F475310
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 688 | 253 | 1376 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100319050|Ga0068853_1003190502 |
| Length | 280 |
| Sequence | LNRFVIRPPSFVIFIVSRYLEIYWMMIRNSLIREMSFKANFLLWIVVEFLWFVGQVVFLEVIYGHVDNIAGWSKWECVLLIGTHQITSQIFQAFFYVNLAELPELVRTGRLDLNLLLPVDAQFAVSTRKFGMDNIVNALVGVAIVVFSLAKLHVVPSAMQIALYIVAVGFGVAIHYAVLFGLATAAFWIVRAQGLIYGYFNVFNIARFPESIFPYSIFKIVFSYFIPVIIVANVPAITLARSFQSPWAGLAQLVVATVFIVSLTRAFWHFALRRYSSASS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 177 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 7.41 |
| Rhizosphere | 91.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068853_100319050 | 3300005539 | Bacteria | 1440 |
| 2 | SwRhRL2b_contig_2929379 | 2162886007 | Unclassified | 1668 |
| 3 | SwRhRL2b_contig_3225193 | 2162886007 | Unclassified | 3032 |
| 4 | SwRhRL2b_contig_3559768 | 2162886007 | Unclassified | 2989 |
| 5 | CNXas_1000054 | 3300000545 | Bacteria | 21918 |
| 6 | JGI24746J21847_1004506 | 3300001977 | Unclassified | 2195 |
| 7 | JGI24737J22298_10014965 | 3300001990 | Bacteria | 2513 |
| 8 | JGI24750J21931_1023983 | 3300002070 | Unclassified | 868 |
| 9 | JGI24035J26624_1000831 | 3300002126 | Unclassified | 2915 |
| 10 | JGI24035J26624_1001587 | 3300002126 | Unclassified | 2148 |
| 11 | JGI24035J26624_1005740 | 3300002126 | Bacteria | 1190 |
| 12 | JGI24035J26624_1006431 | 3300002126 | Bacteria | 1134 |
| 13 | JGI24034J26672_10029203 | 3300002239 | Bacteria | 892 |
| 14 | JGI25406J46586_10000023 | 3300003203 | Bacteria | 76640 |
| 15 | JGI25404J52841_10007566 | 3300003659 | Bacteria | 2300 |
| 16 | JGI25405J52794_10004719 | 3300003911 | Bacteria | 2440 |
| 17 | JGI25405J52794_10010745 | 3300003911 | Bacteria | 1746 |
| 18 | Ga0065703_1019827 | 3300005272 | Unclassified | 2346 |
| 19 | Ga0065704_10007112 | 3300005289 | Bacteria | 2370 |
| 20 | Ga0065704_10078626 | 3300005289 | Bacteria | 4378 |
| 21 | Ga0065704_10112617 | 3300005289 | Bacteria | 1913 |
| 22 | Ga0065712_10008183 | 3300005290 | Unclassified | 2326 |
| 23 | Ga0065712_10079225 | 3300005290 | Bacteria | 3243 |
| 24 | Ga0065712_10098032 | 3300005290 | Bacteria | 2132 |
| 25 | Ga0065712_10099310 | 3300005290 | Bacteria | 2095 |
| 26 | Ga0065712_10172837 | 3300005290 | Bacteria | 1234 |
| 27 | Ga0065712_10199461 | 3300005290 | Unclassified | 1114 |
| 28 | Ga0065715_10000634 | 3300005293 | Bacteria | 10072 |
| 29 | Ga0065715_10006297 | 3300005293 | Bacteria | 3460 |
| 30 | Ga0065715_10010746 | 3300005293 | Bacteria | 2625 |
| 31 | Ga0065715_10131347 | 3300005293 | Bacteria | 2009 |
| 32 | Ga0065715_10184365 | 3300005293 | Bacteria | 1417 |
| 33 | Ga0065715_10205606 | 3300005293 | Bacteria | 1329 |
| 34 | Ga0065715_10216202 | 3300005293 | Unclassified | 1292 |
| 35 | Ga0065715_10395014 | 3300005293 | Bacteria | 889 |
| 36 | Ga0065707_10007784 | 3300005295 | Bacteria | 6660 |
| 37 | Ga0065707_10290155 | 3300005295 | Bacteria | 1027 |
| 38 | Ga0065707_10328605 | 3300005295 | Unclassified | 953 |
| 39 | Ga0070658_10000314 | 3300005327 | Bacteria | 41791 |
| 40 | Ga0070658_10028042 | 3300005327 | Unclassified | 4519 |
| 41 | Ga0070658_10109062 | 3300005327 | Unclassified | 2292 |
| 42 | Ga0070676_10000759 | 3300005328 | Bacteria | 15860 |
| 43 | Ga0070676_10003127 | 3300005328 | Bacteria | 8550 |
| 44 | Ga0070676_10004090 | 3300005328 | Bacteria | 7667 |
| 45 | Ga0070676_10103501 | 3300005328 | Bacteria | 1763 |
| 46 | Ga0070676_10120206 | 3300005328 | Bacteria | 1648 |
| 47 | Ga0070683_100084083 | 3300005329 | Bacteria | 2982 |
| 48 | Ga0070683_100353845 | 3300005329 | Bacteria | 1399 |
| 49 | Ga0070690_100126582 | 3300005330 | Bacteria | 1720 |
| 50 | Ga0070670_100008345 | 3300005331 | Bacteria | 8830 |
| 51 | Ga0070677_10033266 | 3300005333 | Bacteria | 1984 |
| 52 | Ga0070666_10014771 | 3300005335 | Bacteria | 4975 |
| 53 | Ga0070666_10017399 | 3300005335 | Bacteria | 4608 |
| 54 | Ga0070666_10036328 | 3300005335 | Bacteria | 3270 |
| 55 | Ga0070666_10066312 | 3300005335 | Bacteria | 2449 |
| 56 | Ga0070666_10127690 | 3300005335 | Bacteria | 1765 |
| 57 | Ga0070682_100211792 | 3300005337 | Unclassified | 1374 |
| 58 | Ga0068868_100035263 | 3300005338 | Bacteria | 3866 |
| 59 | Ga0068868_100040543 | 3300005338 | Unclassified | 3624 |
| 60 | Ga0068868_100138806 | 3300005338 | Bacteria | 1994 |
| 61 | Ga0068868_100154326 | 3300005338 | Bacteria | 1893 |
| 62 | Ga0070660_100099471 | 3300005339 | Bacteria | 2303 |
| 63 | Ga0070689_100001923 | 3300005340 | Bacteria | 13432 |
| 64 | Ga0070689_100002311 | 3300005340 | Bacteria | 12406 |
| 65 | Ga0070689_100005623 | 3300005340 | Bacteria | 8583 |
| 66 | Ga0070689_100266532 | 3300005340 | Bacteria | 1417 |
| 67 | Ga0070689_100484642 | 3300005340 | Bacteria | 1057 |
| 68 | Ga0070687_100000585 | 3300005343 | Bacteria | 12125 |
| 69 | Ga0070687_100210657 | 3300005343 | Bacteria | 1184 |
| 70 | Ga0070661_100374226 | 3300005344 | Bacteria | 1122 |
| 71 | Ga0070668_100004269 | 3300005347 | Bacteria | 10602 |
| 72 | Ga0070668_100004794 | 3300005347 | Bacteria | 10026 |
| 73 | Ga0070668_100096261 | 3300005347 | Bacteria | 2339 |
| 74 | Ga0070668_100294538 | 3300005347 | Unclassified | 1359 |
| 75 | Ga0070669_100004777 | 3300005353 | Bacteria | 9775 |
| 76 | Ga0070669_100023284 | 3300005353 | Bacteria | 4435 |
| 77 | Ga0070669_100051535 | 3300005353 | Unclassified | 3009 |
| 78 | Ga0070669_100074737 | 3300005353 | Bacteria | 2512 |
| 79 | Ga0070669_100189808 | 3300005353 | Bacteria | 1611 |
| 80 | Ga0070669_100222792 | 3300005353 | Bacteria | 1492 |
| 81 | Ga0070669_100384727 | 3300005353 | Unclassified | 1145 |
| 82 | Ga0070675_100003641 | 3300005354 | Bacteria | 11721 |
| 83 | Ga0070675_100005459 | 3300005354 | Bacteria | 9726 |
| 84 | Ga0070675_100018755 | 3300005354 | Bacteria | 5507 |
| 85 | Ga0070675_100029200 | 3300005354 | Bacteria | 4445 |
| 86 | Ga0070675_100063876 | 3300005354 | Bacteria | 3044 |
| 87 | Ga0070675_100300599 | 3300005354 | Bacteria | 1414 |
| 88 | Ga0070675_100510903 | 3300005354 | Bacteria | 1083 |
| 89 | Ga0070671_100000966 | 3300005355 | Bacteria | 21064 |
| 90 | Ga0070671_100020232 | 3300005355 | Bacteria | 5426 |
| 91 | Ga0070671_100026158 | 3300005355 | Bacteria | 4794 |
| 92 | Ga0070671_100061696 | 3300005355 | Bacteria | 3122 |
| 93 | Ga0070671_100090021 | 3300005355 | Bacteria | 2568 |
| 94 | Ga0070674_100015414 | 3300005356 | Bacteria | 4770 |
| 95 | Ga0070674_100087391 | 3300005356 | Bacteria | 2241 |
| 96 | Ga0070674_100433985 | 3300005356 | Bacteria | 1081 |
| 97 | Ga0070673_100062566 | 3300005364 | Unclassified | 2957 |
| 98 | Ga0070673_100201108 | 3300005364 | Bacteria | 1716 |
| 99 | Ga0070673_100341003 | 3300005364 | Bacteria | 1328 |
| 100 | Ga0070688_100003252 | 3300005365 | Bacteria | 8324 |
| 101 | Ga0070688_100006168 | 3300005365 | Bacteria | 6380 |
| 102 | Ga0070688_100055467 | 3300005365 | Unclassified | 2485 |
| 103 | Ga0070688_100109047 | 3300005365 | Bacteria | 1838 |
| 104 | Ga0070688_100161670 | 3300005365 | Bacteria | 1539 |
| 105 | Ga0070659_100002393 | 3300005366 | Bacteria | 13330 |
| 106 | Ga0070659_100006312 | 3300005366 | Bacteria | 8562 |
| 107 | Ga0070667_100003645 | 3300005367 | Bacteria | 13106 |
| 108 | Ga0070667_100007325 | 3300005367 | Bacteria | 9170 |
| 109 | Ga0070667_100013130 | 3300005367 | Bacteria | 6847 |
| 110 | Ga0070667_100049340 | 3300005367 | Bacteria | 3545 |
| 111 | Ga0070709_10029851 | 3300005434 | Bacteria | 3265 |
| 112 | Ga0070709_10058520 | 3300005434 | Bacteria | 2444 |
| 113 | Ga0070709_10286161 | 3300005434 | Unclassified | 1199 |
| 114 | Ga0070714_100450557 | 3300005435 | Bacteria | 1222 |
| 115 | Ga0070714_100499000 | 3300005435 | Unclassified | 1160 |
| 116 | Ga0070713_100030518 | 3300005436 | Bacteria | 4282 |
| 117 | Ga0070713_100040161 | 3300005436 | Bacteria | 3803 |
| 118 | Ga0070713_100160642 | 3300005436 | Bacteria | 2005 |
| 119 | Ga0070713_100181493 | 3300005436 | Bacteria | 1891 |
| 120 | Ga0070713_100302588 | 3300005436 | Bacteria | 1472 |
| 121 | Ga0070713_100377917 | 3300005436 | Bacteria | 1319 |
| 122 | Ga0070710_10090439 | 3300005437 | Bacteria | 1804 |
| 123 | Ga0070711_100004894 | 3300005439 | Bacteria | 7954 |
| 124 | Ga0070711_100042226 | 3300005439 | Bacteria | 3082 |
| 125 | Ga0070711_100114145 | 3300005439 | Bacteria | 1987 |
| 126 | Ga0070711_100284004 | 3300005439 | Unclassified | 1310 |
| 127 | Ga0070711_100370649 | 3300005439 | Bacteria | 1155 |
| 128 | Ga0070705_100201364 | 3300005440 | Unclassified | 1365 |
| 129 | Ga0070694_100132518 | 3300005444 | Unclassified | 1802 |
| 130 | Ga0070708_100031485 | 3300005445 | Bacteria | 4591 |
| 131 | Ga0070708_100043385 | 3300005445 | Bacteria | 3952 |
| 132 | Ga0070708_100093957 | 3300005445 | Bacteria | 2735 |
| 133 | Ga0070708_100153991 | 3300005445 | Bacteria | 2139 |
| 134 | Ga0070708_100300124 | 3300005445 | Bacteria | 1512 |
| 135 | Ga0070708_100371124 | 3300005445 | Bacteria | 1349 |
| 136 | Ga0070708_100373410 | 3300005445 | Unclassified | 1344 |
| 137 | Ga0070708_100571209 | 3300005445 | Unclassified | 1066 |
| 138 | Ga0070708_100671413 | 3300005445 | Unclassified | 976 |
| 139 | Ga0070678_100002283 | 3300005456 | Bacteria | 10436 |
| 140 | Ga0070678_100120639 | 3300005456 | Bacteria | 2067 |
| 141 | Ga0070678_100129195 | 3300005456 | Unclassified | 2005 |
| 142 | Ga0070678_100150030 | 3300005456 | Bacteria | 1877 |
| 143 | Ga0070678_100483898 | 3300005456 | Bacteria | 1089 |
| 144 | Ga0070662_100002790 | 3300005457 | Bacteria | 10816 |
| 145 | Ga0070662_100065244 | 3300005457 | Bacteria | 2668 |
| 146 | Ga0068867_100079364 | 3300005459 | Bacteria | 2470 |
| 147 | Ga0068867_100101588 | 3300005459 | Bacteria | 2197 |
| 148 | Ga0068867_100103544 | 3300005459 | Unclassified | 2177 |
| 149 | Ga0068867_100398109 | 3300005459 | Bacteria | 1161 |
| 150 | Ga0070706_100000072 | 3300005467 | Bacteria | 117347 |
| 151 | Ga0070706_100005839 | 3300005467 | Bacteria | 11678 |
| 152 | Ga0070706_100015133 | 3300005467 | Bacteria | 7123 |
| 153 | Ga0070706_100062984 | 3300005467 | Bacteria | 3427 |
| 154 | Ga0070706_100074559 | 3300005467 | Bacteria | 3140 |
| 155 | Ga0070706_100091695 | 3300005467 | Bacteria | 2818 |
| 156 | Ga0070706_100121436 | 3300005467 | Bacteria | 2435 |
| 157 | Ga0070706_100151004 | 3300005467 | Bacteria | 2169 |
| 158 | Ga0070706_100174569 | 3300005467 | Bacteria | 2007 |
| 159 | Ga0070706_100240938 | 3300005467 | Unclassified | 1689 |
| 160 | Ga0070706_100442468 | 3300005467 | Unclassified | 1210 |
| 161 | Ga0070707_100000414 | 3300005468 | Bacteria | 42193 |
| 162 | Ga0070707_100011922 | 3300005468 | Bacteria | 8110 |
| 163 | Ga0070707_100016298 | 3300005468 | Bacteria | 6975 |
| 164 | Ga0070707_100018415 | 3300005468 | Bacteria | 6569 |
| 165 | Ga0070707_100020265 | 3300005468 | Bacteria | 6270 |
| 166 | Ga0070707_100041911 | 3300005468 | Bacteria | 4383 |
| 167 | Ga0070707_100055645 | 3300005468 | Bacteria | 3793 |
| 168 | Ga0070707_100056090 | 3300005468 | Bacteria | 3778 |
| 169 | Ga0070707_100065104 | 3300005468 | Bacteria | 3501 |
| 170 | Ga0070707_100147710 | 3300005468 | Bacteria | 2288 |
| 171 | Ga0070707_100151675 | 3300005468 | Bacteria | 2257 |
| 172 | Ga0070707_100215729 | 3300005468 | Bacteria | 1870 |
| 173 | Ga0070707_100482331 | 3300005468 | Unclassified | 1201 |
| 174 | Ga0070698_100002051 | 3300005471 | Bacteria | 22375 |
| 175 | Ga0070698_100003705 | 3300005471 | Bacteria | 16773 |
| 176 | Ga0070698_100036057 | 3300005471 | Bacteria | 5112 |
| 177 | Ga0070698_100464528 | 3300005471 | Unclassified | 1202 |
| 178 | Ga0070699_100053744 | 3300005518 | Unclassified | 3486 |
| 179 | Ga0070699_100242952 | 3300005518 | Bacteria | 1608 |
| 180 | Ga0070699_100320643 | 3300005518 | Bacteria | 1393 |
| 181 | Ga0070679_100544908 | 3300005530 | Bacteria | 1104 |
| 182 | Ga0070684_100019475 | 3300005535 | Bacteria | 5614 |
| 183 | Ga0070684_100074143 | 3300005535 | Bacteria | 2999 |
| 184 | Ga0070684_100144648 | 3300005535 | Bacteria | 2151 |
| 185 | Ga0070697_100004384 | 3300005536 | Bacteria | 10834 |
| 186 | Ga0070697_100008529 | 3300005536 | Bacteria | 8001 |
| 187 | Ga0070697_100012783 | 3300005536 | Bacteria | 6576 |
| 188 | Ga0070697_100013951 | 3300005536 | Bacteria | 6309 |
| 189 | Ga0070697_100109712 | 3300005536 | Bacteria | 2298 |
| 190 | Ga0070697_100110102 | 3300005536 | Bacteria | 2294 |
| 191 | Ga0070697_100113329 | 3300005536 | Bacteria | 2262 |
| 192 | Ga0070697_100279707 | 3300005536 | Unclassified | 1431 |
| 193 | Ga0070697_100284893 | 3300005536 | Bacteria | 1418 |
| 194 | Ga0070697_100309023 | 3300005536 | Bacteria | 1360 |
| 195 | Ga0070697_100404002 | 3300005536 | Bacteria | 1186 |
| 196 | Ga0068853_100000001 | 3300005539 | Bacteria | 715840 |
| 197 | Ga0068853_100303983 | 3300005539 | Unclassified | 1475 |
| 198 | Ga0070672_100013289 | 3300005543 | Bacteria | 5811 |
| 199 | Ga0070672_100021779 | 3300005543 | Bacteria | 4694 |
| 200 | Ga0070672_100220833 | 3300005543 | Bacteria | 1589 |
| 201 | Ga0070672_100370792 | 3300005543 | Unclassified | 1223 |
| 202 | Ga0070695_100040110 | 3300005545 | Bacteria | 2962 |
| 203 | Ga0070696_100173640 | 3300005546 | Bacteria | 1595 |
| 204 | Ga0070693_100030019 | 3300005547 | Bacteria | 2969 |
| 205 | Ga0070665_100019885 | 3300005548 | Bacteria | 6742 |
| 206 | Ga0070665_100108726 | 3300005548 | Bacteria | 2775 |
| 207 | Ga0070665_100114340 | 3300005548 | Bacteria | 2701 |
| 208 | Ga0070665_100125567 | 3300005548 | Bacteria | 2568 |
| 209 | Ga0070665_100131849 | 3300005548 | Bacteria | 2501 |
| 210 | Ga0070665_100273159 | 3300005548 | Unclassified | 1692 |
| 211 | Ga0068855_100000294 | 3300005563 | Bacteria | 61922 |
| 212 | Ga0070664_100049228 | 3300005564 | Bacteria | 3563 |
| 213 | Ga0070664_100372678 | 3300005564 | Bacteria | 1302 |
| 214 | Ga0068856_100109277 | 3300005614 | Bacteria | 2761 |
| 215 | Ga0070702_100107594 | 3300005615 | Bacteria | 1722 |
| 216 | Ga0068852_100092731 | 3300005616 | Bacteria | 2705 |
| 217 | Ga0068859_100088056 | 3300005617 | Bacteria | 3154 |
| 218 | Ga0068866_10036187 | 3300005718 | Bacteria | 2417 |
| 219 | Ga0068866_10036702 | 3300005718 | Bacteria | 2402 |
| 220 | Ga0068861_100401763 | 3300005719 | Unclassified | 1216 |
| 221 | Ga0068861_100495012 | 3300005719 | Bacteria | 1104 |
| 222 | Ga0068863_100006720 | 3300005841 | Bacteria | 11276 |
| 223 | Ga0068858_100004519 | 3300005842 | Bacteria | 13640 |
| 224 | Ga0068858_100027473 | 3300005842 | Bacteria | 5286 |
| 225 | Ga0068858_100607648 | 3300005842 | Bacteria | 1061 |
| 226 | Ga0068860_100030461 | 3300005843 | Bacteria | 5189 |
| 227 | Ga0068860_100112764 | 3300005843 | Bacteria | 2600 |
| 228 | Ga0068860_100114149 | 3300005843 | Bacteria | 2583 |
| 229 | Ga0068860_100218262 | 3300005843 | Unclassified | 1851 |
| 230 | Ga0068860_100302873 | 3300005843 | Bacteria | 1566 |
| 231 | Ga0068860_100509850 | 3300005843 | Unclassified | 1202 |
| 232 | Ga0068862_100033520 | 3300005844 | Bacteria | 4342 |
| 233 | Ga0068862_100224970 | 3300005844 | Bacteria | 1700 |
| 234 | Ga0081455_10002038 | 3300005937 | Bacteria | 24159 |
| 235 | Ga0081455_10002816 | 3300005937 | Bacteria | 20483 |
| 236 | Ga0081455_10007921 | 3300005937 | Bacteria | 11117 |
| 237 | Ga0081455_10385360 | 3300005937 | Unclassified | 978 |
| 238 | Ga0081540_1000014 | 3300005983 | Bacteria | 179266 |
| 239 | Ga0081540_1043180 | 3300005983 | Bacteria | 2316 |
| 240 | Ga0081539_10000014 | 3300005985 | Bacteria | 411270 |
| 241 | Ga0081539_10003564 | 3300005985 | Bacteria | 18907 |
| 242 | Ga0081539_10009184 | 3300005985 | Bacteria | 8333 |
| 243 | Ga0081539_10015129 | 3300005985 | Bacteria | 5642 |
| 244 | Ga0070717_10008397 | 3300006028 | Bacteria | 7713 |
| 245 | Ga0070717_10082917 | 3300006028 | Unclassified | 2695 |
| 246 | Ga0070717_10166961 | 3300006028 | Bacteria | 1912 |
| 247 | Ga0070717_10303407 | 3300006028 | Unclassified | 1420 |
| 248 | Ga0070717_10356255 | 3300006028 | Bacteria | 1309 |
| 249 | Ga0070717_10425619 | 3300006028 | Unclassified | 1194 |
| 250 | Ga0070717_10464382 | 3300006028 | Unclassified | 1142 |
| 251 | Ga0070715_10092523 | 3300006163 | Bacteria | 1394 |
| 252 | Ga0070716_100040226 | 3300006173 | Unclassified | 2600 |
| 253 | Ga0070716_100051233 | 3300006173 | Bacteria | 2346 |
| 254 | Ga0070716_100218199 | 3300006173 | Bacteria | 1279 |
| 255 | Ga0070716_100247374 | 3300006173 | Bacteria | 1213 |
| 256 | Ga0070712_100033533 | 3300006175 | Bacteria | 3475 |
| 257 | Ga0070712_100037558 | 3300006175 | Bacteria | 3303 |
| 258 | Ga0070712_100062757 | 3300006175 | Unclassified | 2628 |
| 259 | Ga0070712_100104127 | 3300006175 | Bacteria | 2105 |
| 260 | Ga0070712_100241365 | 3300006175 | Bacteria | 1439 |
| 261 | Ga0070712_100416529 | 3300006175 | Unclassified | 1112 |
| 262 | Ga0070712_100465609 | 3300006175 | Bacteria | 1055 |
| 263 | Ga0075362_10144429 | 3300006177 | Unclassified | 1138 |
| 264 | Ga0097621_100018440 | 3300006237 | Bacteria | 5331 |
| 265 | Ga0097621_100072422 | 3300006237 | Unclassified | 2850 |
| 266 | Ga0068871_100009562 | 3300006358 | Bacteria | 7037 |
| 267 | Ga0068871_100036935 | 3300006358 | Bacteria | 3893 |
| 268 | Ga0075434_100273395 | 3300006871 | Bacteria | 1709 |
| 269 | Ga0075434_100308544 | 3300006871 | Bacteria | 1603 |
| 270 | Ga0068865_100088034 | 3300006881 | Unclassified | 2246 |
| 271 | Ga0068865_100184419 | 3300006881 | Bacteria | 1609 |
| 272 | Ga0068865_100521925 | 3300006881 | Bacteria | 993 |
| 273 | Ga0075436_100192292 | 3300006914 | Bacteria | 1444 |
| 274 | Ga0097620_100088060 | 3300006931 | Bacteria | 3154 |
| 275 | Ga0075435_100058107 | 3300007076 | Bacteria | 3131 |
| 276 | Ga0075435_100336742 | 3300007076 | Bacteria | 1293 |
| 277 | Ga0099794_10159784 | 3300007265 | Unclassified | 1146 |
| 278 | Ga0099795_10010810 | 3300007788 | Bacteria | 2703 |
| 279 | Ga0111539_10013275 | 3300009094 | Bacteria | 10294 |
| 280 | Ga0105245_10149349 | 3300009098 | Bacteria | 2208 |
| 281 | Ga0105245_10658301 | 3300009098 | Unclassified | 1078 |
| 282 | Ga0105247_10449562 | 3300009101 | Unclassified | 929 |
| 283 | Ga0114129_10000103 | 3300009147 | Bacteria | 83612 |
| 284 | Ga0114129_10268702 | 3300009147 | Unclassified | 2282 |
| 285 | Ga0114129_10440648 | 3300009147 | Bacteria | 1710 |
| 286 | Ga0114129_10798590 | 3300009147 | Bacteria | 1204 |
| 287 | Ga0105243_10153182 | 3300009148 | Bacteria | 1980 |
| 288 | Ga0105243_10372903 | 3300009148 | Bacteria | 1317 |
| 289 | Ga0105242_10005103 | 3300009176 | Bacteria | 10134 |
| 290 | Ga0105242_10117267 | 3300009176 | Bacteria | 2279 |
| 291 | Ga0105237_10010320 | 3300009545 | Bacteria | 9951 |
| 292 | Ga0105237_10031392 | 3300009545 | Bacteria | 5388 |
| 293 | Ga0105238_10486365 | 3300009551 | Unclassified | 1234 |
| 294 | Ga0105249_10008958 | 3300009553 | Bacteria | 8741 |
| 295 | Ga0105249_10070652 | 3300009553 | Unclassified | 3223 |
| 296 | Ga0105249_10182789 | 3300009553 | Bacteria | 2041 |
| 297 | Ga0105249_10243423 | 3300009553 | Bacteria | 1779 |
| 298 | Ga0105249_10682684 | 3300009553 | Unclassified | 1086 |
| 299 | Ga0099796_10027737 | 3300010159 | Bacteria | 1811 |
| 300 | Ga0099796_10071095 | 3300010159 | Unclassified | 1256 |
| 301 | Ga0105239_10009837 | 3300010375 | Bacteria | 10741 |
| 302 | Ga0105239_10055069 | 3300010375 | Bacteria | 4363 |
| 303 | Ga0105239_10137085 | 3300010375 | Bacteria | 2724 |
| 304 | Ga0157338_1013112 | 3300012515 | Bacteria | 875 |
| 305 | Ga0157374_10007842 | 3300013296 | Bacteria | 9115 |
| 306 | Ga0157374_10009172 | 3300013296 | Bacteria | 8482 |
| 307 | Ga0157374_10010109 | 3300013296 | Bacteria | 8104 |
| 308 | Ga0157374_10032125 | 3300013296 | Bacteria | 4777 |
| 309 | Ga0157374_10065734 | 3300013296 | Bacteria | 3407 |
| 310 | Ga0157374_10153928 | 3300013296 | Unclassified | 2237 |
| 311 | Ga0157374_10195249 | 3300013296 | Unclassified | 1981 |
| 312 | Ga0157374_10279178 | 3300013296 | Bacteria | 1649 |
| 313 | Ga0157374_10283149 | 3300013296 | Bacteria | 1637 |
| 314 | Ga0157374_10394247 | 3300013296 | Bacteria | 1380 |
| 315 | Ga0157374_10480083 | 3300013296 | Unclassified | 1246 |
| 316 | Ga0157374_10481634 | 3300013296 | Unclassified | 1244 |
| 317 | Ga0157374_10985578 | 3300013296 | Bacteria | 862 |
| 318 | Ga0157378_10009004 | 3300013297 | Bacteria | 8692 |
| 319 | Ga0157378_10025623 | 3300013297 | Bacteria | 5192 |
| 320 | Ga0157378_10031002 | 3300013297 | Bacteria | 4722 |
| 321 | Ga0157378_10041230 | 3300013297 | Bacteria | 4095 |
| 322 | Ga0157378_10061844 | 3300013297 | Bacteria | 3343 |
| 323 | Ga0157378_10096757 | 3300013297 | Bacteria | 2690 |
| 324 | Ga0157378_10266658 | 3300013297 | Bacteria | 1645 |
| 325 | Ga0157378_10458463 | 3300013297 | Bacteria | 1266 |
| 326 | Ga0157378_10480253 | 3300013297 | Unclassified | 1238 |
| 327 | Ga0157378_10548740 | 3300013297 | Unclassified | 1161 |
| 328 | Ga0163162_10005079 | 3300013306 | Bacteria | 12675 |
| 329 | Ga0163162_10006220 | 3300013306 | Bacteria | 11569 |
| 330 | Ga0163162_10013945 | 3300013306 | Bacteria | 7853 |
| 331 | Ga0163162_10109331 | 3300013306 | Unclassified | 2861 |
| 332 | Ga0163162_10118489 | 3300013306 | Bacteria | 2750 |
| 333 | Ga0163162_10158828 | 3300013306 | Bacteria | 2382 |
| 334 | Ga0163162_10203642 | 3300013306 | Unclassified | 2108 |
| 335 | Ga0163162_10215911 | 3300013306 | Bacteria | 2048 |
| 336 | Ga0163162_10240366 | 3300013306 | Bacteria | 1942 |
| 337 | Ga0157372_10125444 | 3300013307 | Unclassified | 2951 |
| 338 | Ga0157372_10150741 | 3300013307 | Bacteria | 2684 |
| 339 | Ga0157372_10160801 | 3300013307 | Bacteria | 2595 |
| 340 | Ga0157372_10749529 | 3300013307 | Bacteria | 1136 |
| 341 | Ga0157375_10003326 | 3300013308 | Bacteria | 13922 |
| 342 | Ga0157375_10021001 | 3300013308 | Bacteria | 5978 |
| 343 | Ga0157375_10053876 | 3300013308 | Bacteria | 3960 |
| 344 | Ga0157375_10195680 | 3300013308 | Bacteria | 2177 |
| 345 | Ga0157375_10266772 | 3300013308 | Unclassified | 1874 |
| 346 | Ga0157375_10318236 | 3300013308 | Bacteria | 1720 |
| 347 | Ga0157375_10483264 | 3300013308 | Bacteria | 1403 |
| 348 | Ga0157375_10829726 | 3300013308 | Bacteria | 1072 |
| 349 | Ga0163163_10099885 | 3300014325 | Unclassified | 2923 |
| 350 | Ga0163163_10250705 | 3300014325 | Bacteria | 1821 |
| 351 | Ga0163163_10372707 | 3300014325 | Bacteria | 1485 |
| 352 | Ga0182008_10062333 | 3300014497 | Unclassified | 1838 |
| 353 | Ga0157379_10018054 | 3300014968 | Bacteria | 6219 |
| 354 | Ga0157379_10910066 | 3300014968 | Unclassified | 835 |
| 355 | Ga0157376_10004419 | 3300014969 | Bacteria | 9790 |
| 356 | Ga0157376_10052256 | 3300014969 | Unclassified | 3397 |
| 357 | Ga0157376_10087191 | 3300014969 | Unclassified | 2693 |
| 358 | Ga0157376_10117052 | 3300014969 | Bacteria | 2356 |
| 359 | Ga0157376_10177982 | 3300014969 | Bacteria | 1942 |
| 360 | Ga0182005_1005473 | 3300015265 | Bacteria | 3963 |
| 361 | Ga0182005_1070198 | 3300015265 | Bacteria | 962 |
| 362 | Ga0163161_10266085 | 3300017792 | Unclassified | 1340 |
| 363 | Ga0163161_10346204 | 3300017792 | Bacteria | 1180 |
| 364 | Ga0163161_10466708 | 3300017792 | Bacteria | 1023 |
| 365 | Ga0213876_10019864 | 3300021384 | Unclassified | 3548 |
| 366 | Ga0207666_1000532 | 3300025271 | Bacteria | 4649 |
| 367 | Ga0207666_1002337 | 3300025271 | Bacteria | 2279 |
| 368 | Ga0207673_1009035 | 3300025290 | Unclassified | 1269 |
| 369 | Ga0207697_10000106 | 3300025315 | Bacteria | 38593 |
| 370 | Ga0207697_10000239 | 3300025315 | Bacteria | 29914 |
| 371 | Ga0207697_10000384 | 3300025315 | Bacteria | 24790 |
| 372 | Ga0207697_10000675 | 3300025315 | Bacteria | 19408 |
| 373 | Ga0207697_10005572 | 3300025315 | Bacteria | 5833 |
| 374 | Ga0207697_10024746 | 3300025315 | Bacteria | 2456 |
| 375 | Ga0207697_10080657 | 3300025315 | Bacteria | 1371 |
| 376 | Ga0207682_10015240 | 3300025893 | Unclassified | 2992 |
| 377 | Ga0207692_10099194 | 3300025898 | Bacteria | 1595 |
| 378 | Ga0207642_10023998 | 3300025899 | Unclassified | 2446 |
| 379 | Ga0207710_10134166 | 3300025900 | Unclassified | 1191 |
| 380 | Ga0207688_10000619 | 3300025901 | Bacteria | 17470 |
| 381 | Ga0207688_10000766 | 3300025901 | Bacteria | 15963 |
| 382 | Ga0207688_10042973 | 3300025901 | Unclassified | 2516 |
| 383 | Ga0207688_10250111 | 3300025901 | Bacteria | 1074 |
| 384 | Ga0207688_10253378 | 3300025901 | Bacteria | 1067 |
| 385 | Ga0207680_10019731 | 3300025903 | Bacteria | 3612 |
| 386 | Ga0207647_10003644 | 3300025904 | Bacteria | 11520 |
| 387 | Ga0207685_10097479 | 3300025905 | Unclassified | 1250 |
| 388 | Ga0207699_10010376 | 3300025906 | Bacteria | 4674 |
| 389 | Ga0207699_10073970 | 3300025906 | Bacteria | 2092 |
| 390 | Ga0207699_10141287 | 3300025906 | Bacteria | 1583 |
| 391 | Ga0207645_10000593 | 3300025907 | Bacteria | 30012 |
| 392 | Ga0207645_10006877 | 3300025907 | Bacteria | 8115 |
| 393 | Ga0207645_10010353 | 3300025907 | Bacteria | 6400 |
| 394 | Ga0207645_10012412 | 3300025907 | Bacteria | 5778 |
| 395 | Ga0207645_10463628 | 3300025907 | Unclassified | 856 |
| 396 | Ga0207705_10000430 | 3300025909 | Bacteria | 36578 |
| 397 | Ga0207705_10020300 | 3300025909 | Unclassified | 4751 |
| 398 | Ga0207705_10298931 | 3300025909 | Unclassified | 1234 |
| 399 | Ga0207684_10000043 | 3300025910 | Bacteria | 259939 |
| 400 | Ga0207684_10007962 | 3300025910 | Bacteria | 9472 |
| 401 | Ga0207684_10020480 | 3300025910 | Bacteria | 5652 |
| 402 | Ga0207684_10054615 | 3300025910 | Bacteria | 3389 |
| 403 | Ga0207684_10055108 | 3300025910 | Unclassified | 3373 |
| 404 | Ga0207684_10060227 | 3300025910 | Bacteria | 3224 |
| 405 | Ga0207684_10060471 | 3300025910 | Unclassified | 3218 |
| 406 | Ga0207684_10173730 | 3300025910 | Unclassified | 1857 |
| 407 | Ga0207684_10189987 | 3300025910 | Unclassified | 1771 |
| 408 | Ga0207684_10557894 | 3300025910 | Unclassified | 980 |
| 409 | Ga0207695_10000093 | 3300025913 | Bacteria | 270427 |
| 410 | Ga0207671_10008351 | 3300025914 | Bacteria | 8791 |
| 411 | Ga0207671_10234212 | 3300025914 | Bacteria | 1441 |
| 412 | Ga0207693_10004002 | 3300025915 | Bacteria | 12530 |
| 413 | Ga0207693_10021448 | 3300025915 | Bacteria | 5132 |
| 414 | Ga0207693_10063334 | 3300025915 | Unclassified | 2897 |
| 415 | Ga0207693_10078451 | 3300025915 | Bacteria | 2585 |
| 416 | Ga0207693_10145764 | 3300025915 | Bacteria | 1862 |
| 417 | Ga0207693_10282400 | 3300025915 | Bacteria | 1301 |
| 418 | Ga0207663_10012721 | 3300025916 | Bacteria | 4557 |
| 419 | Ga0207663_10052155 | 3300025916 | Bacteria | 2550 |
| 420 | Ga0207662_10000157 | 3300025918 | Bacteria | 32191 |
| 421 | Ga0207662_10008803 | 3300025918 | Bacteria | 5538 |
| 422 | Ga0207657_10046701 | 3300025919 | Bacteria | 3792 |
| 423 | Ga0207657_10083323 | 3300025919 | Bacteria | 2683 |
| 424 | Ga0207657_10170594 | 3300025919 | Bacteria | 1763 |
| 425 | Ga0207649_10309104 | 3300025920 | Bacteria | 1158 |
| 426 | Ga0207652_10527886 | 3300025921 | Bacteria | 1062 |
| 427 | Ga0207646_10000513 | 3300025922 | Bacteria | 51606 |
| 428 | Ga0207646_10003677 | 3300025922 | Bacteria | 17126 |
| 429 | Ga0207646_10027683 | 3300025922 | Bacteria | 5167 |
| 430 | Ga0207646_10038535 | 3300025922 | Bacteria | 4305 |
| 431 | Ga0207646_10039540 | 3300025922 | Unclassified | 4245 |
| 432 | Ga0207646_10125049 | 3300025922 | Bacteria | 2312 |
| 433 | Ga0207646_10243778 | 3300025922 | Bacteria | 1623 |
| 434 | Ga0207646_10346946 | 3300025922 | Bacteria | 1341 |
| 435 | Ga0207646_10467835 | 3300025922 | Unclassified | 1137 |
| 436 | Ga0207681_10003225 | 3300025923 | Bacteria | 10229 |
| 437 | Ga0207681_10009120 | 3300025923 | Bacteria | 6061 |
| 438 | Ga0207681_10042854 | 3300025923 | Unclassified | 3026 |
| 439 | Ga0207681_10065417 | 3300025923 | Bacteria | 2513 |
| 440 | Ga0207681_10154288 | 3300025923 | Bacteria | 1724 |
| 441 | Ga0207650_10001096 | 3300025925 | Bacteria | 20008 |
| 442 | Ga0207650_10053724 | 3300025925 | Unclassified | 2987 |
| 443 | Ga0207659_10007541 | 3300025926 | Bacteria | 6700 |
| 444 | Ga0207659_10029416 | 3300025926 | Bacteria | 3744 |
| 445 | Ga0207659_10046934 | 3300025926 | Bacteria | 3053 |
| 446 | Ga0207659_10088903 | 3300025926 | Unclassified | 2302 |
| 447 | Ga0207659_10105118 | 3300025926 | Bacteria | 2136 |
| 448 | Ga0207659_10392298 | 3300025926 | Bacteria | 1159 |
| 449 | Ga0207687_10073364 | 3300025927 | Bacteria | 2450 |
| 450 | Ga0207687_10079931 | 3300025927 | Bacteria | 2358 |
| 451 | Ga0207700_10037693 | 3300025928 | Bacteria | 3503 |
| 452 | Ga0207700_10130775 | 3300025928 | Bacteria | 2049 |
| 453 | Ga0207700_10203787 | 3300025928 | Unclassified | 1668 |
| 454 | Ga0207700_10458324 | 3300025928 | Bacteria | 1124 |
| 455 | Ga0207664_10232840 | 3300025929 | Bacteria | 1602 |
| 456 | Ga0207664_10477754 | 3300025929 | Bacteria | 1114 |
| 457 | Ga0207644_10020135 | 3300025931 | Bacteria | 4533 |
| 458 | Ga0207644_10060522 | 3300025931 | Unclassified | 2740 |
| 459 | Ga0207644_10086153 | 3300025931 | Unclassified | 2332 |
| 460 | Ga0207644_10093820 | 3300025931 | Bacteria | 2241 |
| 461 | Ga0207644_10235715 | 3300025931 | Bacteria | 1455 |
| 462 | Ga0207644_10449668 | 3300025931 | Unclassified | 1058 |
| 463 | Ga0207690_10009577 | 3300025932 | Bacteria | 5753 |
| 464 | Ga0207690_10084269 | 3300025932 | Unclassified | 2228 |
| 465 | Ga0207706_10003628 | 3300025933 | Bacteria | 14753 |
| 466 | Ga0207706_10033911 | 3300025933 | Unclassified | 4544 |
| 467 | Ga0207706_10087246 | 3300025933 | Bacteria | 2744 |
| 468 | Ga0207686_10034695 | 3300025934 | Bacteria | 3022 |
| 469 | Ga0207686_10110739 | 3300025934 | Bacteria | 1851 |
| 470 | Ga0207670_10002877 | 3300025936 | Bacteria | 9080 |
| 471 | Ga0207670_10005081 | 3300025936 | Bacteria | 7181 |
| 472 | Ga0207670_10261656 | 3300025936 | Unclassified | 1341 |
| 473 | Ga0207670_10536762 | 3300025936 | Bacteria | 954 |
| 474 | Ga0207669_10010287 | 3300025937 | Bacteria | 4499 |
| 475 | Ga0207669_10039680 | 3300025937 | Bacteria | 2723 |
| 476 | Ga0207669_10228122 | 3300025937 | Bacteria | 1372 |
| 477 | Ga0207704_10488363 | 3300025938 | Unclassified | 990 |
| 478 | Ga0207665_10053495 | 3300025939 | Bacteria | 2721 |
| 479 | Ga0207665_10125937 | 3300025939 | Bacteria | 1814 |
| 480 | Ga0207665_10405776 | 3300025939 | Unclassified | 1039 |
| 481 | Ga0207691_10001220 | 3300025940 | Bacteria | 25641 |
| 482 | Ga0207691_10003896 | 3300025940 | Bacteria | 14494 |
| 483 | Ga0207691_10011033 | 3300025940 | Bacteria | 8670 |
| 484 | Ga0207691_10025155 | 3300025940 | Bacteria | 5592 |
| 485 | Ga0207689_10265206 | 3300025942 | Unclassified | 1421 |
| 486 | Ga0207661_10058825 | 3300025944 | Unclassified | 3095 |
| 487 | Ga0207661_10133995 | 3300025944 | Bacteria | 2126 |
| 488 | Ga0207661_10153315 | 3300025944 | Unclassified | 1993 |
| 489 | Ga0207679_10061969 | 3300025945 | Bacteria | 2786 |
| 490 | Ga0207667_10088605 | 3300025949 | Unclassified | 3200 |
| 491 | Ga0207651_10007258 | 3300025960 | Bacteria | 5890 |
| 492 | Ga0207651_10018500 | 3300025960 | Bacteria | 4149 |
| 493 | Ga0207651_10022188 | 3300025960 | Bacteria | 3875 |
| 494 | Ga0207651_10039271 | 3300025960 | Bacteria | 3120 |
| 495 | Ga0207651_10505753 | 3300025960 | Bacteria | 1045 |
| 496 | Ga0207712_10086957 | 3300025961 | Unclassified | 2291 |
| 497 | Ga0207712_10151885 | 3300025961 | Unclassified | 1790 |
| 498 | Ga0207668_10003175 | 3300025972 | Bacteria | 9626 |
| 499 | Ga0207668_10014021 | 3300025972 | Bacteria | 4954 |
| 500 | Ga0207668_10059270 | 3300025972 | Bacteria | 2681 |
| 501 | Ga0207668_10496105 | 3300025972 | Bacteria | 1049 |
| 502 | Ga0207658_10007135 | 3300025986 | Bacteria | 7611 |
| 503 | Ga0207658_10052524 | 3300025986 | Bacteria | 3008 |
| 504 | Ga0207658_10077845 | 3300025986 | Bacteria | 2531 |
| 505 | Ga0207658_10147502 | 3300025986 | Bacteria | 1912 |
| 506 | Ga0207677_10059824 | 3300026023 | Bacteria | 2630 |
| 507 | Ga0207677_10148970 | 3300026023 | Bacteria | 1802 |
| 508 | Ga0207677_10359351 | 3300026023 | Unclassified | 1223 |
| 509 | Ga0207677_10396948 | 3300026023 | Bacteria | 1169 |
| 510 | Ga0207703_10007665 | 3300026035 | Bacteria | 8554 |
| 511 | Ga0207703_10012394 | 3300026035 | Bacteria | 6644 |
| 512 | Ga0207703_10250909 | 3300026035 | Bacteria | 1595 |
| 513 | Ga0207639_10000001 | 3300026041 | Bacteria | 1431562 |
| 514 | Ga0207639_10442587 | 3300026041 | Bacteria | 1178 |
| 515 | Ga0207639_10598330 | 3300026041 | Unclassified | 1017 |
| 516 | Ga0207678_10048423 | 3300026067 | Bacteria | 3674 |
| 517 | Ga0207678_10658995 | 3300026067 | Bacteria | 920 |
| 518 | Ga0207708_10008840 | 3300026075 | Bacteria | 7455 |
| 519 | Ga0207648_10012757 | 3300026089 | Bacteria | 7853 |
| 520 | Ga0207648_10476175 | 3300026089 | Bacteria | 1140 |
| 521 | Ga0207675_100469815 | 3300026118 | Unclassified | 1249 |
| 522 | Ga0207675_100617577 | 3300026118 | Bacteria | 1088 |
| 523 | Ga0207683_10002653 | 3300026121 | Bacteria | 15625 |
| 524 | Ga0207683_10003604 | 3300026121 | Bacteria | 13490 |
| 525 | Ga0207683_10008086 | 3300026121 | Bacteria | 8996 |
| 526 | Ga0207683_10070826 | 3300026121 | Unclassified | 3081 |
| 527 | Ga0207683_10458671 | 3300026121 | Bacteria | 1175 |
| 528 | Ga0207698_10338457 | 3300026142 | Unclassified | 1416 |
| 529 | Ga0209974_10004814 | 3300027876 | Bacteria | 4787 |
| 530 | Ga0209974_10049995 | 3300027876 | Unclassified | 1403 |
| 531 | Ga0207428_10343028 | 3300027907 | Unclassified | 1100 |
| 532 | Ga0268266_10002974 | 3300028379 | Bacteria | 17473 |
| 533 | Ga0268266_10141483 | 3300028379 | Bacteria | 2159 |
| 534 | Ga0268266_10161405 | 3300028379 | Unclassified | 2028 |
| 535 | Ga0268266_10574551 | 3300028379 | Bacteria | 1081 |
| 536 | Ga0268265_10018839 | 3300028380 | Bacteria | 4789 |
| 537 | Ga0268265_10397537 | 3300028380 | Unclassified | 1273 |
| 538 | Ga0268264_10008218 | 3300028381 | Bacteria | 8667 |
| 539 | Ga0268264_10011950 | 3300028381 | Bacteria | 7149 |
| 540 | Ga0268264_10021850 | 3300028381 | Bacteria | 5222 |
| 541 | Ga0268264_10060925 | 3300028381 | Bacteria | 3164 |
| 542 | Ga0268264_10414671 | 3300028381 | Bacteria | 1297 |
| 543 | Ga0268264_10477854 | 3300028381 | Bacteria | 1212 |
| 544 | Ga0307513_10093726 | 3300031456 | Unclassified | 3051 |
| 545 | Ga0373959_0036791 | 3300034820 | Bacteria | 1012 |
| 546 | Ga0373940_0082905 | 3300035088 | Bacteria | 951 |
| 547 | Ga0373944_0115947 | 3300035089 | Bacteria | 919 |
| 548 | Ga0373932_0158300 | 3300035112 | Bacteria | 782 |
| 549 | Ga0373945_0163451 | 3300035116 | Unclassified | 909 |
| 550 | Ga0373943_0030336 | 3300035170 | Bacteria | 2558 |
| 551 | Ga0373943_0151178 | 3300035170 | Bacteria | 1258 |
| 552 | Ga0373943_0154588 | 3300035170 | Unclassified | 1245 |
| 553 | Ga0373946_0090256 | 3300035171 | Unclassified | 1357 |
| 554 | Ga0373946_0092041 | 3300035171 | Bacteria | 1345 |
| 555 | Ga0373946_0235078 | 3300035171 | Unclassified | 889 |
| 556 | Ga0373955_0094916 | 3300035172 | Unclassified | 1705 |
| 557 | Ga0373924_0066559 | 3300035410 | Bacteria | 1515 |
| 558 | Ga0373935_0067357 | 3300035692 | Bacteria | 2302 |
| 559 | Ga0373935_0250894 | 3300035692 | Bacteria | 1238 |
| 560 | Ga0373927_0225263 | 3300035695 | Unclassified | 1232 |
| 561 | Ga0373933_0180851 | 3300035724 | Unclassified | 1345 |
| 562 | Ga0373947_0018018 | 3300035725 | Bacteria | 4064 |
| 563 | Ga0373947_0051719 | 3300035725 | Bacteria | 2472 |
| 564 | Ga0373947_0062249 | 3300035725 | Bacteria | 2270 |
| 565 | Ga0373947_0180444 | 3300035725 | Unclassified | 1374 |
| 566 | Ga0373925_0059921 | 3300037068 | Unclassified | 2857 |
| 567 | Ga0373925_0075105 | 3300037068 | Bacteria | 2561 |
| 568 | Ga0373925_0178495 | 3300037068 | Bacteria | 1679 |
| 569 | Ga0395900_0009876 | 3300037418 | Bacteria | 9775 |
| 570 | Ga0395900_0379306 | 3300037418 | Unclassified | 1382 |
| 571 | Ga0395898_0014853 | 3300037466 | Bacteria | 7994 |
| 572 | Ga0395898_0586066 | 3300037466 | Unclassified | 1058 |
| 573 | Ga0395905_0019798 | 3300037471 | Bacteria | 6379 |
| 574 | Ga0395905_0051394 | 3300037471 | Unclassified | 3861 |
| 575 | Ga0395905_0558714 | 3300037471 | Bacteria | 1046 |
| 576 | Ga0395901_0004662 | 3300038443 | Bacteria | 13824 |
| 577 | Ga0395901_0053682 | 3300038443 | Bacteria | 4188 |
| 578 | Ga0395901_0071409 | 3300038443 | Bacteria | 3618 |
| 579 | Ga0395901_0137096 | 3300038443 | Unclassified | 2571 |
| 580 | Ga0436365_0725183 | 3300039437 | Bacteria | 3629 |
| 581 | Ga0436365_0743711 | 3300039437 | Unclassified | 4029 |
| 582 | Ga0451787_787321 | 3300041441 | Unclassified | 819 |
| 583 | Ga0451853_3052533 | 3300041512 | Unclassified | 1299 |
| 584 | Ga0451576_0038986 | 3300045051 | Bacteria | 5029 |
| 585 | Ga0451576_0063594 | 3300045051 | Bacteria | 3846 |
| 586 | Ga0466967_0782395 | 3300045976 | Bacteria | 947 |
| 587 | Ga0495592_0060803 | 3300046454 | Unclassified | 2777 |
| 588 | Ga0495603_0164421 | 3300046455 | Unclassified | 1287 |
| 589 | Ga0495651_0135541 | 3300046462 | Bacteria | 1792 |
| 590 | Ga0495580_0167139 | 3300046472 | Unclassified | 1521 |
| 591 | Ga0495580_0220448 | 3300046472 | Bacteria | 1304 |
| 592 | Ga0495639_0121611 | 3300046475 | Unclassified | 1246 |
| 593 | Ga0495585_0035090 | 3300046492 | Bacteria | 2837 |
| 594 | Ga0495608_0182256 | 3300046511 | Bacteria | 1328 |
| 595 | Ga0495628_0288651 | 3300046516 | Bacteria | 1216 |
| 596 | Ga0495630_0124351 | 3300046517 | Bacteria | 1957 |
| 597 | Ga0495643_0000176 | 3300046522 | Bacteria | 102034 |
| 598 | Ga0495644_0062791 | 3300046523 | Unclassified | 1396 |
| 599 | Ga0495652_0024908 | 3300046529 | Bacteria | 5295 |
| 600 | Ga0495652_0211157 | 3300046529 | Unclassified | 1465 |
| 601 | Ga0495598_0001731 | 3300046537 | Bacteria | 4378 |
| 602 | Ga0495598_0014056 | 3300046537 | Viruses | 1996 |
| 603 | Ga0495645_0047814 | 3300046543 | Bacteria | 3116 |
| 604 | Ga0495634_0248949 | 3300046642 | Unclassified | 1088 |
| 605 | Ga0495659_0008961 | 3300046664 | Bacteria | 3187 |
| 606 | Ga0495659_0050632 | 3300046664 | Bacteria | 1511 |
| 607 | Ga0495659_0141065 | 3300046664 | Unclassified | 962 |
| 608 | Ga0495588_0121148 | 3300046674 | Unclassified | 1379 |
| 609 | Ga0495599_0033741 | 3300046678 | Bacteria | 3217 |
| 610 | Ga0495599_0215267 | 3300046678 | Unclassified | 1177 |
| 611 | Ga0495623_0079725 | 3300046679 | Bacteria | 2028 |
| 612 | Ga0495646_0053143 | 3300046680 | Bacteria | 2444 |
| 613 | Ga0495658_0114094 | 3300046683 | Unclassified | 1628 |
| 614 | Ga0495669_0063231 | 3300046684 | Unclassified | 1679 |
| 615 | Ga0495670_0216466 | 3300046691 | Bacteria | 1017 |
| 616 | Ga0495671_0120689 | 3300046692 | Bacteria | 1279 |
| 617 | Ga0495600_0351843 | 3300046809 | Unclassified | 923 |
| 618 | Ga0495581_0213655 | 3300047315 | Unclassified | 1128 |
| 619 | Ga0495604_0308817 | 3300047317 | Bacteria | 1060 |
| 620 | Ga0495674_0154019 | 3300047319 | Unclassified | 1926 |
| 621 | Ga0495675_0011585 | 3300047444 | Bacteria | 5536 |
| 622 | Ga0495684_0006328 | 3300047471 | Bacteria | 9202 |
| 623 | Ga0495684_0090540 | 3300047471 | Unclassified | 2317 |
| 624 | Ga0495602_0069761 | 3300048088 | Bacteria | 3011 |
| 625 | Ga0496100_0023535 | 3300048903 | Bacteria | 3743 |
| 626 | Ga0496100_0170912 | 3300048903 | Bacteria | 1565 |
| 627 | Ga0496101_0003525 | 3300048904 | Bacteria | 9758 |
| 628 | Ga0496101_0092484 | 3300048904 | Bacteria | 2252 |
| 629 | Ga0496101_0131754 | 3300048904 | Bacteria | 1899 |
| 630 | Ga0496101_0377263 | 3300048904 | Bacteria | 1116 |
| 631 | Ga0496102_0050163 | 3300048905 | Bacteria | 3799 |
| 632 | Ga0496102_0118429 | 3300048905 | Bacteria | 2472 |
| 633 | Ga0496102_0150245 | 3300048905 | Bacteria | 2188 |
| 634 | Ga0496102_0557113 | 3300048905 | Unclassified | 1069 |
| 635 | Ga0496104_0073911 | 3300048907 | Unclassified | 3244 |
| 636 | Ga0496105_0143744 | 3300048908 | Unclassified | 1963 |
| 637 | Ga0496105_0229527 | 3300048908 | Bacteria | 1509 |
| 638 | Ga0496105_0247800 | 3300048908 | Unclassified | 1444 |
| 639 | Ga0496105_0379870 | 3300048908 | Bacteria | 1124 |
| 640 | Ga0496106_0020281 | 3300048909 | Bacteria | 4932 |
| 641 | Ga0496107_0022989 | 3300048910 | Bacteria | 4407 |
| 642 | Ga0496107_0061696 | 3300048910 | Unclassified | 2715 |
| 643 | Ga0496107_0275955 | 3300048910 | Bacteria | 1251 |
| 644 | Ga0496108_0043777 | 3300048911 | Bacteria | 3739 |
| 645 | Ga0496108_0120947 | 3300048911 | Bacteria | 2246 |
| 646 | Ga0496108_0125391 | 3300048911 | Unclassified | 2204 |
| 647 | Ga0496108_0364127 | 3300048911 | Bacteria | 1262 |
| 648 | Ga0496108_0495896 | 3300048911 | Bacteria | 1067 |
| 649 | Ga0496109_0009018 | 3300048912 | Bacteria | 8497 |
| 650 | Ga0496109_0098208 | 3300048912 | Bacteria | 2715 |
| 651 | Ga0496109_0117018 | 3300048912 | Bacteria | 2481 |
| 652 | Ga0496109_0182387 | 3300048912 | Unclassified | 1972 |
| 653 | Ga0496109_0188090 | 3300048912 | Bacteria | 1940 |
| 654 | Ga0496109_0282367 | 3300048912 | Bacteria | 1565 |
| 655 | Ga0496110_0022417 | 3300048913 | Bacteria | 5362 |
| 656 | Ga0496110_0345746 | 3300048913 | Unclassified | 1355 |
| 657 | Ga0496110_0444512 | 3300048913 | Unclassified | 1182 |
| 658 | Ga0496110_0546224 | 3300048913 | Bacteria | 1053 |
| 659 | Ga0496111_0283704 | 3300048914 | Bacteria | 1228 |
| 660 | Ga0496112_0005284 | 3300048915 | Bacteria | 11138 |
| 661 | Ga0496112_0014542 | 3300048915 | Bacteria | 7310 |
| 662 | Ga0496112_0029766 | 3300048915 | Bacteria | 5283 |
| 663 | Ga0496112_0047623 | 3300048915 | Bacteria | 4206 |
| 664 | Ga0496112_0329358 | 3300048915 | Bacteria | 1471 |
| 665 | Ga0496112_0366672 | 3300048915 | Bacteria | 1382 |
| 666 | Ga0496113_0116490 | 3300048916 | Bacteria | 2085 |
| 667 | Ga0496113_0130664 | 3300048916 | Unclassified | 1970 |
| 668 | Ga0496113_0266185 | 3300048916 | Unclassified | 1370 |
| 669 | Ga0496114_0024566 | 3300048917 | Bacteria | 4920 |
| 670 | Ga0496114_0061373 | 3300048917 | Bacteria | 3144 |
| 671 | Ga0496115_0001810 | 3300048918 | Bacteria | 15284 |
| 672 | Ga0496115_0016337 | 3300048918 | Bacteria | 5649 |
| 673 | Ga0496115_0098535 | 3300048918 | Unclassified | 2394 |
| 674 | Ga0496115_0168166 | 3300048918 | Bacteria | 1813 |
| 675 | nmdc:mga05p37_1087359_c1 | 3300050507 | Bacteria | 839 |
| 676 | nmdc:mga05p37_446057_c1 | 3300050507 | Unclassified | 1499 |
| 677 | nmdc:mga05p37_5724_c2 | 3300050507 | Bacteria | 6080 |
| 678 | nmdc:mga05p37_777871_c1 | 3300050507 | Unclassified | 1051 |
| 679 | nmdc:mga08y16_82954_c1 | 3300050511 | Bacteria | 3341 |
| 680 | nmdc:mga0n895_263653_c1 | 3300050512 | Bacteria | 1748 |
| 681 | nmdc:mga0n895_571204_c1 | 3300050512 | Unclassified | 1135 |
| 682 | nmdc:mga0rr50_102775_c1 | 3300050513 | Bacteria | 2248 |
| 683 | nmdc:mga0rr50_486973_c1 | 3300050513 | Bacteria | 1048 |
| 684 | nmdc:mga08x19_64194_c1 | 3300050514 | Unclassified | 2383 |
| 685 | nmdc:mga0a205_207276_c1 | 3300050515 | Unclassified | 1849 |
| 686 | nmdc:mga0a205_719227_c1 | 3300050515 | Unclassified | 848 |
| 687 | Ga0495619_0094039 | 3300053085 | Bacteria | 2033 |
| 688 | 2787505954 | 2786546548 | Bacteria | 4745694 |
| 689 | Ga0068853_100319050 | |||
| 690 | SwRhRL2b_contig_2929379 | |||
| 691 | SwRhRL2b_contig_3225193 | |||
| 692 | SwRhRL2b_contig_3559768 | |||
| 693 | CNXas_1000054 | |||
| 694 | JGI24746J21847_1004506 | |||
| 695 | JGI24737J22298_10014965 | |||
| 696 | JGI24750J21931_1023983 | |||
| 697 | JGI24035J26624_1000831 | |||
| 698 | JGI24035J26624_1001587 | |||
| 699 | JGI24035J26624_1005740 | |||
| 700 | JGI24035J26624_1006431 | |||
| 701 | JGI24034J26672_10029203 | |||
| 702 | JGI25406J46586_10000023 | |||
| 703 | JGI25404J52841_10007566 | |||
| 704 | JGI25405J52794_10004719 | |||
| 705 | JGI25405J52794_10010745 | |||
| 706 | Ga0065703_1019827 | |||
| 707 | Ga0065704_10007112 | |||
| 708 | Ga0065704_10078626 | |||
| 709 | Ga0065704_10112617 | |||
| 710 | Ga0065712_10008183 | |||
| 711 | Ga0065712_10079225 | |||
| 712 | Ga0065712_10098032 | |||
| 713 | Ga0065712_10099310 | |||
| 714 | Ga0065712_10172837 | |||
| 715 | Ga0065712_10199461 | |||
| 716 | Ga0065715_10000634 | |||
| 717 | Ga0065715_10006297 | |||
| 718 | Ga0065715_10010746 | |||
| 719 | Ga0065715_10131347 | |||
| 720 | Ga0065715_10184365 | |||
| 721 | Ga0065715_10205606 | |||
| 722 | Ga0065715_10216202 | |||
| 723 | Ga0065715_10395014 | |||
| 724 | Ga0065707_10007784 | |||
| 725 | Ga0065707_10290155 | |||
| 726 | Ga0065707_10328605 | |||
| 727 | Ga0070658_10000314 | |||
| 728 | Ga0070658_10028042 | |||
| 729 | Ga0070658_10109062 | |||
| 730 | Ga0070676_10000759 | |||
| 731 | Ga0070676_10003127 | |||
| 732 | Ga0070676_10004090 | |||
| 733 | Ga0070676_10103501 | |||
| 734 | Ga0070676_10120206 | |||
| 735 | Ga0070683_100084083 | |||
| 736 | Ga0070683_100353845 | |||
| 737 | Ga0070690_100126582 | |||
| 738 | Ga0070670_100008345 | |||
| 739 | Ga0070677_10033266 | |||
| 740 | Ga0070666_10014771 | |||
| 741 | Ga0070666_10017399 | |||
| 742 | Ga0070666_10036328 | |||
| 743 | Ga0070666_10066312 | |||
| 744 | Ga0070666_10127690 | |||
| 745 | Ga0070682_100211792 | |||
| 746 | Ga0068868_100035263 | |||
| 747 | Ga0068868_100040543 | |||
| 748 | Ga0068868_100138806 | |||
| 749 | Ga0068868_100154326 | |||
| 750 | Ga0070660_100099471 | |||
| 751 | Ga0070689_100001923 | |||
| 752 | Ga0070689_100002311 | |||
| 753 | Ga0070689_100005623 | |||
| 754 | Ga0070689_100266532 | |||
| 755 | Ga0070689_100484642 | |||
| 756 | Ga0070687_100000585 | |||
| 757 | Ga0070687_100210657 | |||
| 758 | Ga0070661_100374226 | |||
| 759 | Ga0070668_100004269 | |||
| 760 | Ga0070668_100004794 | |||
| 761 | Ga0070668_100096261 | |||
| 762 | Ga0070668_100294538 | |||
| 763 | Ga0070669_100004777 | |||
| 764 | Ga0070669_100023284 | |||
| 765 | Ga0070669_100051535 | |||
| 766 | Ga0070669_100074737 | |||
| 767 | Ga0070669_100189808 | |||
| 768 | Ga0070669_100222792 | |||
| 769 | Ga0070669_100384727 | |||
| 770 | Ga0070675_100003641 | |||
| 771 | Ga0070675_100005459 | |||
| 772 | Ga0070675_100018755 | |||
| 773 | Ga0070675_100029200 | |||
| 774 | Ga0070675_100063876 | |||
| 775 | Ga0070675_100300599 | |||
| 776 | Ga0070675_100510903 | |||
| 777 | Ga0070671_100000966 | |||
| 778 | Ga0070671_100020232 | |||
| 779 | Ga0070671_100026158 | |||
| 780 | Ga0070671_100061696 | |||
| 781 | Ga0070671_100090021 | |||
| 782 | Ga0070674_100015414 | |||
| 783 | Ga0070674_100087391 | |||
| 784 | Ga0070674_100433985 | |||
| 785 | Ga0070673_100062566 | |||
| 786 | Ga0070673_100201108 | |||
| 787 | Ga0070673_100341003 | |||
| 788 | Ga0070688_100003252 | |||
| 789 | Ga0070688_100006168 | |||
| 790 | Ga0070688_100055467 | |||
| 791 | Ga0070688_100109047 | |||
| 792 | Ga0070688_100161670 | |||
| 793 | Ga0070659_100002393 | |||
| 794 | Ga0070659_100006312 | |||
| 795 | Ga0070667_100003645 | |||
| 796 | Ga0070667_100007325 | |||
| 797 | Ga0070667_100013130 | |||
| 798 | Ga0070667_100049340 | |||
| 799 | Ga0070709_10029851 | |||
| 800 | Ga0070709_10058520 | |||
| 801 | Ga0070709_10286161 | |||
| 802 | Ga0070714_100450557 | |||
| 803 | Ga0070714_100499000 | |||
| 804 | Ga0070713_100030518 | |||
| 805 | Ga0070713_100040161 | |||
| 806 | Ga0070713_100160642 | |||
| 807 | Ga0070713_100181493 | |||
| 808 | Ga0070713_100302588 | |||
| 809 | Ga0070713_100377917 | |||
| 810 | Ga0070710_10090439 | |||
| 811 | Ga0070711_100004894 | |||
| 812 | Ga0070711_100042226 | |||
| 813 | Ga0070711_100114145 | |||
| 814 | Ga0070711_100284004 | |||
| 815 | Ga0070711_100370649 | |||
| 816 | Ga0070705_100201364 | |||
| 817 | Ga0070694_100132518 | |||
| 818 | Ga0070708_100031485 | |||
| 819 | Ga0070708_100043385 | |||
| 820 | Ga0070708_100093957 | |||
| 821 | Ga0070708_100153991 | |||
| 822 | Ga0070708_100300124 | |||
| 823 | Ga0070708_100371124 | |||
| 824 | Ga0070708_100373410 | |||
| 825 | Ga0070708_100571209 | |||
| 826 | Ga0070708_100671413 | |||
| 827 | Ga0070678_100002283 | |||
| 828 | Ga0070678_100120639 | |||
| 829 | Ga0070678_100129195 | |||
| 830 | Ga0070678_100150030 | |||
| 831 | Ga0070678_100483898 | |||
| 832 | Ga0070662_100002790 | |||
| 833 | Ga0070662_100065244 | |||
| 834 | Ga0068867_100079364 | |||
| 835 | Ga0068867_100101588 | |||
| 836 | Ga0068867_100103544 | |||
| 837 | Ga0068867_100398109 | |||
| 838 | Ga0070706_100000072 | |||
| 839 | Ga0070706_100005839 | |||
| 840 | Ga0070706_100015133 | |||
| 841 | Ga0070706_100062984 | |||
| 842 | Ga0070706_100074559 | |||
| 843 | Ga0070706_100091695 | |||
| 844 | Ga0070706_100121436 | |||
| 845 | Ga0070706_100151004 | |||
| 846 | Ga0070706_100174569 | |||
| 847 | Ga0070706_100240938 | |||
| 848 | Ga0070706_100442468 | |||
| 849 | Ga0070707_100000414 | |||
| 850 | Ga0070707_100011922 | |||
| 851 | Ga0070707_100016298 | |||
| 852 | Ga0070707_100018415 | |||
| 853 | Ga0070707_100020265 | |||
| 854 | Ga0070707_100041911 | |||
| 855 | Ga0070707_100055645 | |||
| 856 | Ga0070707_100056090 | |||
| 857 | Ga0070707_100065104 | |||
| 858 | Ga0070707_100147710 | |||
| 859 | Ga0070707_100151675 | |||
| 860 | Ga0070707_100215729 | |||
| 861 | Ga0070707_100482331 | |||
| 862 | Ga0070698_100002051 | |||
| 863 | Ga0070698_100003705 | |||
| 864 | Ga0070698_100036057 | |||
| 865 | Ga0070698_100464528 | |||
| 866 | Ga0070699_100053744 | |||
| 867 | Ga0070699_100242952 | |||
| 868 | Ga0070699_100320643 | |||
| 869 | Ga0070679_100544908 | |||
| 870 | Ga0070684_100019475 | |||
| 871 | Ga0070684_100074143 | |||
| 872 | Ga0070684_100144648 | |||
| 873 | Ga0070697_100004384 | |||
| 874 | Ga0070697_100008529 | |||
| 875 | Ga0070697_100012783 | |||
| 876 | Ga0070697_100013951 | |||
| 877 | Ga0070697_100109712 | |||
| 878 | Ga0070697_100110102 | |||
| 879 | Ga0070697_100113329 | |||
| 880 | Ga0070697_100279707 | |||
| 881 | Ga0070697_100284893 | |||
| 882 | Ga0070697_100309023 | |||
| 883 | Ga0070697_100404002 | |||
| 884 | Ga0068853_100000001 | |||
| 885 | Ga0068853_100303983 | |||
| 886 | Ga0070672_100013289 | |||
| 887 | Ga0070672_100021779 | |||
| 888 | Ga0070672_100220833 | |||
| 889 | Ga0070672_100370792 | |||
| 890 | Ga0070695_100040110 | |||
| 891 | Ga0070696_100173640 | |||
| 892 | Ga0070693_100030019 | |||
| 893 | Ga0070665_100019885 | |||
| 894 | Ga0070665_100108726 | |||
| 895 | Ga0070665_100114340 | |||
| 896 | Ga0070665_100125567 | |||
| 897 | Ga0070665_100131849 | |||
| 898 | Ga0070665_100273159 | |||
| 899 | Ga0068855_100000294 | |||
| 900 | Ga0070664_100049228 | |||
| 901 | Ga0070664_100372678 | |||
| 902 | Ga0068856_100109277 | |||
| 903 | Ga0070702_100107594 | |||
| 904 | Ga0068852_100092731 | |||
| 905 | Ga0068859_100088056 | |||
| 906 | Ga0068866_10036187 | |||
| 907 | Ga0068866_10036702 | |||
| 908 | Ga0068861_100401763 | |||
| 909 | Ga0068861_100495012 | |||
| 910 | Ga0068863_100006720 | |||
| 911 | Ga0068858_100004519 | |||
| 912 | Ga0068858_100027473 | |||
| 913 | Ga0068858_100607648 | |||
| 914 | Ga0068860_100030461 | |||
| 915 | Ga0068860_100112764 | |||
| 916 | Ga0068860_100114149 | |||
| 917 | Ga0068860_100218262 | |||
| 918 | Ga0068860_100302873 | |||
| 919 | Ga0068860_100509850 | |||
| 920 | Ga0068862_100033520 | |||
| 921 | Ga0068862_100224970 | |||
| 922 | Ga0081455_10002038 | |||
| 923 | Ga0081455_10002816 | |||
| 924 | Ga0081455_10007921 | |||
| 925 | Ga0081455_10385360 | |||
| 926 | Ga0081540_1000014 | |||
| 927 | Ga0081540_1043180 | |||
| 928 | Ga0081539_10000014 | |||
| 929 | Ga0081539_10003564 | |||
| 930 | Ga0081539_10009184 | |||
| 931 | Ga0081539_10015129 | |||
| 932 | Ga0070717_10008397 | |||
| 933 | Ga0070717_10082917 | |||
| 934 | Ga0070717_10166961 | |||
| 935 | Ga0070717_10303407 | |||
| 936 | Ga0070717_10356255 | |||
| 937 | Ga0070717_10425619 | |||
| 938 | Ga0070717_10464382 | |||
| 939 | Ga0070715_10092523 | |||
| 940 | Ga0070716_100040226 | |||
| 941 | Ga0070716_100051233 | |||
| 942 | Ga0070716_100218199 | |||
| 943 | Ga0070716_100247374 | |||
| 944 | Ga0070712_100033533 | |||
| 945 | Ga0070712_100037558 | |||
| 946 | Ga0070712_100062757 | |||
| 947 | Ga0070712_100104127 | |||
| 948 | Ga0070712_100241365 | |||
| 949 | Ga0070712_100416529 | |||
| 950 | Ga0070712_100465609 | |||
| 951 | Ga0075362_10144429 | |||
| 952 | Ga0097621_100018440 | |||
| 953 | Ga0097621_100072422 | |||
| 954 | Ga0068871_100009562 | |||
| 955 | Ga0068871_100036935 | |||
| 956 | Ga0075434_100273395 | |||
| 957 | Ga0075434_100308544 | |||
| 958 | Ga0068865_100088034 | |||
| 959 | Ga0068865_100184419 | |||
| 960 | Ga0068865_100521925 | |||
| 961 | Ga0075436_100192292 | |||
| 962 | Ga0097620_100088060 | |||
| 963 | Ga0075435_100058107 | |||
| 964 | Ga0075435_100336742 | |||
| 965 | Ga0099794_10159784 | |||
| 966 | Ga0099795_10010810 | |||
| 967 | Ga0111539_10013275 | |||
| 968 | Ga0105245_10149349 | |||
| 969 | Ga0105245_10658301 | |||
| 970 | Ga0105247_10449562 | |||
| 971 | Ga0114129_10000103 | |||
| 972 | Ga0114129_10268702 | |||
| 973 | Ga0114129_10440648 | |||
| 974 | Ga0114129_10798590 | |||
| 975 | Ga0105243_10153182 | |||
| 976 | Ga0105243_10372903 | |||
| 977 | Ga0105242_10005103 | |||
| 978 | Ga0105242_10117267 | |||
| 979 | Ga0105237_10010320 | |||
| 980 | Ga0105237_10031392 | |||
| 981 | Ga0105238_10486365 | |||
| 982 | Ga0105249_10008958 | |||
| 983 | Ga0105249_10070652 | |||
| 984 | Ga0105249_10182789 | |||
| 985 | Ga0105249_10243423 | |||
| 986 | Ga0105249_10682684 | |||
| 987 | Ga0099796_10027737 | |||
| 988 | Ga0099796_10071095 | |||
| 989 | Ga0105239_10009837 | |||
| 990 | Ga0105239_10055069 | |||
| 991 | Ga0105239_10137085 | |||
| 992 | Ga0157338_1013112 | |||
| 993 | Ga0157374_10007842 | |||
| 994 | Ga0157374_10009172 | |||
| 995 | Ga0157374_10010109 | |||
| 996 | Ga0157374_10032125 | |||
| 997 | Ga0157374_10065734 | |||
| 998 | Ga0157374_10153928 | |||
| 999 | Ga0157374_10195249 | |||
| 1000 | Ga0157374_10279178 | |||
| 1001 | Ga0157374_10283149 | |||
| 1002 | Ga0157374_10394247 | |||
| 1003 | Ga0157374_10480083 | |||
| 1004 | Ga0157374_10481634 | |||
| 1005 | Ga0157374_10985578 | |||
| 1006 | Ga0157378_10009004 | |||
| 1007 | Ga0157378_10025623 | |||
| 1008 | Ga0157378_10031002 | |||
| 1009 | Ga0157378_10041230 | |||
| 1010 | Ga0157378_10061844 | |||
| 1011 | Ga0157378_10096757 | |||
| 1012 | Ga0157378_10266658 | |||
| 1013 | Ga0157378_10458463 | |||
| 1014 | Ga0157378_10480253 | |||
| 1015 | Ga0157378_10548740 | |||
| 1016 | Ga0163162_10005079 | |||
| 1017 | Ga0163162_10006220 | |||
| 1018 | Ga0163162_10013945 | |||
| 1019 | Ga0163162_10109331 | |||
| 1020 | Ga0163162_10118489 | |||
| 1021 | Ga0163162_10158828 | |||
| 1022 | Ga0163162_10203642 | |||
| 1023 | Ga0163162_10215911 | |||
| 1024 | Ga0163162_10240366 | |||
| 1025 | Ga0157372_10125444 | |||
| 1026 | Ga0157372_10150741 | |||
| 1027 | Ga0157372_10160801 | |||
| 1028 | Ga0157372_10749529 | |||
| 1029 | Ga0157375_10003326 | |||
| 1030 | Ga0157375_10021001 | |||
| 1031 | Ga0157375_10053876 | |||
| 1032 | Ga0157375_10195680 | |||
| 1033 | Ga0157375_10266772 | |||
| 1034 | Ga0157375_10318236 | |||
| 1035 | Ga0157375_10483264 | |||
| 1036 | Ga0157375_10829726 | |||
| 1037 | Ga0163163_10099885 | |||
| 1038 | Ga0163163_10250705 | |||
| 1039 | Ga0163163_10372707 | |||
| 1040 | Ga0182008_10062333 | |||
| 1041 | Ga0157379_10018054 | |||
| 1042 | Ga0157379_10910066 | |||
| 1043 | Ga0157376_10004419 | |||
| 1044 | Ga0157376_10052256 | |||
| 1045 | Ga0157376_10087191 | |||
| 1046 | Ga0157376_10117052 | |||
| 1047 | Ga0157376_10177982 | |||
| 1048 | Ga0182005_1005473 | |||
| 1049 | Ga0182005_1070198 | |||
| 1050 | Ga0163161_10266085 | |||
| 1051 | Ga0163161_10346204 | |||
| 1052 | Ga0163161_10466708 | |||
| 1053 | Ga0213876_10019864 | |||
| 1054 | Ga0207666_1000532 | |||
| 1055 | Ga0207666_1002337 | |||
| 1056 | Ga0207673_1009035 | |||
| 1057 | Ga0207697_10000106 | |||
| 1058 | Ga0207697_10000239 | |||
| 1059 | Ga0207697_10000384 | |||
| 1060 | Ga0207697_10000675 | |||
| 1061 | Ga0207697_10005572 | |||
| 1062 | Ga0207697_10024746 | |||
| 1063 | Ga0207697_10080657 | |||
| 1064 | Ga0207682_10015240 | |||
| 1065 | Ga0207692_10099194 | |||
| 1066 | Ga0207642_10023998 | |||
| 1067 | Ga0207710_10134166 | |||
| 1068 | Ga0207688_10000619 | |||
| 1069 | Ga0207688_10000766 | |||
| 1070 | Ga0207688_10042973 | |||
| 1071 | Ga0207688_10250111 | |||
| 1072 | Ga0207688_10253378 | |||
| 1073 | Ga0207680_10019731 | |||
| 1074 | Ga0207647_10003644 | |||
| 1075 | Ga0207685_10097479 | |||
| 1076 | Ga0207699_10010376 | |||
| 1077 | Ga0207699_10073970 | |||
| 1078 | Ga0207699_10141287 | |||
| 1079 | Ga0207645_10000593 | |||
| 1080 | Ga0207645_10006877 | |||
| 1081 | Ga0207645_10010353 | |||
| 1082 | Ga0207645_10012412 | |||
| 1083 | Ga0207645_10463628 | |||
| 1084 | Ga0207705_10000430 | |||
| 1085 | Ga0207705_10020300 | |||
| 1086 | Ga0207705_10298931 | |||
| 1087 | Ga0207684_10000043 | |||
| 1088 | Ga0207684_10007962 | |||
| 1089 | Ga0207684_10020480 | |||
| 1090 | Ga0207684_10054615 | |||
| 1091 | Ga0207684_10055108 | |||
| 1092 | Ga0207684_10060227 | |||
| 1093 | Ga0207684_10060471 | |||
| 1094 | Ga0207684_10173730 | |||
| 1095 | Ga0207684_10189987 | |||
| 1096 | Ga0207684_10557894 | |||
| 1097 | Ga0207695_10000093 | |||
| 1098 | Ga0207671_10008351 | |||
| 1099 | Ga0207671_10234212 | |||
| 1100 | Ga0207693_10004002 | |||
| 1101 | Ga0207693_10021448 | |||
| 1102 | Ga0207693_10063334 | |||
| 1103 | Ga0207693_10078451 | |||
| 1104 | Ga0207693_10145764 | |||
| 1105 | Ga0207693_10282400 | |||
| 1106 | Ga0207663_10012721 | |||
| 1107 | Ga0207663_10052155 | |||
| 1108 | Ga0207662_10000157 | |||
| 1109 | Ga0207662_10008803 | |||
| 1110 | Ga0207657_10046701 | |||
| 1111 | Ga0207657_10083323 | |||
| 1112 | Ga0207657_10170594 | |||
| 1113 | Ga0207649_10309104 | |||
| 1114 | Ga0207652_10527886 | |||
| 1115 | Ga0207646_10000513 | |||
| 1116 | Ga0207646_10003677 | |||
| 1117 | Ga0207646_10027683 | |||
| 1118 | Ga0207646_10038535 | |||
| 1119 | Ga0207646_10039540 | |||
| 1120 | Ga0207646_10125049 | |||
| 1121 | Ga0207646_10243778 | |||
| 1122 | Ga0207646_10346946 | |||
| 1123 | Ga0207646_10467835 | |||
| 1124 | Ga0207681_10003225 | |||
| 1125 | Ga0207681_10009120 | |||
| 1126 | Ga0207681_10042854 | |||
| 1127 | Ga0207681_10065417 | |||
| 1128 | Ga0207681_10154288 | |||
| 1129 | Ga0207650_10001096 | |||
| 1130 | Ga0207650_10053724 | |||
| 1131 | Ga0207659_10007541 | |||
| 1132 | Ga0207659_10029416 | |||
| 1133 | Ga0207659_10046934 | |||
| 1134 | Ga0207659_10088903 | |||
| 1135 | Ga0207659_10105118 | |||
| 1136 | Ga0207659_10392298 | |||
| 1137 | Ga0207687_10073364 | |||
| 1138 | Ga0207687_10079931 | |||
| 1139 | Ga0207700_10037693 | |||
| 1140 | Ga0207700_10130775 | |||
| 1141 | Ga0207700_10203787 | |||
| 1142 | Ga0207700_10458324 | |||
| 1143 | Ga0207664_10232840 | |||
| 1144 | Ga0207664_10477754 | |||
| 1145 | Ga0207644_10020135 | |||
| 1146 | Ga0207644_10060522 | |||
| 1147 | Ga0207644_10086153 | |||
| 1148 | Ga0207644_10093820 | |||
| 1149 | Ga0207644_10235715 | |||
| 1150 | Ga0207644_10449668 | |||
| 1151 | Ga0207690_10009577 | |||
| 1152 | Ga0207690_10084269 | |||
| 1153 | Ga0207706_10003628 | |||
| 1154 | Ga0207706_10033911 | |||
| 1155 | Ga0207706_10087246 | |||
| 1156 | Ga0207686_10034695 | |||
| 1157 | Ga0207686_10110739 | |||
| 1158 | Ga0207670_10002877 | |||
| 1159 | Ga0207670_10005081 | |||
| 1160 | Ga0207670_10261656 | |||
| 1161 | Ga0207670_10536762 | |||
| 1162 | Ga0207669_10010287 | |||
| 1163 | Ga0207669_10039680 | |||
| 1164 | Ga0207669_10228122 | |||
| 1165 | Ga0207704_10488363 | |||
| 1166 | Ga0207665_10053495 | |||
| 1167 | Ga0207665_10125937 | |||
| 1168 | Ga0207665_10405776 | |||
| 1169 | Ga0207691_10001220 | |||
| 1170 | Ga0207691_10003896 | |||
| 1171 | Ga0207691_10011033 | |||
| 1172 | Ga0207691_10025155 | |||
| 1173 | Ga0207689_10265206 | |||
| 1174 | Ga0207661_10058825 | |||
| 1175 | Ga0207661_10133995 | |||
| 1176 | Ga0207661_10153315 | |||
| 1177 | Ga0207679_10061969 | |||
| 1178 | Ga0207667_10088605 | |||
| 1179 | Ga0207651_10007258 | |||
| 1180 | Ga0207651_10018500 | |||
| 1181 | Ga0207651_10022188 | |||
| 1182 | Ga0207651_10039271 | |||
| 1183 | Ga0207651_10505753 | |||
| 1184 | Ga0207712_10086957 | |||
| 1185 | Ga0207712_10151885 | |||
| 1186 | Ga0207668_10003175 | |||
| 1187 | Ga0207668_10014021 | |||
| 1188 | Ga0207668_10059270 | |||
| 1189 | Ga0207668_10496105 | |||
| 1190 | Ga0207658_10007135 | |||
| 1191 | Ga0207658_10052524 | |||
| 1192 | Ga0207658_10077845 | |||
| 1193 | Ga0207658_10147502 | |||
| 1194 | Ga0207677_10059824 | |||
| 1195 | Ga0207677_10148970 | |||
| 1196 | Ga0207677_10359351 | |||
| 1197 | Ga0207677_10396948 | |||
| 1198 | Ga0207703_10007665 | |||
| 1199 | Ga0207703_10012394 | |||
| 1200 | Ga0207703_10250909 | |||
| 1201 | Ga0207639_10000001 | |||
| 1202 | Ga0207639_10442587 | |||
| 1203 | Ga0207639_10598330 | |||
| 1204 | Ga0207678_10048423 | |||
| 1205 | Ga0207678_10658995 | |||
| 1206 | Ga0207708_10008840 | |||
| 1207 | Ga0207648_10012757 | |||
| 1208 | Ga0207648_10476175 | |||
| 1209 | Ga0207675_100469815 | |||
| 1210 | Ga0207675_100617577 | |||
| 1211 | Ga0207683_10002653 | |||
| 1212 | Ga0207683_10003604 | |||
| 1213 | Ga0207683_10008086 | |||
| 1214 | Ga0207683_10070826 | |||
| 1215 | Ga0207683_10458671 | |||
| 1216 | Ga0207698_10338457 | |||
| 1217 | Ga0209974_10004814 | |||
| 1218 | Ga0209974_10049995 | |||
| 1219 | Ga0207428_10343028 | |||
| 1220 | Ga0268266_10002974 | |||
| 1221 | Ga0268266_10141483 | |||
| 1222 | Ga0268266_10161405 | |||
| 1223 | Ga0268266_10574551 | |||
| 1224 | Ga0268265_10018839 | |||
| 1225 | Ga0268265_10397537 | |||
| 1226 | Ga0268264_10008218 | |||
| 1227 | Ga0268264_10011950 | |||
| 1228 | Ga0268264_10021850 | |||
| 1229 | Ga0268264_10060925 | |||
| 1230 | Ga0268264_10414671 | |||
| 1231 | Ga0268264_10477854 | |||
| 1232 | Ga0307513_10093726 | |||
| 1233 | Ga0373959_0036791 | |||
| 1234 | Ga0373940_0082905 | |||
| 1235 | Ga0373944_0115947 | |||
| 1236 | Ga0373932_0158300 | |||
| 1237 | Ga0373945_0163451 | |||
| 1238 | Ga0373943_0030336 | |||
| 1239 | Ga0373943_0151178 | |||
| 1240 | Ga0373943_0154588 | |||
| 1241 | Ga0373946_0090256 | |||
| 1242 | Ga0373946_0092041 | |||
| 1243 | Ga0373946_0235078 | |||
| 1244 | Ga0373955_0094916 | |||
| 1245 | Ga0373924_0066559 | |||
| 1246 | Ga0373935_0067357 | |||
| 1247 | Ga0373935_0250894 | |||
| 1248 | Ga0373927_0225263 | |||
| 1249 | Ga0373933_0180851 | |||
| 1250 | Ga0373947_0018018 | |||
| 1251 | Ga0373947_0051719 | |||
| 1252 | Ga0373947_0062249 | |||
| 1253 | Ga0373947_0180444 | |||
| 1254 | Ga0373925_0059921 | |||
| 1255 | Ga0373925_0075105 | |||
| 1256 | Ga0373925_0178495 | |||
| 1257 | Ga0395900_0009876 | |||
| 1258 | Ga0395900_0379306 | |||
| 1259 | Ga0395898_0014853 | |||
| 1260 | Ga0395898_0586066 | |||
| 1261 | Ga0395905_0019798 | |||
| 1262 | Ga0395905_0051394 | |||
| 1263 | Ga0395905_0558714 | |||
| 1264 | Ga0395901_0004662 | |||
| 1265 | Ga0395901_0053682 | |||
| 1266 | Ga0395901_0071409 | |||
| 1267 | Ga0395901_0137096 | |||
| 1268 | Ga0436365_0725183 | |||
| 1269 | Ga0436365_0743711 | |||
| 1270 | Ga0451787_787321 | |||
| 1271 | Ga0451853_3052533 | |||
| 1272 | Ga0451576_0038986 | |||
| 1273 | Ga0451576_0063594 | |||
| 1274 | Ga0466967_0782395 | |||
| 1275 | Ga0495592_0060803 | |||
| 1276 | Ga0495603_0164421 | |||
| 1277 | Ga0495651_0135541 | |||
| 1278 | Ga0495580_0167139 | |||
| 1279 | Ga0495580_0220448 | |||
| 1280 | Ga0495639_0121611 | |||
| 1281 | Ga0495585_0035090 | |||
| 1282 | Ga0495608_0182256 | |||
| 1283 | Ga0495628_0288651 | |||
| 1284 | Ga0495630_0124351 | |||
| 1285 | Ga0495643_0000176 | |||
| 1286 | Ga0495644_0062791 | |||
| 1287 | Ga0495652_0024908 | |||
| 1288 | Ga0495652_0211157 | |||
| 1289 | Ga0495598_0001731 | |||
| 1290 | Ga0495598_0014056 | |||
| 1291 | Ga0495645_0047814 | |||
| 1292 | Ga0495634_0248949 | |||
| 1293 | Ga0495659_0008961 | |||
| 1294 | Ga0495659_0050632 | |||
| 1295 | Ga0495659_0141065 | |||
| 1296 | Ga0495588_0121148 | |||
| 1297 | Ga0495599_0033741 | |||
| 1298 | Ga0495599_0215267 | |||
| 1299 | Ga0495623_0079725 | |||
| 1300 | Ga0495646_0053143 | |||
| 1301 | Ga0495658_0114094 | |||
| 1302 | Ga0495669_0063231 | |||
| 1303 | Ga0495670_0216466 | |||
| 1304 | Ga0495671_0120689 | |||
| 1305 | Ga0495600_0351843 | |||
| 1306 | Ga0495581_0213655 | |||
| 1307 | Ga0495604_0308817 | |||
| 1308 | Ga0495674_0154019 | |||
| 1309 | Ga0495675_0011585 | |||
| 1310 | Ga0495684_0006328 | |||
| 1311 | Ga0495684_0090540 | |||
| 1312 | Ga0495602_0069761 | |||
| 1313 | Ga0496100_0023535 | |||
| 1314 | Ga0496100_0170912 | |||
| 1315 | Ga0496101_0003525 | |||
| 1316 | Ga0496101_0092484 | |||
| 1317 | Ga0496101_0131754 | |||
| 1318 | Ga0496101_0377263 | |||
| 1319 | Ga0496102_0050163 | |||
| 1320 | Ga0496102_0118429 | |||
| 1321 | Ga0496102_0150245 | |||
| 1322 | Ga0496102_0557113 | |||
| 1323 | Ga0496104_0073911 | |||
| 1324 | Ga0496105_0143744 | |||
| 1325 | Ga0496105_0229527 | |||
| 1326 | Ga0496105_0247800 | |||
| 1327 | Ga0496105_0379870 | |||
| 1328 | Ga0496106_0020281 | |||
| 1329 | Ga0496107_0022989 | |||
| 1330 | Ga0496107_0061696 | |||
| 1331 | Ga0496107_0275955 | |||
| 1332 | Ga0496108_0043777 | |||
| 1333 | Ga0496108_0120947 | |||
| 1334 | Ga0496108_0125391 | |||
| 1335 | Ga0496108_0364127 | |||
| 1336 | Ga0496108_0495896 | |||
| 1337 | Ga0496109_0009018 | |||
| 1338 | Ga0496109_0098208 | |||
| 1339 | Ga0496109_0117018 | |||
| 1340 | Ga0496109_0182387 | |||
| 1341 | Ga0496109_0188090 | |||
| 1342 | Ga0496109_0282367 | |||
| 1343 | Ga0496110_0022417 | |||
| 1344 | Ga0496110_0345746 | |||
| 1345 | Ga0496110_0444512 | |||
| 1346 | Ga0496110_0546224 | |||
| 1347 | Ga0496111_0283704 | |||
| 1348 | Ga0496112_0005284 | |||
| 1349 | Ga0496112_0014542 | |||
| 1350 | Ga0496112_0029766 | |||
| 1351 | Ga0496112_0047623 | |||
| 1352 | Ga0496112_0329358 | |||
| 1353 | Ga0496112_0366672 | |||
| 1354 | Ga0496113_0116490 | |||
| 1355 | Ga0496113_0130664 | |||
| 1356 | Ga0496113_0266185 | |||
| 1357 | Ga0496114_0024566 | |||
| 1358 | Ga0496114_0061373 | |||
| 1359 | Ga0496115_0001810 | |||
| 1360 | Ga0496115_0016337 | |||
| 1361 | Ga0496115_0098535 | |||
| 1362 | Ga0496115_0168166 | |||
| 1363 | nmdc:mga05p37_1087359_c1 | |||
| 1364 | nmdc:mga05p37_446057_c1 | |||
| 1365 | nmdc:mga05p37_5724_c2 | |||
| 1366 | nmdc:mga05p37_777871_c1 | |||
| 1367 | nmdc:mga08y16_82954_c1 | |||
| 1368 | nmdc:mga0n895_263653_c1 | |||
| 1369 | nmdc:mga0n895_571204_c1 | |||
| 1370 | nmdc:mga0rr50_102775_c1 | |||
| 1371 | nmdc:mga0rr50_486973_c1 | |||
| 1372 | nmdc:mga08x19_64194_c1 | |||
| 1373 | nmdc:mga0a205_207276_c1 | |||
| 1374 | nmdc:mga0a205_719227_c1 | |||
| 1375 | Ga0495619_0094039 | |||
| 1376 | 2787505954 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7k2t-assembly1.cif.gz_B | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.6485 | 4 | 253 |
| 6m96-assembly1.cif.gz_B-2 | atp-bound conformation of the wzmwzt o antigen abc transporter | 0.6476 | 6 | 253 |
| 7k2t-assembly1.cif.gz_B | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.6362 | 4 | 253 |
| 6oih-assembly2.cif.gz_C | crystal structure of o-antigen polysaccharide abc-transporter | 0.6339 | 4 | 253 |
| 6m96-assembly1.cif.gz_B-2 | atp-bound conformation of the wzmwzt o antigen abc transporter | 0.6301 | 6 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5396 | 57 | 245 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5199 | 47 | 244 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5087 | 31 | 250 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4489 | 31 | 250 | 3.40.1710.10 |
| af_Q2G1V6_3_205_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4407 | 55 | 249 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6LXK8-F1-model_v4 | ABC transporter permease | 0.972 | 42 | 258 |
GO:0016020
|
| AF-A0A2V5SRU2-F1-model_v4 | ABC transporter permease | 0.9643 | 109 | 258 |
GO:0016020
|
| AF-A0A2V6LXK8-F1-model_v4 | ABC transporter permease | 0.9633 | 42 | 258 |
GO:0016020
|
| AF-A0A2V6H6N7-F1-model_v4 | ABC transporter permease | 0.9582 | 79 | 258 |
GO:0016020
|
| AF-A0A2V6BR21-F1-model_v4 | ABC transporter permease | 0.958 | 130 | 258 |
GO:0016020
|