3300005354 Bacteria 5507
85 Ga0070675_100029200 3300005354 Bacteria 4445
86 Ga0070675_100063876 3300005354 Bacteria 3044
87 Ga0070675_100300599 3300005354 Bacteria 1414
88 Ga0070675_100510903 3300005354 Bacteria 1083
89 Ga0070671_100000966 3300005355 Bacteria 21064
90 Ga0070671_100020232 3300005355 Bacteria 5426
91 Ga0070671_100026158 3300005355 Bacteria 4794
92 Ga0070671_100061696 3300005355 Bacteria 3122
93 Ga0070671_100090021 3300005355 Bacteria 2568
94 Ga0070674_100015414 3300005356 Bacteria 4770
95 Ga0070674_100087391 3300005356 Bacteria 2241
96 Ga0070674_100433985 3300005356 Bacteria 1081
97 Ga0070673_100062566 3300005364 Unclassified 2957
98 Ga0070673_100201108 3300005364 Bacteria 1716
99 Ga0070673_100341003 3300005364 Bacteria 1328
100 Ga0070688_100003252 3300005365 Bacteria 8324
101 Ga0070688_100006168 3300005365 Bacteria 6380
102 Ga0070688_100055467 3300005365 Unclassified 2485
103 Ga0070688_100109047 3300005365 Bacteria 1838
104 Ga0070688_100161670 3300005365 Bacteria 1539
105 Ga0070659_100002393 3300005366 Bacteria 13330
106 Ga0070659_100006312 3300005366 Bacteria 8562
107 Ga0070667_100003645 3300005367 Bacteria 13106
108 Ga0070667_100007325 3300005367 Bacteria 9170
109 Ga0070667_100013130 3300005367 Bacteria 6847
110 Ga0070667_100049340 3300005367 Bacteria 3545
111 Ga0070709_10029851 3300005434 Bacteria 3265
112 Ga0070709_10058520 3300005434 Bacteria 2444
113 Ga0070709_10286161 3300005434 Unclassified 1199
114 Ga0070714_100450557 3300005435 Bacteria 1222
115 Ga0070714_100499000 3300005435 Unclassified 1160
116 Ga0070713_100030518 3300005436 Bacteria 4282
117 Ga0070713_100040161 3300005436 Bacteria 3803
118 Ga0070713_100160642 3300005436 Bacteria 2005
119 Ga0070713_100181493 3300005436 Bacteria 1891
120 Ga0070713_100302588 3300005436 Bacteria 1472
121 Ga0070713_100377917 3300005436 Bacteria 1319
122 Ga0070710_10090439 3300005437 Bacteria 1804
123 Ga0070711_100004894 3300005439 Bacteria 7954
124 Ga0070711_100042226 3300005439 Bacteria 3082
125 Ga0070711_100114145 3300005439 Bacteria 1987
126 Ga0070711_100284004 3300005439 Unclassified 1310
127 Ga0070711_100370649 3300005439 Bacteria 1155
128 Ga0070705_100201364 3300005440 Unclassified 1365
129 Ga0070694_100132518 3300005444 Unclassified 1802
130 Ga0070708_100031485 3300005445 Bacteria 4591
131 Ga0070708_100043385 3300005445 Bacteria 3952
132 Ga0070708_100093957 3300005445 Bacteria 2735
133 Ga0070708_100153991 3300005445 Bacteria 2139
134 Ga0070708_100300124 3300005445 Bacteria 1512
135 Ga0070708_100371124 3300005445 Bacteria 1349
136 Ga0070708_100373410 3300005445 Unclassified 1344
137 Ga0070708_100571209 3300005445 Unclassified 1066
138 Ga0070708_100671413 3300005445 Unclassified 976
139 Ga0070678_100002283 3300005456 Bacteria 10436
140 Ga0070678_100120639 3300005456 Bacteria 2067
141 Ga0070678_100129195 3300005456 Unclassified 2005
142 Ga0070678_100150030 3300005456 Bacteria 1877
143 Ga0070678_100483898 3300005456 Bacteria 1089
144 Ga0070662_100002790 3300005457 Bacteria 10816
145 Ga0070662_100065244 3300005457 Bacteria 2668
146 Ga0068867_100079364 3300005459 Bacteria 2470
147 Ga0068867_100101588 3300005459 Bacteria 2197
148 Ga0068867_100103544 3300005459 Unclassified 2177
149 Ga0068867_100398109 3300005459 Bacteria 1161
150 Ga0070706_100000072 3300005467 Bacteria 117347
151 Ga0070706_100005839 3300005467 Bacteria 11678
152 Ga0070706_100015133 3300005467 Bacteria 7123
153 Ga0070706_100062984 3300005467 Bacteria 3427
154 Ga0070706_100074559 3300005467 Bacteria 3140
155 Ga0070706_100091695 3300005467 Bacteria 2818
156 Ga0070706_100121436 3300005467 Bacteria 2435
157 Ga0070706_100151004 3300005467 Bacteria 2169
158 Ga0070706_100174569 3300005467 Bacteria 2007
159 Ga0070706_100240938 3300005467 Unclassified 1689
160 Ga0070706_100442468 3300005467 Unclassified 1210
161 Ga0070707_100000414 3300005468 Bacteria 42193
162 Ga0070707_100011922 3300005468 Bacteria 8110
163 Ga0070707_100016298 3300005468 Bacteria 6975
164 Ga0070707_100018415 3300005468 Bacteria 6569
165 Ga0070707_100020265 3300005468 Bacteria 6270
166 Ga0070707_100041911 3300005468 Bacteria 4383
167 Ga0070707_100055645 3300005468 Bacteria 3793
168 Ga0070707_100056090 3300005468 Bacteria 3778
169 Ga0070707_100065104 3300005468 Bacteria 3501
170 Ga0070707_100147710 3300005468 Bacteria 2288
171 Ga0070707_100151675 3300005468 Bacteria 2257
172 Ga0070707_100215729 3300005468 Bacteria 1870
173 Ga0070707_100482331 3300005468 Unclassified 1201
174 Ga0070698_100002051 3300005471 Bacteria 22375
175 Ga0070698_100003705 3300005471 Bacteria 16773
176 Ga0070698_100036057 3300005471 Bacteria 5112
177 Ga0070698_100464528 3300005471 Unclassified 1202
178 Ga0070699_100053744 3300005518 Unclassified 3486
179 Ga0070699_100242952 3300005518 Bacteria 1608
180 Ga0070699_100320643 3300005518 Bacteria 1393
181 Ga0070679_100544908 3300005530 Bacteria 1104
182 Ga0070684_100019475 3300005535 Bacteria 5614
183 Ga0070684_100074143 3300005535 Bacteria 2999
184 Ga0070684_100144648 3300005535 Bacteria 2151
185 Ga0070697_100004384 3300005536 Bacteria 10834
186 Ga0070697_100008529 3300005536 Bacteria 8001
187 Ga0070697_100012783 3300005536 Bacteria 6576
188 Ga0070697_100013951 3300005536 Bacteria 6309
189 Ga0070697_100109712 3300005536 Bacteria 2298
190 Ga0070697_100110102 3300005536 Bacteria 2294
191 Ga0070697_100113329 3300005536 Bacteria 2262
192 Ga0070697_100279707 3300005536 Unclassified 1431
193 Ga0070697_100284893 3300005536 Bacteria 1418
194 Ga0070697_100309023 3300005536 Bacteria 1360
195 Ga0070697_100404002 3300005536 Bacteria 1186
196 Ga0068853_100000001 3300005539 Bacteria 715840
197 Ga0068853_100303983 3300005539 Unclassified 1475
198 Ga0070672_100013289 3300005543 Bacteria 5811
199 Ga0070672_100021779 3300005543 Bacteria 4694
200 Ga0070672_100220833 3300005543 Bacteria 1589
201 Ga0070672_100370792 3300005543 Unclassified 1223
202 Ga0070695_100040110 3300005545 Bacteria 2962
203 Ga0070696_100173640 3300005546 Bacteria 1595
204 Ga0070693_100030019 3300005547 Bacteria 2969
205 Ga0070665_100019885 3300005548 Bacteria 6742
206 Ga0070665_100108726 3300005548 Bacteria 2775
207 Ga0070665_100114340 3300005548 Bacteria 2701
208 Ga0070665_100125567 3300005548 Bacteria 2568
209 Ga0070665_100131849 3300005548 Bacteria 2501
210 Ga0070665_100273159 3300005548 Unclassified 1692
211 Ga0068855_100000294 3300005563 Bacteria 61922
212 Ga0070664_100049228 3300005564 Bacteria 3563
213 Ga0070664_100372678 3300005564 Bacteria 1302
214 Ga0068856_100109277 3300005614 Bacteria 2761
215 Ga0070702_100107594 3300005615 Bacteria 1722
216 Ga0068852_100092731 3300005616 Bacteria 2705
217 Ga0068859_100088056 3300005617 Bacteria 3154
218 Ga0068866_10036187 3300005718 Bacteria 2417
219 Ga0068866_10036702 3300005718 Bacteria 2402
220 Ga0068861_100401763 3300005719 Unclassified 1216
221 Ga0068861_100495012 3300005719 Bacteria 1104
222 Ga0068863_100006720 3300005841 Bacteria 11276
223 Ga0068858_100004519 3300005842 Bacteria 13640
224 Ga0068858_100027473 3300005842 Bacteria 5286
225 Ga0068858_100607648 3300005842 Bacteria 1061
226 Ga0068860_100030461 3300005843 Bacteria 5189
227 Ga0068860_100112764 3300005843 Bacteria 2600
228 Ga0068860_100114149 3300005843 Bacteria 2583
229 Ga0068860_100218262 3300005843 Unclassified 1851
230 Ga0068860_100302873 3300005843 Bacteria 1566
231 Ga0068860_100509850 3300005843 Unclassified 1202
232 Ga0068862_100033520 3300005844 Bacteria 4342
233 Ga0068862_100224970 3300005844 Bacteria 1700
234 Ga0081455_10002038 3300005937 Bacteria 24159
235 Ga0081455_10002816 3300005937 Bacteria 20483
236 Ga0081455_10007921 3300005937 Bacteria 11117
237 Ga0081455_10385360 3300005937 Unclassified 978
238 Ga0081540_1000014 3300005983 Bacteria 179266
239 Ga0081540_1043180 3300005983 Bacteria 2316
240 Ga0081539_10000014 3300005985 Bacteria 411270
241 Ga0081539_10003564 3300005985 Bacteria 18907
242 Ga0081539_10009184 3300005985 Bacteria 8333
243 Ga0081539_10015129 3300005985 Bacteria 5642
244 Ga0070717_10008397 3300006028 Bacteria 7713
245 Ga0070717_10082917 3300006028 Unclassified 2695
246 Ga0070717_10166961 3300006028 Bacteria 1912
247 Ga0070717_10303407 3300006028 Unclassified 1420
248 Ga0070717_10356255 3300006028 Bacteria 1309
249 Ga0070717_10425619 3300006028 Unclassified 1194
250 Ga0070717_10464382 3300006028 Unclassified 1142
251 Ga0070715_10092523 3300006163 Bacteria 1394
252 Ga0070716_100040226 3300006173 Unclassified 2600
253 Ga0070716_100051233 3300006173 Bacteria 2346
254 Ga0070716_100218199 3300006173 Bacteria 1279
255 Ga0070716_100247374 3300006173 Bacteria 1213
256 Ga0070712_100033533 3300006175 Bacteria 3475
257 Ga0070712_100037558 3300006175 Bacteria 3303
258 Ga0070712_100062757 3300006175 Unclassified 2628
259 Ga0070712_100104127 3300006175 Bacteria 2105
260 Ga0070712_100241365 3300006175 Bacteria 1439
261 Ga0070712_100416529 3300006175 Unclassified 1112
262 Ga0070712_100465609 3300006175 Bacteria 1055
263 Ga0075362_10144429 3300006177 Unclassified 1138
264 Ga0097621_100018440 3300006237 Bacteria 5331
265 Ga0097621_100072422 3300006237 Unclassified 2850
266 Ga0068871_100009562 3300006358 Bacteria 7037
267 Ga0068871_100036935 3300006358 Bacteria 3893
268 Ga0075434_100273395 3300006871 Bacteria 1709
269 Ga0075434_100308544 3300006871 Bacteria 1603
270 Ga0068865_100088034 3300006881 Unclassified 2246
271 Ga0068865_100184419 3300006881 Bacteria 1609
272 Ga0068865_100521925 3300006881 Bacteria 993
273 Ga0075436_100192292 3300006914 Bacteria 1444
274 Ga0097620_100088060 3300006931 Bacteria 3154
275 Ga0075435_100058107 3300007076 Bacteria 3131
276 Ga0075435_100336742 3300007076 Bacteria 1293
277 Ga0099794_10159784 3300007265 Unclassified 1146
278 Ga0099795_10010810 3300007788 Bacteria 2703
279 Ga0111539_10013275 3300009094 Bacteria 10294
280 Ga0105245_10149349 3300009098 Bacteria 2208
281 Ga0105245_10658301 3300009098 Unclassified 1078
282 Ga0105247_10449562 3300009101 Unclassified 929
283 Ga0114129_10000103 3300009147 Bacteria 83612
284 Ga0114129_10268702 3300009147 Unclassified 2282
285 Ga0114129_10440648 3300009147 Bacteria 1710
286 Ga0114129_10798590 3300009147 Bacteria 1204
287 Ga0105243_10153182 3300009148 Bacteria 1980
288 Ga0105243_10372903 3300009148 Bacteria 1317
289 Ga0105242_10005103 3300009176 Bacteria 10134
290 Ga0105242_10117267 3300009176 Bacteria 2279
291 Ga0105237_10010320 3300009545 Bacteria 9951
292 Ga0105237_10031392 3300009545 Bacteria 5388
293 Ga0105238_10486365 3300009551 Unclassified 1234
294 Ga0105249_10008958 3300009553 Bacteria 8741
295 Ga0105249_10070652 3300009553 Unclassified 3223
296 Ga0105249_10182789 3300009553 Bacteria 2041
297 Ga0105249_10243423 3300009553 Bacteria 1779
298 Ga0105249_10682684 3300009553 Unclassified 1086
299 Ga0099796_10027737 3300010159 Bacteria 1811
300 Ga0099796_10071095 3300010159 Unclassified 1256
301 Ga0105239_10009837 3300010375 Bacteria 10741
302 Ga0105239_10055069 3300010375 Bacteria 4363
303 Ga0105239_10137085 3300010375 Bacteria 2724
304 Ga0157338_1013112 3300012515 Bacteria 875
305 Ga0157374_10007842 3300013296 Bacteria 9115
306 Ga0157374_10009172 3300013296 Bacteria 8482
307 Ga0157374_10010109 3300013296 Bacteria 8104
308 Ga0157374_10032125 3300013296 Bacteria 4777
309 Ga0157374_10065734 3300013296 Bacteria 3407
310 Ga0157374_10153928 3300013296 Unclassified 2237
311 Ga0157374_10195249 3300013296 Unclassified 1981
312 Ga0157374_10279178 3300013296 Bacteria 1649
313 Ga0157374_10283149 3300013296 Bacteria 1637
314 Ga0157374_10394247 3300013296 Bacteria 1380
315 Ga0157374_10480083 3300013296 Unclassified 1246
316 Ga0157374_10481634 3300013296 Unclassified 1244
317 Ga0157374_10985578 3300013296 Bacteria 862
318 Ga0157378_10009004 3300013297 Bacteria 8692
319 Ga0157378_10025623 3300013297 Bacteria 5192
320 Ga0157378_10031002 3300013297 Bacteria 4722
321 Ga0157378_10041230 3300013297 Bacteria 4095
322 Ga0157378_10061844 3300013297 Bacteria 3343
323 Ga0157378_10096757 3300013297 Bacteria 2690
324 Ga0157378_10266658 3300013297 Bacteria 1645
325 Ga0157378_10458463 3300013297 Bacteria 1266
326 Ga0157378_10480253 3300013297 Unclassified 1238
327 Ga0157378_10548740 3300013297 Unclassified 1161
328 Ga0163162_10005079 3300013306 Bacteria 12675
329 Ga0163162_10006220 3300013306 Bacteria 11569
330 Ga0163162_10013945 3300013306 Bacteria 7853
331 Ga0163162_10109331 3300013306 Unclassified 2861
332 Ga0163162_10118489 3300013306 Bacteria 2750
333 Ga0163162_10158828 3300013306 Bacteria 2382
334 Ga0163162_10203642 3300013306 Unclassified 2108
335 Ga0163162_10215911 3300013306 Bacteria 2048
336 Ga0163162_10240366 3300013306 Bacteria 1942
337 Ga0157372_10125444 3300013307 Unclassified 2951
338 Ga0157372_10150741 3300013307 Bacteria 2684
339 Ga0157372_10160801 3300013307 Bacteria 2595
340 Ga0157372_10749529 3300013307 Bacteria 1136
341 Ga0157375_10003326 3300013308 Bacteria 13922
342 Ga0157375_10021001 3300013308 Bacteria 5978
343 Ga0157375_10053876 3300013308 Bacteria 3960
344 Ga0157375_10195680 3300013308 Bacteria 2177
345 Ga0157375_10266772 3300013308 Unclassified 1874
346 Ga0157375_10318236 3300013308 Bacteria 1720
347 Ga0157375_10483264 3300013308 Bacteria 1403
348 Ga0157375_10829726 3300013308 Bacteria 1072
349 Ga0163163_10099885 3300014325 Unclassified 2923
350 Ga0163163_10250705 3300014325 Bacteria 1821
351 Ga0163163_10372707 3300014325 Bacteria 1485
352 Ga0182008_10062333 3300014497 Unclassified 1838
353 Ga0157379_10018054 3300014968 Bacteria 6219
354 Ga0157379_10910066 3300014968 Unclassified 835
355 Ga0157376_10004419 3300014969 Bacteria 9790
356 Ga0157376_10052256 3300014969 Unclassified 3397
357 Ga0157376_10087191 3300014969 Unclassified 2693
358 Ga0157376_10117052 3300014969 Bacteria 2356
359 Ga0157376_10177982 3300014969 Bacteria 1942
360 Ga0182005_1005473 3300015265 Bacteria 3963
361 Ga0182005_1070198 3300015265 Bacteria 962
362 Ga0163161_10266085 3300017792 Unclassified 1340
363 Ga0163161_10346204 3300017792 Bacteria 1180
364 Ga0163161_10466708 3300017792 Bacteria 1023
365 Ga0213876_10019864 3300021384 Unclassified 3548
366 Ga0207666_1000532 3300025271 Bacteria 4649
367 Ga0207666_1002337 3300025271 Bacteria 2279
368 Ga0207673_1009035 3300025290 Unclassified 1269
369 Ga0207697_10000106 3300025315 Bacteria 38593
370 Ga0207697_10000239 3300025315 Bacteria 29914
371 Ga0207697_10000384 3300025315 Bacteria 24790
372 Ga0207697_10000675 3300025315 Bacteria 19408
373 Ga0207697_10005572 3300025315 Bacteria 5833
374 Ga0207697_10024746 3300025315 Bacteria 2456
375 Ga0207697_10080657 3300025315 Bacteria 1371
376 Ga0207682_10015240 3300025893 Unclassified 2992
377 Ga0207692_10099194 3300025898 Bacteria 1595
378 Ga0207642_10023998 3300025899 Unclassified 2446
379 Ga0207710_10134166 3300025900 Unclassified 1191
380 Ga0207688_10000619 3300025901 Bacteria 17470
381 Ga0207688_10000766 3300025901 Bacteria 15963
382 Ga0207688_10042973 3300025901 Unclassified 2516
383 Ga0207688_10250111 3300025901 Bacteria 1074
384 Ga0207688_10253378 3300025901 Bacteria 1067
385 Ga0207680_10019731 3300025903 Bacteria 3612
386 Ga0207647_10003644 3300025904 Bacteria 11520
387 Ga0207685_10097479 3300025905 Unclassified 1250
388 Ga0207699_10010376 3300025906 Bacteria 4674
389 Ga0207699_10073970 3300025906 Bacteria 2092
390 Ga0207699_10141287 3300025906 Bacteria 1583
391 Ga0207645_10000593 3300025907 Bacteria 30012
392 Ga0207645_10006877 3300025907 Bacteria 8115
393 Ga0207645_10010353 3300025907 Bacteria 6400
394 Ga0207645_10012412 3300025907 Bacteria 5778
395 Ga0207645_10463628 3300025907 Unclassified 856
396 Ga0207705_10000430 3300025909 Bacteria 36578
397 Ga0207705_10020300 3300025909 Unclassified 4751
398 Ga0207705_10298931 3300025909 Unclassified 1234
399 Ga0207684_10000043 3300025910 Bacteria 259939
400 Ga0207684_10007962 3300025910 Bacteria 9472
401 Ga0207684_10020480 3300025910 Bacteria 5652
402 Ga0207684_10054615 3300025910 Bacteria 3389
403 Ga0207684_10055108 3300025910 Unclassified 3373
404 Ga0207684_10060227 3300025910 Bacteria 3224
405 Ga0207684_10060471 3300025910 Unclassified 3218
406 Ga0207684_10173730 3300025910 Unclassified 1857
407 Ga0207684_10189987 3300025910 Unclassified 1771
408 Ga0207684_10557894 3300025910 Unclassified 980
409 Ga0207695_10000093 3300025913 Bacteria 270427
410 Ga0207671_10008351 3300025914 Bacteria 8791
411 Ga0207671_10234212 3300025914 Bacteria 1441
412 Ga0207693_10004002 3300025915 Bacteria 12530
413 Ga0207693_10021448 3300025915 Bacteria 5132
414 Ga0207693_10063334 3300025915 Unclassified 2897
415 Ga0207693_10078451 3300025915 Bacteria 2585
416 Ga0207693_10145764 3300025915 Bacteria 1862
417 Ga0207693_10282400 3300025915 Bacteria 1301
418 Ga0207663_10012721 3300025916 Bacteria 4557
419 Ga0207663_10052155 3300025916 Bacteria 2550
420 Ga0207662_10000157 3300025918 Bacteria 32191
421 Ga0207662_10008803 3300025918 Bacteria 5538
422 Ga0207657_10046701 3300025919 Bacteria 3792
423 Ga0207657_10083323 3300025919 Bacteria 2683
424 Ga0207657_10170594 3300025919 Bacteria 1763
425 Ga0207649_10309104 3300025920 Bacteria 1158
426 Ga0207652_10527886 3300025921 Bacteria 1062
427 Ga0207646_10000513 3300025922 Bacteria 51606
428 Ga0207646_10003677 3300025922 Bacteria 17126
429 Ga0207646_10027683 3300025922 Bacteria 5167
430 Ga0207646_10038535 3300025922 Bacteria 4305
431 Ga0207646_10039540 3300025922 Unclassified 4245
432 Ga0207646_10125049 3300025922 Bacteria 2312
433 Ga0207646_10243778 3300025922 Bacteria 1623
434 Ga0207646_10346946 3300025922 Bacteria 1341
435 Ga0207646_10467835 3300025922 Unclassified 1137
436 Ga0207681_10003225 3300025923 Bacteria 10229
437 Ga0207681_10009120 3300025923 Bacteria 6061
438 Ga0207681_10042854 3300025923 Unclassified 3026
439 Ga0207681_10065417 3300025923 Bacteria 2513
440 Ga0207681_10154288 3300025923 Bacteria 1724
441 Ga0207650_10001096 3300025925 Bacteria 20008
442 Ga0207650_10053724 3300025925 Unclassified 2987
443 Ga0207659_10007541 3300025926 Bacteria 6700
444 Ga0207659_10029416 3300025926 Bacteria 3744
445 Ga0207659_10046934 3300025926 Bacteria 3053
446 Ga0207659_10088903 3300025926 Unclassified 2302
447 Ga0207659_10105118 3300025926 Bacteria 2136
448 Ga0207659_10392298 3300025926 Bacteria 1159
449 Ga0207687_10073364 3300025927 Bacteria 2450
450 Ga0207687_10079931 3300025927 Bacteria 2358
451 Ga0207700_10037693 3300025928 Bacteria 3503
452 Ga0207700_10130775 3300025928 Bacteria 2049
453 Ga0207700_10203787 3300025928 Unclassified 1668
454 Ga0207700_10458324 3300025928 Bacteria 1124
455 Ga0207664_10232840 3300025929 Bacteria 1602
456 Ga0207664_10477754 3300025929 Bacteria 1114
457 Ga0207644_10020135 3300025931 Bacteria 4533
458 Ga0207644_10060522 3300025931 Unclassified 2740
459 Ga0207644_10086153 3300025931 Unclassified 2332
460 Ga0207644_10093820 3300025931 Bacteria 2241
461 Ga0207644_10235715 3300025931 Bacteria 1455
462 Ga0207644_10449668 3300025931 Unclassified 1058
463 Ga0207690_10009577 3300025932 Bacteria 5753
464 Ga0207690_10084269 3300025932 Unclassified 2228
465 Ga0207706_10003628 3300025933 Bacteria 14753
466 Ga0207706_10033911 3300025933 Unclassified 4544
467 Ga0207706_10087246 3300025933 Bacteria 2744
468 Ga0207686_10034695 3300025934 Bacteria 3022
469 Ga0207686_10110739 3300025934 Bacteria 1851
470 Ga0207670_10002877 3300025936 Bacteria 9080
471 Ga0207670_10005081 3300025936 Bacteria 7181
472 Ga0207670_10261656 3300025936 Unclassified 1341
473 Ga0207670_10536762 3300025936 Bacteria 954
474 Ga0207669_10010287 3300025937 Bacteria 4499
475 Ga0207669_10039680 3300025937 Bacteria 2723
476 Ga0207669_10228122 3300025937 Bacteria 1372
477 Ga0207704_10488363 3300025938 Unclassified 990
478 Ga0207665_10053495 3300025939 Bacteria 2721
479 Ga0207665_10125937 3300025939 Bacteria 1814
480 Ga0207665_10405776 3300025939 Unclassified 1039
481 Ga0207691_10001220 3300025940 Bacteria 25641
482 Ga0207691_10003896 3300025940 Bacteria 14494
483 Ga0207691_10011033 3300025940 Bacteria 8670
484 Ga0207691_10025155 3300025940 Bacteria 5592
485 Ga0207689_10265206 3300025942 Unclassified 1421
486 Ga0207661_10058825 3300025944 Unclassified 3095
487 Ga0207661_10133995 3300025944 Bacteria 2126
488 Ga0207661_10153315 3300025944 Unclassified 1993
489 Ga0207679_10061969 3300025945 Bacteria 2786
490 Ga0207667_10088605 3300025949 Unclassified 3200
491 Ga0207651_10007258 3300025960 Bacteria 5890
492 Ga0207651_10018500 3300025960 Bacteria 4149
493 Ga0207651_10022188 3300025960 Bacteria 3875
494 Ga0207651_10039271 3300025960 Bacteria 3120
495 Ga0207651_10505753 3300025960 Bacteria 1045
496 Ga0207712_10086957 3300025961 Unclassified 2291
497 Ga0207712_10151885 3300025961 Unclassified 1790
498 Ga0207668_10003175 3300025972 Bacteria 9626
499 Ga0207668_10014021 3300025972 Bacteria 4954
500 Ga0207668_10059270 3300025972 Bacteria 2681
501 Ga0207668_10496105 3300025972 Bacteria 1049
502 Ga0207658_10007135 3300025986 Bacteria 7611
503 Ga0207658_10052524 3300025986 Bacteria 3008
504 Ga0207658_10077845 3300025986 Bacteria 2531
505 Ga0207658_10147502 3300025986 Bacteria 1912
506 Ga0207677_10059824 3300026023 Bacteria 2630
507 Ga0207677_10148970 3300026023 Bacteria 1802
508 Ga0207677_10359351 3300026023 Unclassified 1223
509 Ga0207677_10396948 3300026023 Bacteria 1169
510 Ga0207703_10007665 3300026035 Bacteria 8554
511 Ga0207703_10012394 3300026035 Bacteria 6644
512 Ga0207703_10250909 3300026035 Bacteria 1595
513 Ga0207639_10000001 3300026041 Bacteria 1431562
514 Ga0207639_10442587 3300026041 Bacteria 1178
515 Ga0207639_10598330 3300026041 Unclassified 1017
516 Ga0207678_10048423 3300026067 Bacteria 3674
517 Ga0207678_10658995 3300026067 Bacteria 920
518 Ga0207708_10008840 3300026075 Bacteria 7455
519 Ga0207648_10012757 3300026089 Bacteria 7853
520 Ga0207648_10476175 3300026089 Bacteria 1140
521 Ga0207675_100469815 3300026118 Unclassified 1249
522 Ga0207675_100617577 3300026118 Bacteria 1088
523 Ga0207683_10002653 3300026121 Bacteria 15625
524 Ga0207683_10003604 3300026121 Bacteria 13490
525 Ga0207683_10008086 3300026121 Bacteria 8996
526 Ga0207683_10070826 3300026121 Unclassified 3081
527 Ga0207683_10458671 3300026121 Bacteria 1175
528 Ga0207698_10338457 3300026142 Unclassified 1416
529 Ga0209974_10004814 3300027876 Bacteria 4787
530 Ga0209974_10049995 3300027876 Unclassified 1403
531 Ga0207428_10343028 3300027907 Unclassified 1100
532 Ga0268266_10002974 3300028379 Bacteria 17473
533 Ga0268266_10141483 3300028379 Bacteria 2159
534 Ga0268266_10161405 3300028379 Unclassified 2028
535 Ga0268266_10574551 3300028379 Bacteria 1081
536 Ga0268265_10018839 3300028380 Bacteria 4789
537 Ga0268265_10397537 3300028380 Unclassified 1273
538 Ga0268264_10008218 3300028381 Bacteria 8667
539 Ga0268264_10011950 3300028381 Bacteria 7149
540 Ga0268264_10021850 3300028381 Bacteria 5222
541 Ga0268264_10060925 3300028381 Bacteria 3164
542 Ga0268264_10414671 3300028381 Bacteria 1297
543 Ga0268264_10477854 3300028381 Bacteria 1212
544 Ga0307513_10093726 3300031456 Unclassified 3051
545 Ga0373959_0036791 3300034820 Bacteria 1012
546 Ga0373940_0082905 3300035088 Bacteria 951
547 Ga0373944_0115947 3300035089 Bacteria 919
548 Ga0373932_0158300 3300035112 Bacteria 782
549 Ga0373945_0163451 3300035116 Unclassified 909
550 Ga0373943_0030336 3300035170 Bacteria 2558
551 Ga0373943_0151178 3300035170 Bacteria 1258
552 Ga0373943_0154588 3300035170 Unclassified 1245
553 Ga0373946_0090256 3300035171 Unclassified 1357
554 Ga0373946_0092041 3300035171 Bacteria 1345
555 Ga0373946_0235078 3300035171 Unclassified 889
556 Ga0373955_0094916 3300035172 Unclassified 1705
557 Ga0373924_0066559 3300035410 Bacteria 1515
558 Ga0373935_0067357 3300035692 Bacteria 2302
559 Ga0373935_0250894 3300035692 Bacteria 1238
560 Ga0373927_0225263 3300035695 Unclassified 1232
561 Ga0373933_0180851 3300035724 Unclassified 1345
562 Ga0373947_0018018 3300035725 Bacteria 4064
563 Ga0373947_0051719 3300035725 Bacteria 2472
564 Ga0373947_0062249 3300035725 Bacteria 2270
565 Ga0373947_0180444 3300035725 Unclassified 1374
566 Ga0373925_0059921 3300037068 Unclassified 2857
567 Ga0373925_0075105 3300037068 Bacteria 2561
568 Ga0373925_0178495 3300037068 Bacteria 1679
569 Ga0395900_0009876 3300037418 Bacteria 9775
570 Ga0395900_0379306 3300037418 Unclassified 1382
571 Ga0395898_0014853 3300037466 Bacteria 7994
572 Ga0395898_0586066 3300037466 Unclassified 1058
573 Ga0395905_0019798 3300037471 Bacteria 6379
574 Ga0395905_0051394 3300037471 Unclassified 3861
575 Ga0395905_0558714 3300037471 Bacteria 1046
576 Ga0395901_0004662 3300038443 Bacteria 13824
577 Ga0395901_0053682 3300038443 Bacteria 4188
578 Ga0395901_0071409 3300038443 Bacteria 3618
579 Ga0395901_0137096 3300038443 Unclassified 2571
580 Ga0436365_0725183 3300039437 Bacteria 3629
581 Ga0436365_0743711 3300039437 Unclassified 4029
582 Ga0451787_787321 3300041441 Unclassified 819
583 Ga0451853_3052533 3300041512 Unclassified 1299
584 Ga0451576_0038986 3300045051 Bacteria 5029
585 Ga0451576_0063594 3300045051 Bacteria 3846
586 Ga0466967_0782395 3300045976 Bacteria 947
587 Ga0495592_0060803 3300046454 Unclassified 2777
588 Ga0495603_0164421 3300046455 Unclassified 1287
589 Ga0495651_0135541 3300046462 Bacteria 1792
590 Ga0495580_0167139 3300046472 Unclassified 1521
591 Ga0495580_0220448 3300046472 Bacteria 1304
592 Ga0495639_0121611 3300046475 Unclassified 1246
593 Ga0495585_0035090 3300046492 Bacteria 2837
594 Ga0495608_0182256 3300046511 Bacteria 1328
595 Ga0495628_0288651 3300046516 Bacteria 1216
596 Ga0495630_0124351 3300046517 Bacteria 1957
597 Ga0495643_0000176 3300046522 Bacteria 102034
598 Ga0495644_0062791 3300046523 Unclassified 1396
599 Ga0495652_0024908 3300046529 Bacteria 5295
600 Ga0495652_0211157 3300046529 Unclassified 1465
601 Ga0495598_0001731 3300046537 Bacteria 4378
602 Ga0495598_0014056 3300046537 Viruses 1996
603 Ga0495645_0047814 3300046543 Bacteria 3116
604 Ga0495634_0248949 3300046642 Unclassified 1088
605 Ga0495659_0008961 3300046664 Bacteria 3187
606 Ga0495659_0050632 3300046664 Bacteria 1511
607 Ga0495659_0141065 3300046664 Unclassified 962
608 Ga0495588_0121148 3300046674 Unclassified 1379
609 Ga0495599_0033741 3300046678 Bacteria 3217
610 Ga0495599_0215267 3300046678 Unclassified 1177
611 Ga0495623_0079725 3300046679 Bacteria 2028
612 Ga0495646_0053143 3300046680 Bacteria 2444
613 Ga0495658_0114094 3300046683 Unclassified 1628
614 Ga0495669_0063231 3300046684 Unclassified 1679
615 Ga0495670_0216466 3300046691 Bacteria 1017
616 Ga0495671_0120689 3300046692 Bacteria 1279
617 Ga0495600_0351843 3300046809 Unclassified 923
618 Ga0495581_0213655 3300047315 Unclassified 1128
619 Ga0495604_0308817 3300047317 Bacteria 1060
620 Ga0495674_0154019 3300047319 Unclassified 1926
621 Ga0495675_0011585 3300047444 Bacteria 5536
622 Ga0495684_0006328 3300047471 Bacteria 9202
623 Ga0495684_0090540 3300047471 Unclassified 2317
624 Ga0495602_0069761 3300048088 Bacteria 3011
625 Ga0496100_0023535 3300048903 Bacteria 3743
626 Ga0496100_0170912 3300048903 Bacteria 1565
627 Ga0496101_0003525 3300048904 Bacteria 9758
628 Ga0496101_0092484 3300048904 Bacteria 2252
629 Ga0496101_0131754 3300048904 Bacteria 1899
630 Ga0496101_0377263 3300048904 Bacteria 1116
631 Ga0496102_0050163 3300048905 Bacteria 3799
632 Ga0496102_0118429 3300048905 Bacteria 2472
633 Ga0496102_0150245 3300048905 Bacteria 2188
634 Ga0496102_0557113 3300048905 Unclassified 1069
635 Ga0496104_0073911 3300048907 Unclassified 3244
636 Ga0496105_0143744 3300048908 Unclassified 1963
637 Ga0496105_0229527 3300048908 Bacteria 1509
638 Ga0496105_0247800 3300048908 Unclassified 1444
639 Ga0496105_0379870 3300048908 Bacteria 1124
640 Ga0496106_0020281 3300048909 Bacteria 4932
641 Ga0496107_0022989 3300048910 Bacteria 4407
642 Ga0496107_0061696 3300048910 Unclassified 2715
643 Ga0496107_0275955 3300048910 Bacteria 1251
644 Ga0496108_0043777 3300048911 Bacteria 3739
645 Ga0496108_0120947 3300048911 Bacteria 2246
646 Ga0496108_0125391 3300048911 Unclassified 2204
647 Ga0496108_0364127 3300048911 Bacteria 1262
648 Ga0496108_0495896 3300048911 Bacteria 1067
649 Ga0496109_0009018 3300048912 Bacteria 8497
650 Ga0496109_0098208 3300048912 Bacteria 2715
651 Ga0496109_0117018 3300048912 Bacteria 2481
652 Ga0496109_0182387 3300048912 Unclassified 1972
653 Ga0496109_0188090 3300048912 Bacteria 1940
654 Ga0496109_0282367 3300048912 Bacteria 1565
655 Ga0496110_0022417 3300048913 Bacteria 5362
656 Ga0496110_0345746 3300048913 Unclassified 1355
657 Ga0496110_0444512 3300048913 Unclassified 1182
658 Ga0496110_0546224 3300048913 Bacteria 1053
659 Ga0496111_0283704 3300048914 Bacteria 1228
660 Ga0496112_0005284 3300048915 Bacteria 11138
661 Ga0496112_0014542 3300048915 Bacteria 7310
662 Ga0496112_0029766 3300048915 Bacteria 5283
663 Ga0496112_0047623 3300048915 Bacteria 4206
664 Ga0496112_0329358 3300048915 Bacteria 1471
665 Ga0496112_0366672 3300048915 Bacteria 1382
666 Ga0496113_0116490 3300048916 Bacteria 2085
667 Ga0496113_0130664 3300048916 Unclassified 1970
668 Ga0496113_0266185 3300048916 Unclassified 1370
669 Ga0496114_0024566 3300048917 Bacteria 4920
670 Ga0496114_0061373 3300048917 Bacteria 3144
671 Ga0496115_0001810 3300048918 Bacteria 15284
672 Ga0496115_0016337 3300048918 Bacteria 5649
673 Ga0496115_0098535 3300048918 Unclassified 2394
674 Ga0496115_0168166 3300048918 Bacteria 1813
675 nmdc:mga05p37_1087359_c1 3300050507 Bacteria 839
676 nmdc:mga05p37_446057_c1 3300050507 Unclassified 1499
677 nmdc:mga05p37_5724_c2 3300050507 Bacteria 6080
678 nmdc:mga05p37_777871_c1 3300050507 Unclassified 1051
679 nmdc:mga08y16_82954_c1 3300050511 Bacteria 3341
680 nmdc:mga0n895_263653_c1 3300050512 Bacteria 1748
681 nmdc:mga0n895_571204_c1 3300050512 Unclassified 1135
682 nmdc:mga0rr50_102775_c1 3300050513 Bacteria 2248
683 nmdc:mga0rr50_486973_c1 3300050513 Bacteria 1048
684 nmdc:mga08x19_64194_c1 3300050514 Unclassified 2383
685 nmdc:mga0a205_207276_c1 3300050515 Unclassified 1849
686 nmdc:mga0a205_719227_c1 3300050515 Unclassified 848
687 Ga0495619_0094039 3300053085 Bacteria 2033
688 2787505954 2786546548 Bacteria 4745694
689 Ga0068853_100319050
690 SwRhRL2b_contig_2929379
691 SwRhRL2b_contig_3225193
692 SwRhRL2b_contig_3559768
693 CNXas_1000054
694 JGI24746J21847_1004506
695 JGI24737J22298_10014965
696 JGI24750J21931_1023983
697 JGI24035J26624_1000831
698 JGI24035J26624_1001587
699 JGI24035J26624_1005740
700 JGI24035J26624_1006431
701 JGI24034J26672_10029203
702 JGI25406J46586_10000023
703 JGI25404J52841_10007566
704 JGI25405J52794_10004719
705 JGI25405J52794_10010745
706 Ga0065703_1019827
707 Ga0065704_10007112
708 Ga0065704_10078626
709 Ga0065704_10112617
710 Ga0065712_10008183
711 Ga0065712_10079225
712 Ga0065712_10098032
713 Ga0065712_10099310
714 Ga0065712_10172837
715 Ga0065712_10199461
716 Ga0065715_10000634
717 Ga0065715_10006297
718 Ga0065715_10010746
719 Ga0065715_10131347
720 Ga0065715_10184365
721 Ga0065715_10205606
722 Ga0065715_10216202
723 Ga0065715_10395014
724 Ga0065707_10007784
725 Ga0065707_10290155
726 Ga0065707_10328605
727 Ga0070658_10000314
728 Ga0070658_10028042
729 Ga0070658_10109062
730 Ga0070676_10000759
731 Ga0070676_10003127
732 Ga0070676_10004090
733 Ga0070676_10103501
734 Ga0070676_10120206
735 Ga0070683_100084083
736 Ga0070683_100353845
737 Ga0070690_100126582
738 Ga0070670_100008345
739 Ga0070677_10033266
740 Ga0070666_10014771
741 Ga0070666_10017399
742 Ga0070666_10036328
743 Ga0070666_10066312
744 Ga0070666_10127690
745 Ga0070682_100211792
746 Ga0068868_100035263
747 Ga0068868_100040543
748 Ga0068868_100138806
749 Ga0068868_100154326
750 Ga0070660_100099471
751 Ga0070689_100001923
752 Ga0070689_100002311
753 Ga0070689_100005623
754 Ga0070689_100266532
755 Ga0070689_100484642
756 Ga0070687_100000585
757 Ga0070687_100210657
758 Ga0070661_100374226
759 Ga0070668_100004269
760 Ga0070668_100004794
761 Ga0070668_100096261
762 Ga0070668_100294538
763 Ga0070669_100004777
764 Ga0070669_100023284
765 Ga0070669_100051535
766 Ga0070669_100074737
767 Ga0070669_100189808
768 Ga0070669_100222792
769 Ga0070669_100384727
770 Ga0070675_100003641
771 Ga0070675_100005459
772 Ga0070675_100018755
773 Ga0070675_100029200
774 Ga0070675_100063876
775 Ga0070675_100300599
776 Ga0070675_100510903
777 Ga0070671_100000966
778 Ga0070671_100020232
779 Ga0070671_100026158
780 Ga0070671_100061696
781 Ga0070671_100090021
782 Ga0070674_100015414
783 Ga0070674_100087391
784 Ga0070674_100433985
785 Ga0070673_100062566
786 Ga0070673_100201108
787 Ga0070673_100341003
788 Ga0070688_100003252
789 Ga0070688_100006168
790 Ga0070688_100055467
791 Ga0070688_100109047
792 Ga0070688_100161670
793 Ga0070659_100002393
794 Ga0070659_100006312
795 Ga0070667_100003645
796 Ga0070667_100007325
797 Ga0070667_100013130
798 Ga0070667_100049340
799 Ga0070709_10029851
800 Ga0070709_10058520
801 Ga0070709_10286161
802 Ga0070714_100450557
803 Ga0070714_100499000
804 Ga0070713_100030518
805 Ga0070713_100040161
806 Ga0070713_100160642
807 Ga0070713_100181493
808 Ga0070713_100302588
809 Ga0070713_100377917
810 Ga0070710_10090439
811 Ga0070711_100004894
812 Ga0070711_100042226
813 Ga0070711_100114145
814 Ga0070711_100284004
815 Ga0070711_100370649
816 Ga0070705_100201364
817 Ga0070694_100132518
818 Ga0070708_100031485
819 Ga0070708_100043385
820 Ga0070708_100093957
821 Ga0070708_100153991
822 Ga0070708_100300124
823 Ga0070708_100371124
824 Ga0070708_100373410
825 Ga0070708_100571209
826 Ga0070708_100671413
827 Ga0070678_100002283
828 Ga0070678_100120639
829 Ga0070678_100129195
830 Ga0070678_100150030
831 Ga0070678_100483898
832 Ga0070662_100002790
833 Ga0070662_100065244
834 Ga0068867_100079364
835 Ga0068867_100101588
836 Ga0068867_100103544
837 Ga0068867_100398109
838 Ga0070706_100000072
839 Ga0070706_100005839
840 Ga0070706_100015133
841 Ga0070706_100062984
842 Ga0070706_100074559
843 Ga0070706_100091695
844 Ga0070706_100121436
845 Ga0070706_100151004
846 Ga0070706_100174569
847 Ga0070706_100240938
848 Ga0070706_100442468
849 Ga0070707_100000414
850 Ga0070707_100011922
851 Ga0070707_100016298
852 Ga0070707_100018415
853 Ga0070707_100020265
854 Ga0070707_100041911
855 Ga0070707_100055645
856 Ga0070707_100056090
857 Ga0070707_100065104
858 Ga0070707_100147710
859 Ga0070707_100151675
860 Ga0070707_100215729
861 Ga0070707_100482331
862 Ga0070698_100002051
863 Ga0070698_100003705
864 Ga0070698_100036057
865 Ga0070698_100464528
866 Ga0070699_100053744
867 Ga0070699_100242952
868 Ga0070699_100320643
869 Ga0070679_100544908
870 Ga0070684_100019475
871 Ga0070684_100074143
872 Ga0070684_100144648
873 Ga0070697_100004384
874 Ga0070697_100008529
875 Ga0070697_100012783
876 Ga0070697_100013951
877 Ga0070697_100109712
878 Ga0070697_100110102
879 Ga0070697_100113329
880 Ga0070697_100279707
881 Ga0070697_100284893
882 Ga0070697_100309023
883 Ga0070697_100404002
884 Ga0068853_100000001
885 Ga0068853_100303983
886 Ga0070672_100013289
887 Ga0070672_100021779
888 Ga0070672_100220833
889 Ga0070672_100370792
890 Ga0070695_100040110
891 Ga0070696_100173640
892 Ga0070693_100030019
893 Ga0070665_100019885
894 Ga0070665_100108726
895 Ga0070665_100114340
896 Ga0070665_100125567
897 Ga0070665_100131849
898 Ga0070665_100273159
899 Ga0068855_100000294
900 Ga0070664_100049228
901 Ga0070664_100372678
902 Ga0068856_100109277
903 Ga0070702_100107594
904 Ga0068852_100092731
905 Ga0068859_100088056
906 Ga0068866_10036187
907 Ga0068866_10036702
908 Ga0068861_100401763
909 Ga0068861_100495012
910 Ga0068863_100006720
911 Ga0068858_100004519
912 Ga0068858_100027473
913 Ga0068858_100607648
914 Ga0068860_100030461
915 Ga0068860_100112764
916 Ga0068860_100114149
917 Ga0068860_100218262
918 Ga0068860_100302873
919 Ga0068860_100509850
920 Ga0068862_100033520
921 Ga0068862_100224970
922 Ga0081455_10002038
923 Ga0081455_10002816
924 Ga0081455_10007921
925 Ga0081455_10385360
926 Ga0081540_1000014
927 Ga0081540_1043180
928 Ga0081539_10000014
929 Ga0081539_10003564
930 Ga0081539_10009184
931 Ga0081539_10015129
932 Ga0070717_10008397
933 Ga0070717_10082917
934 Ga0070717_10166961
935 Ga0070717_10303407
936 Ga0070717_10356255
937 Ga0070717_10425619
938 Ga0070717_10464382
939 Ga0070715_10092523
940 Ga0070716_100040226
941 Ga0070716_100051233
942 Ga0070716_100218199
943 Ga0070716_100247374
944 Ga0070712_100033533
945 Ga0070712_100037558
946 Ga0070712_100062757
947 Ga0070712_100104127
948 Ga0070712_100241365
949 Ga0070712_100416529
950 Ga0070712_100465609
951 Ga0075362_10144429
952 Ga0097621_100018440
953 Ga0097621_100072422
954 Ga0068871_100009562
955 Ga0068871_100036935
956 Ga0075434_100273395
957 Ga0075434_100308544
958 Ga0068865_100088034
959 Ga0068865_100184419
960 Ga0068865_100521925
961 Ga0075436_100192292
962 Ga0097620_100088060
963 Ga0075435_100058107
964 Ga0075435_100336742
965 Ga0099794_10159784
966 Ga0099795_10010810
967 Ga0111539_10013275
968 Ga0105245_10149349
969 Ga0105245_10658301
970 Ga0105247_10449562
971 Ga0114129_10000103
972 Ga0114129_10268702
973 Ga0114129_10440648
974 Ga0114129_10798590
975 Ga0105243_10153182
976 Ga0105243_10372903
977 Ga0105242_10005103
978 Ga0105242_10117267
979 Ga0105237_10010320
980 Ga0105237_10031392
981 Ga0105238_10486365
982 Ga0105249_10008958
983 Ga0105249_10070652
984 Ga0105249_10182789
985 Ga0105249_10243423
986 Ga0105249_10682684
987 Ga0099796_10027737
988 Ga0099796_10071095
989 Ga0105239_10009837
990 Ga0105239_10055069
991 Ga0105239_10137085
992 Ga0157338_1013112
993 Ga0157374_10007842
994 Ga0157374_10009172
995 Ga0157374_10010109
996 Ga0157374_10032125
997 Ga0157374_10065734
998 Ga0157374_10153928
999 Ga0157374_10195249
1000 Ga0157374_10279178
1001 Ga0157374_10283149
1002 Ga0157374_10394247
1003 Ga0157374_10480083
1004 Ga0157374_10481634
1005 Ga0157374_10985578
1006 Ga0157378_10009004
1007 Ga0157378_10025623
1008 Ga0157378_10031002
1009 Ga0157378_10041230
1010 Ga0157378_10061844
1011 Ga0157378_10096757
1012 Ga0157378_10266658
1013 Ga0157378_10458463
1014 Ga0157378_10480253
1015 Ga0157378_10548740
1016 Ga0163162_10005079
1017 Ga0163162_10006220
1018 Ga0163162_10013945
1019 Ga0163162_10109331
1020 Ga0163162_10118489
1021 Ga0163162_10158828
1022 Ga0163162_10203642
1023 Ga0163162_10215911
1024 Ga0163162_10240366
1025 Ga0157372_10125444
1026 Ga0157372_10150741
1027 Ga0157372_10160801
1028 Ga0157372_10749529
1029 Ga0157375_10003326
1030 Ga0157375_10021001
1031 Ga0157375_10053876
1032 Ga0157375_10195680
1033 Ga0157375_10266772
1034 Ga0157375_10318236
1035 Ga0157375_10483264
1036 Ga0157375_10829726
1037 Ga0163163_10099885
1038 Ga0163163_10250705
1039 Ga0163163_10372707
1040 Ga0182008_10062333
1041 Ga0157379_10018054
1042 Ga0157379_10910066
1043 Ga0157376_10004419
1044 Ga0157376_10052256
1045 Ga0157376_10087191
1046 Ga0157376_10117052
1047 Ga0157376_10177982
1048 Ga0182005_1005473
1049 Ga0182005_1070198
1050 Ga0163161_10266085
1051 Ga0163161_10346204
1052 Ga0163161_10466708
1053 Ga0213876_10019864
1054 Ga0207666_1000532
1055 Ga0207666_1002337
1056 Ga0207673_1009035
1057 Ga0207697_10000106
1058 Ga0207697_10000239
1059 Ga0207697_10000384
1060 Ga0207697_10000675
1061 Ga0207697_10005572
1062 Ga0207697_10024746
1063 Ga0207697_10080657
1064 Ga0207682_10015240
1065 Ga0207692_10099194
1066 Ga0207642_10023998
1067 Ga0207710_10134166
1068 Ga0207688_10000619
1069 Ga0207688_10000766
1070 Ga0207688_10042973
1071 Ga0207688_10250111
1072 Ga0207688_10253378
1073 Ga0207680_10019731
1074 Ga0207647_10003644
1075 Ga0207685_10097479
1076 Ga0207699_10010376
1077 Ga0207699_10073970
1078 Ga0207699_10141287
1079 Ga0207645_10000593
1080 Ga0207645_10006877
1081 Ga0207645_10010353
1082 Ga0207645_10012412
1083 Ga0207645_10463628
1084 Ga0207705_10000430
1085 Ga0207705_10020300
1086 Ga0207705_10298931
1087 Ga0207684_10000043
1088 Ga0207684_10007962
1089 Ga0207684_10020480
1090 Ga0207684_10054615
1091 Ga0207684_10055108
1092 Ga0207684_10060227
1093 Ga0207684_10060471
1094 Ga0207684_10173730
1095 Ga0207684_10189987
1096 Ga0207684_10557894
1097 Ga0207695_10000093
1098 Ga0207671_10008351
1099 Ga0207671_10234212
1100 Ga0207693_10004002
1101 Ga0207693_10021448
1102 Ga0207693_10063334
1103 Ga0207693_10078451
1104 Ga0207693_10145764
1105 Ga0207693_10282400
1106 Ga0207663_10012721
1107 Ga0207663_10052155
1108 Ga0207662_10000157
1109 Ga0207662_10008803
1110 Ga0207657_10046701
1111 Ga0207657_10083323
1112 Ga0207657_10170594
1113 Ga0207649_10309104
1114 Ga0207652_10527886
1115 Ga0207646_10000513
1116 Ga0207646_10003677
1117 Ga0207646_10027683
1118 Ga0207646_10038535
1119 Ga0207646_10039540
1120 Ga0207646_10125049
1121 Ga0207646_10243778
1122 Ga0207646_10346946
1123 Ga0207646_10467835
1124 Ga0207681_10003225
1125 Ga0207681_10009120
1126 Ga0207681_10042854
1127 Ga0207681_10065417
1128 Ga0207681_10154288
1129 Ga0207650_10001096
1130 Ga0207650_10053724
1131 Ga0207659_10007541
1132 Ga0207659_10029416
1133 Ga0207659_10046934
1134 Ga0207659_10088903
1135 Ga0207659_10105118
1136 Ga0207659_10392298
1137 Ga0207687_10073364
1138 Ga0207687_10079931
1139 Ga0207700_10037693
1140 Ga0207700_10130775
1141 Ga0207700_10203787
1142 Ga0207700_10458324
1143 Ga0207664_10232840
1144 Ga0207664_10477754
1145 Ga0207644_10020135
1146 Ga0207644_10060522
1147 Ga0207644_10086153
1148 Ga0207644_10093820
1149 Ga0207644_10235715
1150 Ga0207644_10449668
1151 Ga0207690_10009577
1152 Ga0207690_10084269
1153 Ga0207706_10003628
1154 Ga0207706_10033911
1155 Ga0207706_10087246
1156 Ga0207686_10034695
1157 Ga0207686_10110739
1158 Ga0207670_10002877
1159 Ga0207670_10005081
1160 Ga0207670_10261656
1161 Ga0207670_10536762
1162 Ga0207669_10010287
1163 Ga0207669_10039680
1164 Ga0207669_10228122
1165 Ga0207704_10488363
1166 Ga0207665_10053495
1167 Ga0207665_10125937
1168 Ga0207665_10405776
1169 Ga0207691_10001220
1170 Ga0207691_10003896
1171 Ga0207691_10011033
1172 Ga0207691_10025155
1173 Ga0207689_10265206
1174 Ga0207661_10058825
1175 Ga0207661_10133995
1176 Ga0207661_10153315
1177 Ga0207679_10061969
1178 Ga0207667_10088605
1179 Ga0207651_10007258
1180 Ga0207651_10018500
1181 Ga0207651_10022188
1182 Ga0207651_10039271
1183 Ga0207651_10505753
1184 Ga0207712_10086957
1185 Ga0207712_10151885
1186 Ga0207668_10003175
1187 Ga0207668_10014021
1188 Ga0207668_10059270
1189 Ga0207668_10496105
1190 Ga0207658_10007135
1191 Ga0207658_10052524
1192 Ga0207658_10077845
1193 Ga0207658_10147502
1194 Ga0207677_10059824
1195 Ga0207677_10148970
1196 Ga0207677_10359351
1197 Ga0207677_10396948
1198 Ga0207703_10007665
1199 Ga0207703_10012394
1200 Ga0207703_10250909
1201 Ga0207639_10000001
1202 Ga0207639_10442587
1203 Ga0207639_10598330
1204 Ga0207678_10048423
1205 Ga0207678_10658995
1206 Ga0207708_10008840
1207 Ga0207648_10012757
1208 Ga0207648_10476175
1209 Ga0207675_100469815
1210 Ga0207675_100617577
1211 Ga0207683_10002653
1212 Ga0207683_10003604
1213 Ga0207683_10008086
1214 Ga0207683_10070826
1215 Ga0207683_10458671
1216 Ga0207698_10338457
1217 Ga0209974_10004814
1218 Ga0209974_10049995
1219 Ga0207428_10343028
1220 Ga0268266_10002974
1221 Ga0268266_10141483
1222 Ga0268266_10161405
1223 Ga0268266_10574551
1224 Ga0268265_10018839
1225 Ga0268265_10397537
1226 Ga0268264_10008218
1227 Ga0268264_10011950
1228 Ga0268264_10021850
1229 Ga0268264_10060925
1230 Ga0268264_10414671
1231 Ga0268264_10477854
1232 Ga0307513_10093726
1233 Ga0373959_0036791
1234 Ga0373940_0082905
1235 Ga0373944_0115947
1236 Ga0373932_0158300
1237 Ga0373945_0163451
1238 Ga0373943_0030336
1239 Ga0373943_0151178
1240 Ga0373943_0154588
1241 Ga0373946_0090256
1242 Ga0373946_0092041
1243 Ga0373946_0235078
1244 Ga0373955_0094916
1245 Ga0373924_0066559
1246 Ga0373935_0067357
1247 Ga0373935_0250894
1248 Ga0373927_0225263
1249 Ga0373933_0180851
1250 Ga0373947_0018018
1251 Ga0373947_0051719
1252 Ga0373947_0062249
1253 Ga0373947_0180444
1254 Ga0373925_0059921
1255 Ga0373925_0075105
1256 Ga0373925_0178495
1257 Ga0395900_0009876
1258 Ga0395900_0379306
1259 Ga0395898_0014853
1260 Ga0395898_0586066
1261 Ga0395905_0019798
1262 Ga0395905_0051394
1263 Ga0395905_0558714
1264 Ga0395901_0004662
1265 Ga0395901_0053682
1266 Ga0395901_0071409
1267 Ga0395901_0137096
1268 Ga0436365_0725183
1269 Ga0436365_0743711
1270 Ga0451787_787321
1271 Ga0451853_3052533
1272 Ga0451576_0038986
1273 Ga0451576_0063594
1274 Ga0466967_0782395
1275 Ga0495592_0060803
1276 Ga0495603_0164421
1277 Ga0495651_0135541
1278 Ga0495580_0167139
1279 Ga0495580_0220448
1280 Ga0495639_0121611
1281 Ga0495585_0035090
1282 Ga0495608_0182256
1283 Ga0495628_0288651
1284 Ga0495630_0124351
1285 Ga0495643_0000176
1286 Ga0495644_0062791
1287 Ga0495652_0024908
1288 Ga0495652_0211157
1289 Ga0495598_0001731
1290 Ga0495598_0014056
1291 Ga0495645_0047814
1292 Ga0495634_0248949
1293 Ga0495659_0008961
1294 Ga0495659_0050632
1295 Ga0495659_0141065
1296 Ga0495588_0121148
1297 Ga0495599_0033741
1298 Ga0495599_0215267
1299 Ga0495623_0079725
1300 Ga0495646_0053143
1301 Ga0495658_0114094
1302 Ga0495669_0063231
1303 Ga0495670_0216466
1304 Ga0495671_0120689
1305 Ga0495600_0351843
1306 Ga0495581_0213655
1307 Ga0495604_0308817
1308 Ga0495674_0154019
1309 Ga0495675_0011585
1310 Ga0495684_0006328
1311 Ga0495684_0090540
1312 Ga0495602_0069761
1313 Ga0496100_0023535
1314 Ga0496100_0170912
1315 Ga0496101_0003525
1316 Ga0496101_0092484
1317 Ga0496101_0131754
1318 Ga0496101_0377263
1319 Ga0496102_0050163
1320 Ga0496102_0118429
1321 Ga0496102_0150245
1322 Ga0496102_0557113
1323 Ga0496104_0073911
1324 Ga0496105_0143744
1325 Ga0496105_0229527
1326 Ga0496105_0247800
1327 Ga0496105_0379870
1328 Ga0496106_0020281
1329 Ga0496107_0022989
1330 Ga0496107_0061696
1331 Ga0496107_0275955
1332 Ga0496108_0043777
1333 Ga0496108_0120947
1334 Ga0496108_0125391
1335 Ga0496108_0364127
1336 Ga0496108_0495896
1337 Ga0496109_0009018
1338 Ga0496109_0098208
1339 Ga0496109_0117018
1340 Ga0496109_0182387
1341 Ga0496109_0188090
1342 Ga0496109_0282367
1343 Ga0496110_0022417
1344 Ga0496110_0345746
1345 Ga0496110_0444512
1346 Ga0496110_0546224
1347 Ga0496111_0283704
1348 Ga0496112_0005284
1349 Ga0496112_0014542
1350 Ga0496112_0029766
1351 Ga0496112_0047623
1352 Ga0496112_0329358
1353 Ga0496112_0366672
1354 Ga0496113_0116490
1355 Ga0496113_0130664
1356 Ga0496113_0266185
1357 Ga0496114_0024566
1358 Ga0496114_0061373
1359 Ga0496115_0001810
1360 Ga0496115_0016337
1361 Ga0496115_0098535
1362 Ga0496115_0168166
1363 nmdc:mga05p37_1087359_c1
1364 nmdc:mga05p37_446057_c1
1365 nmdc:mga05p37_5724_c2
1366 nmdc:mga05p37_777871_c1
1367 nmdc:mga08y16_82954_c1
1368 nmdc:mga0n895_263653_c1
1369 nmdc:mga0n895_571204_c1
1370 nmdc:mga0rr50_102775_c1
1371 nmdc:mga0rr50_486973_c1
1372 nmdc:mga08x19_64194_c1
1373 nmdc:mga0a205_207276_c1
1374 nmdc:mga0a205_719227_c1
1375 Ga0495619_0094039
1376 2787505954

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06182

ABC2_membrane_6

ABC-2 family transporter protein

49

279

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.6485 4 253
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.6476 6 253
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.6362 4 253
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.6339 4 253
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.6301 6 253
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5396 57 245 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5199 47 244 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5087 31 250 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4489 31 250 3.40.1710.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4407 55 249 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2V6LXK8-F1-model_v4 ABC transporter permease 0.972 42 258 GO:0016020
AF-A0A2V5SRU2-F1-model_v4 ABC transporter permease 0.9643 109 258 GO:0016020
AF-A0A2V6LXK8-F1-model_v4 ABC transporter permease 0.9633 42 258 GO:0016020
AF-A0A2V6H6N7-F1-model_v4 ABC transporter permease 0.9582 79 258 GO:0016020
AF-A0A2V6BR21-F1-model_v4 ABC transporter permease 0.958 130 258 GO:0016020

Map