F475321

General Info

Members Datasets Scaffolds Average Seq Length
688 280 1376 333

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10007091|Ga0157369_100070914
Length 384
Sequence LFWTIIFKASESGQTSSDHQRAERVTRPAGFCYHPLSMKRTGENVVRIEAEALRRLADRIGGPMGEAFQRALDLMFECRGRVVVTGMGKSGIIARKIAATLSSIGTPALYLHPVEAIHGDLGMVVSGDVVVALSASGETEEILRLLANIKRLRVPLITMTCDEIFGASPLSVEPHGVDGDSRELAAPQKLSTLAAAAEVALDCSIDKEACSLGLAPTASTTAMLALGDALAVALSEKRGFKEEDFANLHPGGKLGKRLARVESLMHSGDAVPRVAPTAKMPDVIYEMSRKKLGMTAVVEGDKLLGVVSDGDLRRLLEQRGKDVLDLTAAECMTRDPKTIAGTEFAATALSIMEEKKITALVVVGNGAKLEGIVHLHDLWGTEMV

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
187 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
188 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
191 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
192 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
199 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
214 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
280 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.73
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 4.07
Rhizosphere 93.9
Stem 0
Stem Tuber 0
Unclassified 8.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10007091 3300013105 Bacteria 12928
2 JGI24752J21851_1002230 3300001976 Bacteria 2587
3 JGI24743J22301_10007511 3300001991 Bacteria 1892
4 JGI24751J29686_10012545 3300002459 Bacteria 1747
5 rootH1_10087392 3300003316 Bacteria 4244
6 rootH2_10017798 3300003320 Bacteria 14280
7 rootL2_10074167 3300003322 Bacteria 3966
8 rootL2_10180054 3300003322 Bacteria 2710
9 Ga0058862_10076746 3300004803 Bacteria 2674
10 Ga0065715_10151838 3300005293 Bacteria 1706
11 Ga0070658_10088467 3300005327 Bacteria 2550
12 Ga0070676_10103438 3300005328 Bacteria 1763
13 Ga0070676_10129380 3300005328 Bacteria 1594
14 Ga0070683_100001626 3300005329 Bacteria 17385
15 Ga0070683_100067321 3300005329 Bacteria 3336
16 Ga0070683_100163742 3300005329 Bacteria 2110
17 Ga0070683_100228700 3300005329 Bacteria 1768
18 Ga0070690_100042191 3300005330 Bacteria 2889
19 Ga0070690_100106958 3300005330 Bacteria 1861
20 Ga0070670_100052443 3300005331 Bacteria 3503
21 Ga0070670_100098527 3300005331 Bacteria 2515
22 Ga0070670_100110019 3300005331 Bacteria 2374
23 Ga0068869_100001857 3300005334 Bacteria 12700
24 Ga0068869_100002009 3300005334 Bacteria 12223
25 Ga0068869_100103680 3300005334 Bacteria 2155
26 Ga0070666_10000112 3300005335 Bacteria 55997
27 Ga0070666_10013203 3300005335 Bacteria 5236
28 Ga0070666_10194478 3300005335 Bacteria 1426
29 Ga0070680_100037547 3300005336 Bacteria 3914
30 Ga0070680_100107442 3300005336 Bacteria 2321
31 Ga0070680_100204746 3300005336 Bacteria 1664
32 Ga0070682_100020328 3300005337 Bacteria 3906
33 Ga0070682_100034220 3300005337 Bacteria 3093
34 Ga0070682_100060727 3300005337 Bacteria 2391
35 Ga0068868_100008985 3300005338 Bacteria 7171
36 Ga0068868_100014278 3300005338 Bacteria 5851
37 Ga0068868_100043917 3300005338 Bacteria 3492
38 Ga0070660_100002367 3300005339 Bacteria 12955
39 Ga0070660_100177063 3300005339 Bacteria 1725
40 Ga0070691_10018185 3300005341 Bacteria 3239
41 Ga0070687_100004698 3300005343 Bacteria 5463
42 Ga0070687_100033238 3300005343 Bacteria 2544
43 Ga0070661_100041173 3300005344 Bacteria 3371
44 Ga0070661_100060461 3300005344 Bacteria 2780
45 Ga0070675_100193240 3300005354 Bacteria 1764
46 Ga0070671_100145196 3300005355 Bacteria 2002
47 Ga0070674_100036897 3300005356 Bacteria 3285
48 Ga0070688_100000649 3300005365 Bacteria 17263
49 Ga0070688_100254182 3300005365 Unclassified 1252
50 Ga0070659_100002024 3300005366 Bacteria 14493
51 Ga0070659_100110688 3300005366 Bacteria 2217
52 Ga0070659_100155171 3300005366 Unclassified 1869
53 Ga0070667_100017599 3300005367 Bacteria 5921
54 Ga0070709_10012407 3300005434 Bacteria 4770
55 Ga0070709_10034826 3300005434 Bacteria 3056
56 Ga0070714_100031796 3300005435 Bacteria 4405
57 Ga0070714_100053079 3300005435 Bacteria 3459
58 Ga0070714_100059609 3300005435 Bacteria 3273
59 Ga0070714_100105981 3300005435 Bacteria 2483
60 Ga0070714_100413684 3300005435 Bacteria 1276
61 Ga0070714_100414440 3300005435 Bacteria 1275
62 Ga0070714_100450386 3300005435 Bacteria 1223
63 Ga0070713_100005746 3300005436 Bacteria 8521
64 Ga0070713_100007565 3300005436 Bacteria 7636
65 Ga0070713_100011239 3300005436 Bacteria 6511
66 Ga0070713_100036748 3300005436 Bacteria 3955
67 Ga0070713_100046707 3300005436 Bacteria 3554
68 Ga0070713_100061504 3300005436 Unclassified 3141
69 Ga0070713_100083172 3300005436 Unclassified 2736
70 Ga0070713_100340513 3300005436 Bacteria 1389
71 Ga0070710_10025077 3300005437 Bacteria 3154
72 Ga0070710_10035306 3300005437 Bacteria 2725
73 Ga0070710_10160127 3300005437 Bacteria 1395
74 Ga0070701_10005375 3300005438 Bacteria 5284
75 Ga0070711_100008817 3300005439 Bacteria 6188
76 Ga0070711_100013799 3300005439 Bacteria 5082
77 Ga0070711_100022031 3300005439 Bacteria 4125
78 Ga0070711_100127600 3300005439 Bacteria 1890
79 Ga0070711_100227844 3300005439 Bacteria 1452
80 Ga0070700_100034036 3300005441 Bacteria 3074
81 Ga0070708_100004387 3300005445 Bacteria 11082
82 Ga0070708_100034749 3300005445 Bacteria 4387
83 Ga0070708_100044873 3300005445 Bacteria 3890
84 Ga0070708_100060491 3300005445 Bacteria 3381
85 Ga0070708_100085848 3300005445 Bacteria 2857
86 Ga0070663_100022418 3300005455 Bacteria 4222
87 Ga0070678_100020672 3300005456 Bacteria 4324
88 Ga0070678_100044700 3300005456 Bacteria 3164
89 Ga0070678_100111458 3300005456 Bacteria 2141
90 Ga0070678_100131764 3300005456 Bacteria 1987
91 Ga0070662_100035203 3300005457 Bacteria 3535
92 Ga0070681_10016054 3300005458 Bacteria 7464
93 Ga0070681_10056317 3300005458 Bacteria 3913
94 Ga0070681_10111751 3300005458 Unclassified 2671
95 Ga0070681_10187229 3300005458 Bacteria 1990
96 Ga0070681_10211351 3300005458 Bacteria 1856
97 Ga0070681_10212467 3300005458 Bacteria 1851
98 Ga0070681_10228072 3300005458 Bacteria 1777
99 Ga0068867_100015408 3300005459 Bacteria 5421
100 Ga0068867_100038327 3300005459 Bacteria 3489
101 Ga0068867_100098863 3300005459 Bacteria 2225
102 Ga0070685_10088377 3300005466 Unclassified 1871
103 Ga0070706_100004518 3300005467 Bacteria 13398
104 Ga0070706_100007965 3300005467 Bacteria 9892
105 Ga0070706_100041991 3300005467 Bacteria 4224
106 Ga0070706_100151444 3300005467 Unclassified 2165
107 Ga0070706_100307884 3300005467 Bacteria 1478
108 Ga0070707_100010330 3300005468 Bacteria 8690
109 Ga0070707_100013103 3300005468 Bacteria 7750
110 Ga0070707_100076256 3300005468 Bacteria 3234
111 Ga0070698_100000039 3300005471 Bacteria 91348
112 Ga0070698_100042796 3300005471 Bacteria 4646
113 Ga0070699_100096724 3300005518 Bacteria 2586
114 Ga0070679_100002354 3300005530 Bacteria 17120
115 Ga0070679_100006248 3300005530 Bacteria 11099
116 Ga0070679_100031817 3300005530 Bacteria 5216
117 Ga0070679_100182384 3300005530 Bacteria 2071
118 Ga0070684_100007055 3300005535 Bacteria 8732
119 Ga0070684_100025259 3300005535 Bacteria 4992
120 Ga0070684_100026321 3300005535 Bacteria 4899
121 Ga0070684_100256762 3300005535 Bacteria 1598
122 Ga0070684_100312043 3300005535 Bacteria 1444
123 Ga0070697_100040698 3300005536 Bacteria 3761
124 Ga0070697_100067209 3300005536 Bacteria 2932
125 Ga0070697_100228610 3300005536 Unclassified 1586
126 Ga0068853_100006954 3300005539 Bacteria 9036
127 Ga0068853_100093357 3300005539 Bacteria 2649
128 Ga0068853_100113996 3300005539 Bacteria 2404
129 Ga0068853_100157184 3300005539 Bacteria 2049
130 Ga0070672_100061334 3300005543 Bacteria 2964
131 Ga0070696_100079366 3300005546 Bacteria 2322
132 Ga0070696_100134052 3300005546 Bacteria 1805
133 Ga0070665_100119943 3300005548 Unclassified 2632
134 Ga0070665_100154251 3300005548 Bacteria 2299
135 Ga0070665_100443517 3300005548 Bacteria 1307
136 Ga0068855_100000782 3300005563 Bacteria 39281
137 Ga0068855_100003547 3300005563 Bacteria 19079
138 Ga0068855_100004362 3300005563 Bacteria 17294
139 Ga0068855_100018769 3300005563 Bacteria 8314
140 Ga0068855_100047589 3300005563 Bacteria 5066
141 Ga0068855_100222868 3300005563 Bacteria 2114
142 Ga0070664_100001991 3300005564 Bacteria 16379
143 Ga0070664_100010095 3300005564 Bacteria 7655
144 Ga0068857_100000775 3300005577 Bacteria 23800
145 Ga0068857_100001392 3300005577 Bacteria 19079
146 Ga0068857_100198356 3300005577 Bacteria 1829
147 Ga0068857_100258835 3300005577 Unclassified 1597
148 Ga0068857_100418012 3300005577 Unclassified 1250
149 Ga0068854_100002592 3300005578 Bacteria 11198
150 Ga0068854_100090550 3300005578 Bacteria 2275
151 Ga0068854_100095898 3300005578 Bacteria 2215
152 Ga0068854_100127888 3300005578 Bacteria 1937
153 Ga0068854_100174988 3300005578 Unclassified 1672
154 Ga0068856_100000437 3300005614 Bacteria 45849
155 Ga0068856_100005024 3300005614 Bacteria 13099
156 Ga0068856_100005815 3300005614 Bacteria 12156
157 Ga0068856_100083869 3300005614 Bacteria 3165
158 Ga0068856_100104260 3300005614 Bacteria 2829
159 Ga0068856_100179631 3300005614 Unclassified 2129
160 Ga0068856_100331633 3300005614 Unclassified 1539
161 Ga0070702_100021445 3300005615 Bacteria 3399
162 Ga0068852_100005128 3300005616 Bacteria 9334
163 Ga0068852_100012290 3300005616 Bacteria 6493
164 Ga0068852_100189228 3300005616 Bacteria 1941
165 Ga0068852_100378513 3300005616 Bacteria 1388
166 Ga0068852_100394460 3300005616 Bacteria 1360
167 Ga0068852_100403705 3300005616 Unclassified 1345
168 Ga0068859_100000018 3300005617 Bacteria 248813
169 Ga0068859_100000298 3300005617 Bacteria 49363
170 Ga0068859_100018200 3300005617 Bacteria 7062
171 Ga0068859_100251227 3300005617 Bacteria 1859
172 Ga0068864_100002195 3300005618 Bacteria 16100
173 Ga0068864_100002226 3300005618 Bacteria 16023
174 Ga0068864_100026453 3300005618 Bacteria 4893
175 Ga0068864_100035311 3300005618 Bacteria 4256
176 Ga0068864_100038489 3300005618 Bacteria 4085
177 Ga0068864_100135313 3300005618 Bacteria 2218
178 Ga0068861_100067746 3300005719 Unclassified 2756
179 Ga0068861_100075095 3300005719 Bacteria 2631
180 Ga0068861_100404971 3300005719 Bacteria 1212
181 Ga0068861_100515472 3300005719 Bacteria 1083
182 Ga0068851_10078344 3300005834 Bacteria 1722
183 Ga0068851_10094974 3300005834 Bacteria 1575
184 Ga0068870_10000211 3300005840 Bacteria 21074
185 Ga0068870_10108856 3300005840 Bacteria 1578
186 Ga0068863_100005189 3300005841 Bacteria 12849
187 Ga0068863_100101577 3300005841 Bacteria 2734
188 Ga0068858_100000728 3300005842 Bacteria 34411
189 Ga0068858_100002919 3300005842 Bacteria 17201
190 Ga0068858_100010844 3300005842 Bacteria 8616
191 Ga0068858_100028909 3300005842 Bacteria 5147
192 Ga0068858_100072311 3300005842 Bacteria 3200
193 Ga0068860_100031286 3300005843 Bacteria 5116
194 Ga0068860_100048179 3300005843 Bacteria 4062
195 Ga0068860_100141659 3300005843 Bacteria 2311
196 Ga0068860_100156457 3300005843 Bacteria 2197
197 Ga0068862_100413965 3300005844 Bacteria 1263
198 Ga0070717_10002780 3300006028 Bacteria 12385
199 Ga0070717_10012555 3300006028 Bacteria 6463
200 Ga0070717_10351968 3300006028 Bacteria 1317
201 Ga0070715_10125253 3300006163 Bacteria 1230
202 Ga0070716_100000412 3300006173 Bacteria 17590
203 Ga0070712_100003917 3300006175 Bacteria 9168
204 Ga0070712_100007097 3300006175 Bacteria 6988
205 Ga0070712_100014269 3300006175 Bacteria 5101
206 Ga0070712_100099225 3300006175 Bacteria 2149
207 Ga0070712_100111988 3300006175 Bacteria 2038
208 Ga0075366_10008292 3300006195 Bacteria 5772
209 Ga0097621_100000472 3300006237 Bacteria 28201
210 Ga0097621_100005119 3300006237 Bacteria 9211
211 Ga0097621_100021084 3300006237 Bacteria 5033
212 Ga0097621_100161643 3300006237 Bacteria 1925
213 Ga0097621_100179945 3300006237 Bacteria 1827
214 Ga0097621_100188313 3300006237 Bacteria 1786
215 Ga0068871_100000084 3300006358 Bacteria 53380
216 Ga0068871_100027840 3300006358 Bacteria 4426
217 Ga0068871_100067580 3300006358 Bacteria 2933
218 Ga0068871_100103111 3300006358 Bacteria 2392
219 Ga0068871_100130163 3300006358 Bacteria 2133
220 Ga0068871_100236235 3300006358 Unclassified 1588
221 Ga0075428_100002512 3300006844 Bacteria 19933
222 Ga0075433_10017089 3300006852 Bacteria 5999
223 Ga0075433_10201290 3300006852 Bacteria 1770
224 Ga0075434_100000303 3300006871 Bacteria 34918
225 Ga0075434_100006848 3300006871 Bacteria 10493
226 Ga0075434_100010660 3300006871 Bacteria 8629
227 Ga0075434_100013728 3300006871 Bacteria 7723
228 Ga0075434_100567561 3300006871 Bacteria 1154
229 Ga0068865_100020735 3300006881 Bacteria 4266
230 Ga0068865_100030842 3300006881 Bacteria 3569
231 Ga0068865_100059521 3300006881 Bacteria 2672
232 Ga0068865_100107252 3300006881 Bacteria 2054
233 Ga0068865_100254777 3300006881 Bacteria 1387
234 Ga0075436_100001773 3300006914 Bacteria 14792
235 Ga0075436_100012670 3300006914 Bacteria 5778
236 Ga0075436_100022740 3300006914 Unclassified 4307
237 Ga0075436_100086953 3300006914 Bacteria 2171
238 Ga0097620_100000018 3300006931 Bacteria 248813
239 Ga0097620_100000298 3300006931 Bacteria 49363
240 Ga0097620_100018202 3300006931 Bacteria 7062
241 Ga0097620_100251243 3300006931 Bacteria 1859
242 Ga0075435_100001940 3300007076 Bacteria 13479
243 Ga0075435_100041806 3300007076 Bacteria 3665
244 Ga0105240_10005889 3300009093 Bacteria 18155
245 Ga0105240_10019633 3300009093 Bacteria 9026
246 Ga0105240_10039462 3300009093 Bacteria 6047
247 Ga0105240_10125612 3300009093 Bacteria 3083
248 Ga0105240_10138712 3300009093 Bacteria 2909
249 Ga0105240_10306446 3300009093 Bacteria 1815
250 Ga0111539_10209782 3300009094 Bacteria 2270
251 Ga0105245_10003176 3300009098 Bacteria 14685
252 Ga0105245_10005120 3300009098 Bacteria 11520
253 Ga0105245_10020679 3300009098 Bacteria 5770
254 Ga0105245_10199370 3300009098 Bacteria 1921
255 Ga0105247_10005382 3300009101 Bacteria 8065
256 Ga0105247_10036051 3300009101 Bacteria 3016
257 Ga0105241_10001966 3300009174 Bacteria 15555
258 Ga0105241_10040079 3300009174 Bacteria 3535
259 Ga0105241_10127828 3300009174 Bacteria 2054
260 Ga0105241_10212161 3300009174 Bacteria 1623
261 Ga0105248_10029115 3300009177 Bacteria 6158
262 Ga0105248_10035966 3300009177 Bacteria 5539
263 Ga0105248_10079009 3300009177 Unclassified 3697
264 Ga0105248_10174681 3300009177 Bacteria 2422
265 Ga0105237_10002252 3300009545 Bacteria 24014
266 Ga0105237_10003222 3300009545 Bacteria 19554
267 Ga0105237_10027686 3300009545 Bacteria 5780
268 Ga0105237_10058217 3300009545 Bacteria 3868
269 Ga0105237_10378172 3300009545 Unclassified 1421
270 Ga0105238_10012484 3300009551 Bacteria 8569
271 Ga0105238_10037575 3300009551 Bacteria 4922
272 Ga0105249_10005930 3300009553 Bacteria 10585
273 Ga0105249_10092022 3300009553 Bacteria 2838
274 Ga0105249_10282203 3300009553 Bacteria 1659
275 Ga0105249_10504310 3300009553 Bacteria 1255
276 Ga0105239_10002453 3300010375 Bacteria 23633
277 Ga0105239_10071172 3300010375 Bacteria 3821
278 Ga0105239_10097035 3300010375 Bacteria 3257
279 Ga0105239_10225797 3300010375 Unclassified 2101
280 Ga0105239_10557092 3300010375 Bacteria 1306
281 Ga0105246_10063497 3300011119 Bacteria 2576
282 Ga0105246_10100654 3300011119 Bacteria 2103
283 Ga0105246_10199382 3300011119 Bacteria 1555
284 Ga0157373_10005980 3300013100 Bacteria 9103
285 Ga0157373_10053729 3300013100 Bacteria 2864
286 Ga0157373_10077039 3300013100 Bacteria 2352
287 Ga0157373_10221392 3300013100 Bacteria 1335
288 Ga0157370_10114950 3300013104 Bacteria 2514
289 Ga0157370_10141257 3300013104 Unclassified 2243
290 Ga0157370_10150084 3300013104 Unclassified 2169
291 Ga0157370_10210610 3300013104 Bacteria 1801
292 Ga0157369_10000297 3300013105 Bacteria 66398
293 Ga0157369_10004291 3300013105 Bacteria 16859
294 Ga0157369_10015876 3300013105 Bacteria 8480
295 Ga0157369_10066644 3300013105 Bacteria 3873
296 Ga0157374_10000357 3300013296 Bacteria 42343
297 Ga0157374_10001545 3300013296 Bacteria 19407
298 Ga0157374_10001620 3300013296 Bacteria 18879
299 Ga0157374_10001876 3300013296 Bacteria 17667
300 Ga0157374_10075968 3300013296 Bacteria 3175
301 Ga0157374_10167999 3300013296 Bacteria 2139
302 Ga0157378_10000133 3300013297 Bacteria 70888
303 Ga0157378_10000970 3300013297 Bacteria 26291
304 Ga0157378_10009203 3300013297 Bacteria 8602
305 Ga0157378_10018115 3300013297 Bacteria 6184
306 Ga0157378_10037172 3300013297 Bacteria 4312
307 Ga0157378_10046849 3300013297 Bacteria 3842
308 Ga0163162_10001107 3300013306 Bacteria 24993
309 Ga0163162_10009985 3300013306 Bacteria 9231
310 Ga0163162_10036746 3300013306 Bacteria 4884
311 Ga0157372_10000544 3300013307 Bacteria 41533
312 Ga0157372_10000749 3300013307 Bacteria 35224
313 Ga0157372_10002337 3300013307 Bacteria 20534
314 Ga0157372_10053060 3300013307 Bacteria 4517
315 Ga0157372_10111813 3300013307 Bacteria 3129
316 Ga0157372_10208841 3300013307 Bacteria 2262
317 Ga0157372_10243572 3300013307 Bacteria 2086
318 Ga0157372_10358666 3300013307 Bacteria 1699
319 Ga0157372_10589640 3300013307 Bacteria 1296
320 Ga0157375_10147731 3300013308 Bacteria 2483
321 Ga0157375_10390409 3300013308 Bacteria 1559
322 Ga0163163_10041486 3300014325 Bacteria 4500
323 Ga0163163_10118100 3300014325 Bacteria 2684
324 Ga0163163_10310268 3300014325 Bacteria 1630
325 Ga0157380_10086862 3300014326 Bacteria 2571
326 Ga0157380_10187513 3300014326 Bacteria 1823
327 Ga0182008_10021047 3300014497 Bacteria 3353
328 Ga0157377_10000704 3300014745 Bacteria 13786
329 Ga0157379_10036033 3300014968 Bacteria 4412
330 Ga0157379_10148276 3300014968 Bacteria 2116
331 Ga0157379_10248894 3300014968 Bacteria 1613
332 Ga0157376_10002166 3300014969 Bacteria 13231
333 Ga0157376_10023839 3300014969 Bacteria 4797
334 Ga0157376_10084238 3300014969 Bacteria 2737
335 Ga0157376_10339339 3300014969 Bacteria 1434
336 Ga0182007_10007804 3300015262 Bacteria 4450
337 Ga0163161_10010962 3300017792 Bacteria 6281
338 Ga0228598_1007166 3300024227 Bacteria 2281
339 Ga0207656_10064673 3300025321 Bacteria 1613
340 Ga0207682_10026377 3300025893 Bacteria 2310
341 Ga0207692_10088723 3300025898 Bacteria 1672
342 Ga0207710_10004125 3300025900 Bacteria 6380
343 Ga0207688_10009395 3300025901 Bacteria 5326
344 Ga0207688_10032133 3300025901 Bacteria 2900
345 Ga0207680_10000193 3300025903 Bacteria 29312
346 Ga0207680_10035685 3300025903 Bacteria 2857
347 Ga0207647_10001725 3300025904 Bacteria 16767
348 Ga0207647_10095040 3300025904 Bacteria 1775
349 Ga0207699_10014129 3300025906 Bacteria 4106
350 Ga0207699_10030809 3300025906 Bacteria 3005
351 Ga0207699_10160356 3300025906 Bacteria 1496
352 Ga0207699_10199802 3300025906 Bacteria 1354
353 Ga0207699_10201656 3300025906 Unclassified 1348
354 Ga0207645_10000104 3300025907 Bacteria 62309
355 Ga0207643_10000512 3300025908 Bacteria 24816
356 Ga0207643_10006921 3300025908 Bacteria 6080
357 Ga0207684_10000457 3300025910 Bacteria 53335
358 Ga0207684_10054018 3300025910 Bacteria 3408
359 Ga0207654_10001980 3300025911 Bacteria 10581
360 Ga0207654_10018281 3300025911 Bacteria 3676
361 Ga0207654_10130020 3300025911 Bacteria 1592
362 Ga0207654_10160948 3300025911 Bacteria 1450
363 Ga0207707_10001372 3300025912 Bacteria 22585
364 Ga0207707_10012202 3300025912 Bacteria 7470
365 Ga0207707_10063186 3300025912 Bacteria 3222
366 Ga0207695_10070288 3300025913 Bacteria 3579
367 Ga0207695_10070744 3300025913 Bacteria 3565
368 Ga0207695_10093475 3300025913 Unclassified 3016
369 Ga0207695_10162121 3300025913 Bacteria 2167
370 Ga0207695_10199351 3300025913 Bacteria 1916
371 Ga0207695_10214937 3300025913 Bacteria 1832
372 Ga0207695_10262885 3300025913 Bacteria 1623
373 Ga0207671_10001799 3300025914 Bacteria 23966
374 Ga0207671_10009175 3300025914 Bacteria 8298
375 Ga0207671_10025778 3300025914 Bacteria 4412
376 Ga0207671_10042066 3300025914 Bacteria 3382
377 Ga0207671_10112587 3300025914 Bacteria 2072
378 Ga0207693_10001454 3300025915 Bacteria 20960
379 Ga0207693_10007586 3300025915 Bacteria 8914
380 Ga0207693_10012077 3300025915 Bacteria 6983
381 Ga0207693_10034746 3300025915 Bacteria 3976
382 Ga0207693_10090013 3300025915 Bacteria 2405
383 Ga0207693_10262333 3300025915 Bacteria 1354
384 Ga0207663_10023888 3300025916 Bacteria 3515
385 Ga0207663_10079133 3300025916 Bacteria 2145
386 Ga0207660_10050806 3300025917 Bacteria 2945
387 Ga0207660_10190271 3300025917 Bacteria 1598
388 Ga0207660_10333916 3300025917 Bacteria 1212
389 Ga0207662_10028514 3300025918 Bacteria 3228
390 Ga0207657_10002030 3300025919 Bacteria 21872
391 Ga0207649_10000149 3300025920 Bacteria 57837
392 Ga0207652_10000098 3300025921 Bacteria 94858
393 Ga0207652_10014836 3300025921 Bacteria 6317
394 Ga0207646_10013710 3300025922 Bacteria 7740
395 Ga0207646_10148211 3300025922 Bacteria 2115
396 Ga0207646_10191675 3300025922 Bacteria 1846
397 Ga0207646_10284928 3300025922 Unclassified 1493
398 Ga0207681_10006994 3300025923 Bacteria 6924
399 Ga0207694_10057084 3300025924 Unclassified 3034
400 Ga0207694_10113525 3300025924 Bacteria 2157
401 Ga0207650_10000442 3300025925 Bacteria 35606
402 Ga0207650_10032174 3300025925 Bacteria 3794
403 Ga0207650_10037358 3300025925 Bacteria 3539
404 Ga0207659_10006779 3300025926 Bacteria 7040
405 Ga0207687_10001854 3300025927 Bacteria 14548
406 Ga0207700_10004348 3300025928 Bacteria 8337
407 Ga0207700_10005883 3300025928 Bacteria 7374
408 Ga0207700_10007126 3300025928 Bacteria 6813
409 Ga0207700_10028787 3300025928 Bacteria 3913
410 Ga0207664_10001649 3300025929 Bacteria 14702
411 Ga0207664_10010810 3300025929 Bacteria 6460
412 Ga0207664_10028600 3300025929 Bacteria 4238
413 Ga0207664_10084133 3300025929 Bacteria 2594
414 Ga0207664_10235851 3300025929 Bacteria 1592
415 Ga0207644_10276281 3300025931 Bacteria 1348
416 Ga0207706_10000651 3300025933 Bacteria 36655
417 Ga0207706_10014413 3300025933 Bacteria 7164
418 Ga0207686_10081199 3300025934 Bacteria 2116
419 Ga0207709_10182258 3300025935 Unclassified 1484
420 Ga0207669_10053883 3300025937 Bacteria 2426
421 Ga0207704_10005806 3300025938 Bacteria 5709
422 Ga0207704_10025863 3300025938 Bacteria 3210
423 Ga0207704_10139319 3300025938 Bacteria 1694
424 Ga0207704_10222833 3300025938 Bacteria 1397
425 Ga0207704_10256779 3300025938 Bacteria 1315
426 Ga0207665_10000884 3300025939 Bacteria 20220
427 Ga0207665_10032359 3300025939 Bacteria 3462
428 Ga0207691_10000312 3300025940 Bacteria 48438
429 Ga0207691_10006924 3300025940 Bacteria 10933
430 Ga0207691_10015832 3300025940 Bacteria 7168
431 Ga0207711_10002489 3300025941 Bacteria 16445
432 Ga0207711_10073624 3300025941 Bacteria 2969
433 Ga0207689_10000706 3300025942 Bacteria 32003
434 Ga0207689_10003386 3300025942 Bacteria 14566
435 Ga0207689_10003649 3300025942 Bacteria 14045
436 Ga0207689_10048022 3300025942 Bacteria 3521
437 Ga0207661_10000213 3300025944 Bacteria 37493
438 Ga0207661_10012169 3300025944 Bacteria 6248
439 Ga0207661_10065711 3300025944 Bacteria 2945
440 Ga0207661_10255183 3300025944 Bacteria 1560
441 Ga0207661_10272824 3300025944 Bacteria 1510
442 Ga0207679_10000080 3300025945 Bacteria 84997
443 Ga0207679_10037097 3300025945 Bacteria 3462
444 Ga0207679_10157560 3300025945 Bacteria 1856
445 Ga0207667_10000475 3300025949 Bacteria 53512
446 Ga0207667_10001648 3300025949 Bacteria 28133
447 Ga0207667_10011648 3300025949 Bacteria 10207
448 Ga0207667_10067837 3300025949 Unclassified 3715
449 Ga0207667_10108728 3300025949 Bacteria 2860
450 Ga0207651_10000653 3300025960 Bacteria 14741
451 Ga0207651_10251174 3300025960 Bacteria 1447
452 Ga0207712_10026102 3300025961 Bacteria 3889
453 Ga0207712_10027693 3300025961 Bacteria 3785
454 Ga0207712_10143522 3300025961 Bacteria 1835
455 Ga0207640_10007162 3300025981 Bacteria 6146
456 Ga0207640_10044860 3300025981 Bacteria 2835
457 Ga0207640_10124342 3300025981 Bacteria 1854
458 Ga0207640_10299638 3300025981 Bacteria 1271
459 Ga0207658_10228740 3300025986 Bacteria 1569
460 Ga0207677_10000965 3300026023 Bacteria 15939
461 Ga0207677_10001580 3300026023 Bacteria 12065
462 Ga0207677_10004544 3300026023 Bacteria 7462
463 Ga0207677_10006822 3300026023 Bacteria 6272
464 Ga0207677_10179879 3300026023 Unclassified 1662
465 Ga0207677_10206307 3300026023 Bacteria 1566
466 Ga0207703_10001934 3300026035 Bacteria 18342
467 Ga0207703_10003058 3300026035 Bacteria 14148
468 Ga0207703_10004846 3300026035 Bacteria 10948
469 Ga0207703_10005756 3300026035 Bacteria 9931
470 Ga0207703_10014844 3300026035 Bacteria 6079
471 Ga0207703_10043426 3300026035 Bacteria 3608
472 Ga0207639_10040501 3300026041 Bacteria 3477
473 Ga0207639_10089042 3300026041 Unclassified 2465
474 Ga0207639_10093972 3300026041 Bacteria 2406
475 Ga0207678_10000687 3300026067 Bacteria 30966
476 Ga0207708_10006721 3300026075 Bacteria 8509
477 Ga0207708_10026128 3300026075 Bacteria 4417
478 Ga0207702_10005732 3300026078 Bacteria 10822
479 Ga0207702_10011714 3300026078 Bacteria 7305
480 Ga0207702_10027898 3300026078 Bacteria 4691
481 Ga0207702_10047228 3300026078 Bacteria 3627
482 Ga0207702_10447264 3300026078 Bacteria 1253
483 Ga0207641_10000015 3300026088 Bacteria 321332
484 Ga0207641_10000432 3300026088 Bacteria 48190
485 Ga0207641_10008617 3300026088 Bacteria 8417
486 Ga0207641_10123736 3300026088 Bacteria 2312
487 Ga0207648_10001706 3300026089 Bacteria 24036
488 Ga0207648_10066522 3300026089 Bacteria 3143
489 Ga0207648_10078093 3300026089 Bacteria 2887
490 Ga0207676_10000586 3300026095 Bacteria 29950
491 Ga0207676_10002258 3300026095 Bacteria 13840
492 Ga0207676_10474770 3300026095 Bacteria 1183
493 Ga0207674_10000165 3300026116 Bacteria 79381
494 Ga0207674_10001107 3300026116 Bacteria 35021
495 Ga0207674_10015293 3300026116 Bacteria 8436
496 Ga0207675_100068498 3300026118 Bacteria 3316
497 Ga0207675_100077216 3300026118 Bacteria 3120
498 Ga0207675_100169987 3300026118 Bacteria 2083
499 Ga0207675_100513610 3300026118 Unclassified 1194
500 Ga0207683_10004384 3300026121 Bacteria 12193
501 Ga0207683_10016959 3300026121 Bacteria 6199
502 Ga0207698_10009978 3300026142 Bacteria 6078
503 Ga0207698_10105318 3300026142 Bacteria 2350
504 Ga0268265_10005678 3300028380 Bacteria 8521
505 Ga0268264_10005599 3300028381 Bacteria 10646
506 Ga0268264_10009685 3300028381 Bacteria 7982
507 Ga0268264_10032967 3300028381 Bacteria 4252
508 Ga0268264_10063071 3300028381 Bacteria 3114
509 Ga0268264_10125444 3300028381 Bacteria 2268
510 Ga0307515_10000031 3300028794 Bacteria 358648
511 Ga0307515_10000133 3300028794 Bacteria 176091
512 Ga0265338_10052948 3300028800 Bacteria 3636
513 Ga0265762_1003446 3300030760 Bacteria 2834
514 Ga0265760_10007449 3300031090 Bacteria 3129
515 Ga0265760_10008099 3300031090 Bacteria 3002
516 Ga0265760_10016441 3300031090 Bacteria 2123
517 Ga0265325_10001387 3300031241 Bacteria 17099
518 Ga0265325_10027690 3300031241 Bacteria 3061
519 Ga0265339_10004017 3300031249 Bacteria 10174
520 Ga0265339_10016016 3300031249 Bacteria 4479
521 Ga0265331_10014653 3300031250 Bacteria 4166
522 Ga0265316_10006073 3300031344 Bacteria 11591
523 Ga0265316_10011504 3300031344 Bacteria 7973
524 Ga0265316_10015996 3300031344 Bacteria 6528
525 Ga0307509_10044659 3300031507 Bacteria 4786
526 Ga0307408_100022706 3300031548 Bacteria 4266
527 Ga0265313_10005589 3300031595 Bacteria 9196
528 Ga0307508_10004635 3300031616 Bacteria 13350
529 Ga0307514_10019165 3300031649 Bacteria 5601
530 Ga0316575_10008094 3300031665 Bacteria 3822
531 Ga0316579_10003282 3300031691 Bacteria 6280
532 Ga0265314_10001960 3300031711 Bacteria 21893
533 Ga0265314_10005810 3300031711 Bacteria 11052
534 Ga0265314_10138090 3300031711 Bacteria 1511
535 Ga0316576_10031932 3300031727 Bacteria 3740
536 Ga0316578_10099723 3300031728 Unclassified 1740
537 Ga0316577_10123048 3300031733 Unclassified 1458
538 Ga0307410_10024366 3300031852 Bacteria 3779
539 Ga0307407_10061268 3300031903 Bacteria 2199
540 Ga0307409_100000699 3300031995 Bacteria 14940
541 Ga0307416_100023449 3300032002 Bacteria 4479
542 Ga0307411_10003407 3300032005 Bacteria 7371
543 Ga0307411_10011260 3300032005 Bacteria 4817
544 Ga0316583_10021225 3300032133 Unclassified 2328
545 Ga0316585_10005751 3300032137 Bacteria 3510
546 Ga0307510_10004925 3300033180 Bacteria 15802
547 Ga0373934_0027441 3300035086 Bacteria 2213
548 Ga0373936_0085152 3300035113 Bacteria 1320
549 Ga0373956_0007195 3300035119 Bacteria 4483
550 Ga0373956_0025356 3300035119 Bacteria 2562
551 Ga0373943_0082046 3300035170 Bacteria 1655
552 Ga0373943_0211543 3300035170 Bacteria 1077
553 Ga0373955_0023631 3300035172 Bacteria 3133
554 Ga0316574_0082453 3300035398 Unclassified 2043
555 Ga0373931_0033111 3300035691 Bacteria 2677
556 Ga0373931_0091653 3300035691 Bacteria 1694
557 Ga0373935_0005093 3300035692 Bacteria 7746
558 Ga0373927_0043324 3300035695 Bacteria 2914
559 Ga0373927_0162460 3300035695 Bacteria 1463
560 Ga0373927_0227235 3300035695 Bacteria 1226
561 Ga0373933_0000545 3300035724 Bacteria 23433
562 Ga0373947_0227224 3300035725 Unclassified 1228
563 Ga0373937_0000074 3300036401 Bacteria 91289
564 Ga0373937_0000827 3300036401 Bacteria 26530
565 Ga0373937_0013056 3300036401 Bacteria 7316
566 Ga0373937_0128313 3300036401 Bacteria 2367
567 Ga0373937_0180135 3300036401 Bacteria 1984
568 Ga0373937_0388890 3300036401 Bacteria 1323
569 Ga0316582_0061461 3300036647 Unclassified 2409
570 Ga0316582_0096846 3300036647 Bacteria 1949
571 Ga0316584_0044986 3300036712 Unclassified 3293
572 Ga0373925_0003807 3300037068 Bacteria 11585
573 Ga0373925_0079754 3300037068 Bacteria 2487
574 Ga0395899_0002500 3300037312 Bacteria 14918
575 Ga0395899_0071908 3300037312 Bacteria 2531
576 Ga0395900_0006705 3300037418 Bacteria 11964
577 Ga0395900_0041142 3300037418 Bacteria 4765
578 Ga0395898_0001101 3300037466 Bacteria 41709
579 Ga0395901_0022924 3300038443 Bacteria 6400
580 Ga0400489_01028 3300039093 Bacteria 1027
581 Ga0436365_0595099 3300039437 Bacteria 1447
582 Ga0439445_0007815 3300042004 Bacteria 2491
583 Ga0451577_0022384 3300042876 Bacteria 5770
584 Ga0451577_0155216 3300042876 Bacteria 2060
585 Ga0451577_0202955 3300042876 Bacteria 1790
586 Ga0466963_0222045 3300044694 Unclassified 1323
587 Ga0453684_0007454 3300044712 Bacteria 20093
588 Ga0466957_0022232 3300044842 Bacteria 3739
589 Ga0466957_0225036 3300044842 Unclassified 1240
590 Ga0466959_0004141 3300045049 Bacteria 9660
591 Ga0466959_0104947 3300045049 Bacteria 2021
592 Ga0451576_0003645 3300045051 Bacteria 20903
593 Ga0451576_0015526 3300045051 Bacteria 8431
594 Ga0451576_0059225 3300045051 Bacteria 3999
595 Ga0451576_0161748 3300045051 Bacteria 2337
596 Ga0451576_0170572 3300045051 Unclassified 2271
597 Ga0466958_0020168 3300045836 Bacteria 3886
598 Ga0466967_0032255 3300045976 Unclassified 4421
599 Ga0466967_0045037 3300045976 Bacteria 3832
600 Ga0466967_0052110 3300045976 Bacteria 3590
601 Ga0466967_0201009 3300045976 Unclassified 1887
602 Ga0466967_0302039 3300045976 Bacteria 1540
603 Ga0495651_0001464 3300046462 Bacteria 18261
604 Ga0495651_0176196 3300046462 Bacteria 1518
605 Ga0495653_0045441 3300046463 Bacteria 3405
606 Ga0495580_0000223 3300046472 Bacteria 44018
607 Ga0495580_0002222 3300046472 Bacteria 16974
608 Ga0495580_0012137 3300046472 Bacteria 6626
609 Ga0495580_0037632 3300046472 Bacteria 3470
610 Ga0495580_0037850 3300046472 Bacteria 3459
611 Ga0495580_0043029 3300046472 Bacteria 3215
612 Ga0495580_0085538 3300046472 Bacteria 2196
613 Ga0495582_0010349 3300046473 Bacteria 5132
614 Ga0495594_0072602 3300046499 Bacteria 1915
615 Ga0495606_0037411 3300046507 Bacteria 3297
616 Ga0495608_0106130 3300046511 Bacteria 1808
617 Ga0495652_0135735 3300046529 Bacteria 1941
618 Ga0495665_0008695 3300046531 Bacteria 5512
619 Ga0495586_0082604 3300046535 Bacteria 1767
620 Ga0495587_0000113 3300046536 Bacteria 61684
621 Ga0495645_0013197 3300046543 Bacteria 5842
622 Ga0495667_0095675 3300046559 Unclassified 1923
623 Ga0495667_0117257 3300046559 Bacteria 1720
624 Ga0495634_0112444 3300046642 Bacteria 1750
625 Ga0495625_0064441 3300046660 Bacteria 2585
626 Ga0495599_0336704 3300046678 Bacteria 906
627 Ga0495623_0064847 3300046679 Bacteria 2285
628 Ga0495647_0006947 3300046681 Bacteria 3771
629 Ga0495658_0034724 3300046683 Bacteria 2769
630 Ga0495669_0038467 3300046684 Bacteria 2119
631 Ga0495669_0135431 3300046684 Bacteria 1161
632 Ga0495669_0150902 3300046684 Bacteria 1100
633 Ga0495649_0004267 3300046694 Bacteria 9378
634 Ga0495604_0021951 3300047317 Bacteria 5095
635 Ga0495680_0079534 3300047322 Bacteria 2479
636 Ga0495675_0000317 3300047444 Bacteria 34404
637 Ga0495686_0000473 3300047472 Bacteria 59965
638 Ga0495602_0000069 3300048088 Bacteria 101160
639 Ga0495602_0107559 3300048088 Unclassified 2273
640 Ga0496100_0069823 3300048903 Bacteria 2341
641 Ga0496102_0074118 3300048905 Bacteria 3129
642 Ga0496102_0075100 3300048905 Bacteria 3107
643 Ga0496102_0145760 3300048905 Bacteria 2222
644 Ga0496102_0241491 3300048905 Bacteria 1703
645 Ga0496103_0005215 3300048906 Bacteria 7808
646 Ga0496104_0109708 3300048907 Bacteria 2645
647 Ga0496105_0013709 3300048908 Bacteria 6436
648 Ga0496105_0060775 3300048908 Bacteria 3118
649 Ga0496108_0000228 3300048911 Bacteria 50279
650 Ga0496109_0000362 3300048912 Bacteria 42175
651 Ga0496110_0012685 3300048913 Bacteria 6935
652 Ga0496110_0137359 3300048913 Unclassified 2209
653 Ga0496111_0001468 3300048914 Bacteria 13488
654 Ga0496111_0028145 3300048914 Bacteria 3981
655 Ga0496111_0346327 3300048914 Unclassified 1100
656 Ga0496112_0000034 3300048915 Bacteria 107237
657 Ga0496112_0003539 3300048915 Bacteria 12966
658 Ga0496112_0035814 3300048915 Bacteria 4837
659 Ga0496112_0038831 3300048915 Bacteria 4651
660 Ga0496112_0047241 3300048915 Unclassified 4223
661 Ga0496112_0066889 3300048915 Bacteria 3546
662 Ga0496112_0081759 3300048915 Bacteria 3195
663 Ga0496112_0101844 3300048915 Unclassified 2842
664 Ga0496113_0000391 3300048916 Bacteria 21186
665 Ga0496113_0448522 3300048916 Unclassified 1036
666 Ga0496115_0101896 3300048918 Bacteria 2354
667 Ga0496115_0197690 3300048918 Unclassified 1661
668 Ga0501034_0024828 3300049571 Bacteria 6098
669 Ga0501038_0121881 3300049574 Bacteria 2149
670 Ga0501076_0202829 3300049592 Bacteria 1620
671 Ga0501044_0181513 3300049823 Bacteria 2071
672 nmdc:mga0k408_7554_c1 3300050493 Bacteria 5806
673 nmdc:mga0n895_15786_c1 3300050512 Bacteria 6904
674 nmdc:mga0n895_3115_c1 3300050512 Bacteria 13216
675 nmdc:mga0n895_327185_c1 3300050512 Bacteria 1553
676 nmdc:mga0n895_6567_c1 3300050512 Bacteria 9899
677 nmdc:mga0rr50_1398_c1 3300050513 Bacteria 13221
678 nmdc:mga0rr50_511127_c1 3300050513 Unclassified 1022
679 nmdc:mga08x19_17986_c1 3300050514 Unclassified 4329
680 nmdc:mga08x19_185975_c1 3300050514 Bacteria 1420
681 nmdc:mga08x19_46063_c1 3300050514 Unclassified 2788
682 nmdc:mga08x19_5765_c1 3300050514 Bacteria 7323
683 nmdc:mga08x19_9044_c1 3300050514 Bacteria 5946
684 nmdc:mga0a205_1031_c1 3300050515 Bacteria 15759
685 nmdc:mga0a205_493912_c1 3300050515 Unclassified 1081
686 Ga0495601_0037734 3300053077 Unclassified 3020
687 Ga0466962_0051791 3300061719 Bacteria 1963
688 2919139599 2919138771 Bacteria 5281312
689 Ga0157369_10007091
690 JGI24752J21851_1002230
691 JGI24743J22301_10007511
692 JGI24751J29686_10012545
693 rootH1_10087392
694 rootH2_10017798
695 rootL2_10074167
696 rootL2_10180054
697 Ga0058862_10076746
698 Ga0065715_10151838
699 Ga0070658_10088467
700 Ga0070676_10103438
701 Ga0070676_10129380
702 Ga0070683_100001626
703 Ga0070683_100067321
704 Ga0070683_100163742
705 Ga0070683_100228700
706 Ga0070690_100042191
707 Ga0070690_100106958
708 Ga0070670_100052443
709 Ga0070670_100098527
710 Ga0070670_100110019
711 Ga0068869_100001857
712 Ga0068869_100002009
713 Ga0068869_100103680
714 Ga0070666_10000112
715 Ga0070666_10013203
716 Ga0070666_10194478
717 Ga0070680_100037547
718 Ga0070680_100107442
719 Ga0070680_100204746
720 Ga0070682_100020328
721 Ga0070682_100034220
722 Ga0070682_100060727
723 Ga0068868_100008985
724 Ga0068868_100014278
725 Ga0068868_100043917
726 Ga0070660_100002367
727 Ga0070660_100177063
728 Ga0070691_10018185
729 Ga0070687_100004698
730 Ga0070687_100033238
731 Ga0070661_100041173
732 Ga0070661_100060461
733 Ga0070675_100193240
734 Ga0070671_100145196
735 Ga0070674_100036897
736 Ga0070688_100000649
737 Ga0070688_100254182
738 Ga0070659_100002024
739 Ga0070659_100110688
740 Ga0070659_100155171
741 Ga0070667_100017599
742 Ga0070709_10012407
743 Ga0070709_10034826
744 Ga0070714_100031796
745 Ga0070714_100053079
746 Ga0070714_100059609
747 Ga0070714_100105981
748 Ga0070714_100413684
749 Ga0070714_100414440
750 Ga0070714_100450386
751 Ga0070713_100005746
752 Ga0070713_100007565
753 Ga0070713_100011239
754 Ga0070713_100036748
755 Ga0070713_100046707
756 Ga0070713_100061504
757 Ga0070713_100083172
758 Ga0070713_100340513
759 Ga0070710_10025077
760 Ga0070710_10035306
761 Ga0070710_10160127
762 Ga0070701_10005375
763 Ga0070711_100008817
764 Ga0070711_100013799
765 Ga0070711_100022031
766 Ga0070711_100127600
767 Ga0070711_100227844
768 Ga0070700_100034036
769 Ga0070708_100004387
770 Ga0070708_100034749
771 Ga0070708_100044873
772 Ga0070708_100060491
773 Ga0070708_100085848
774 Ga0070663_100022418
775 Ga0070678_100020672
776 Ga0070678_100044700
777 Ga0070678_100111458
778 Ga0070678_100131764
779 Ga0070662_100035203
780 Ga0070681_10016054
781 Ga0070681_10056317
782 Ga0070681_10111751
783 Ga0070681_10187229
784 Ga0070681_10211351
785 Ga0070681_10212467
786 Ga0070681_10228072
787 Ga0068867_100015408
788 Ga0068867_100038327
789 Ga0068867_100098863
790 Ga0070685_10088377
791 Ga0070706_100004518
792 Ga0070706_100007965
793 Ga0070706_100041991
794 Ga0070706_100151444
795 Ga0070706_100307884
796 Ga0070707_100010330
797 Ga0070707_100013103
798 Ga0070707_100076256
799 Ga0070698_100000039
800 Ga0070698_100042796
801 Ga0070699_100096724
802 Ga0070679_100002354
803 Ga0070679_100006248
804 Ga0070679_100031817
805 Ga0070679_100182384
806 Ga0070684_100007055
807 Ga0070684_100025259
808 Ga0070684_100026321
809 Ga0070684_100256762
810 Ga0070684_100312043
811 Ga0070697_100040698
812 Ga0070697_100067209
813 Ga0070697_100228610
814 Ga0068853_100006954
815 Ga0068853_100093357
816 Ga0068853_100113996
817 Ga0068853_100157184
818 Ga0070672_100061334
819 Ga0070696_100079366
820 Ga0070696_100134052
821 Ga0070665_100119943
822 Ga0070665_100154251
823 Ga0070665_100443517
824 Ga0068855_100000782
825 Ga0068855_100003547
826 Ga0068855_100004362
827 Ga0068855_100018769
828 Ga0068855_100047589
829 Ga0068855_100222868
830 Ga0070664_100001991
831 Ga0070664_100010095
832 Ga0068857_100000775
833 Ga0068857_100001392
834 Ga0068857_100198356
835 Ga0068857_100258835
836 Ga0068857_100418012
837 Ga0068854_100002592
838 Ga0068854_100090550
839 Ga0068854_100095898
840 Ga0068854_100127888
841 Ga0068854_100174988
842 Ga0068856_100000437
843 Ga0068856_100005024
844 Ga0068856_100005815
845 Ga0068856_100083869
846 Ga0068856_100104260
847 Ga0068856_100179631
848 Ga0068856_100331633
849 Ga0070702_100021445
850 Ga0068852_100005128
851 Ga0068852_100012290
852 Ga0068852_100189228
853 Ga0068852_100378513
854 Ga0068852_100394460
855 Ga0068852_100403705
856 Ga0068859_100000018
857 Ga0068859_100000298
858 Ga0068859_100018200
859 Ga0068859_100251227
860 Ga0068864_100002195
861 Ga0068864_100002226
862 Ga0068864_100026453
863 Ga0068864_100035311
864 Ga0068864_100038489
865 Ga0068864_100135313
866 Ga0068861_100067746
867 Ga0068861_100075095
868 Ga0068861_100404971
869 Ga0068861_100515472
870 Ga0068851_10078344
871 Ga0068851_10094974
872 Ga0068870_10000211
873 Ga0068870_10108856
874 Ga0068863_100005189
875 Ga0068863_100101577
876 Ga0068858_100000728
877 Ga0068858_100002919
878 Ga0068858_100010844
879 Ga0068858_100028909
880 Ga0068858_100072311
881 Ga0068860_100031286
882 Ga0068860_100048179
883 Ga0068860_100141659
884 Ga0068860_100156457
885 Ga0068862_100413965
886 Ga0070717_10002780
887 Ga0070717_10012555
888 Ga0070717_10351968
889 Ga0070715_10125253
890 Ga0070716_100000412
891 Ga0070712_100003917
892 Ga0070712_100007097
893 Ga0070712_100014269
894 Ga0070712_100099225
895 Ga0070712_100111988
896 Ga0075366_10008292
897 Ga0097621_100000472
898 Ga0097621_100005119
899 Ga0097621_100021084
900 Ga0097621_100161643
901 Ga0097621_100179945
902 Ga0097621_100188313
903 Ga0068871_100000084
904 Ga0068871_100027840
905 Ga0068871_100067580
906 Ga0068871_100103111
907 Ga0068871_100130163
908 Ga0068871_100236235
909 Ga0075428_100002512
910 Ga0075433_10017089
911 Ga0075433_10201290
912 Ga0075434_100000303
913 Ga0075434_100006848
914 Ga0075434_100010660
915 Ga0075434_100013728
916 Ga0075434_100567561
917 Ga0068865_100020735
918 Ga0068865_100030842
919 Ga0068865_100059521
920 Ga0068865_100107252
921 Ga0068865_100254777
922 Ga0075436_100001773
923 Ga0075436_100012670
924 Ga0075436_100022740
925 Ga0075436_100086953
926 Ga0097620_100000018
927 Ga0097620_100000298
928 Ga0097620_100018202
929 Ga0097620_100251243
930 Ga0075435_100001940
931 Ga0075435_100041806
932 Ga0105240_10005889
933 Ga0105240_10019633
934 Ga0105240_10039462
935 Ga0105240_10125612
936 Ga0105240_10138712
937 Ga0105240_10306446
938 Ga0111539_10209782
939 Ga0105245_10003176
940 Ga0105245_10005120
941 Ga0105245_10020679
942 Ga0105245_10199370
943 Ga0105247_10005382
944 Ga0105247_10036051
945 Ga0105241_10001966
946 Ga0105241_10040079
947 Ga0105241_10127828
948 Ga0105241_10212161
949 Ga0105248_10029115
950 Ga0105248_10035966
951 Ga0105248_10079009
952 Ga0105248_10174681
953 Ga0105237_10002252
954 Ga0105237_10003222
955 Ga0105237_10027686
956 Ga0105237_10058217
957 Ga0105237_10378172
958 Ga0105238_10012484
959 Ga0105238_10037575
960 Ga0105249_10005930
961 Ga0105249_10092022
962 Ga0105249_10282203
963 Ga0105249_10504310
964 Ga0105239_10002453
965 Ga0105239_10071172
966 Ga0105239_10097035
967 Ga0105239_10225797
968 Ga0105239_10557092
969 Ga0105246_10063497
970 Ga0105246_10100654
971 Ga0105246_10199382
972 Ga0157373_10005980
973 Ga0157373_10053729
974 Ga0157373_10077039
975 Ga0157373_10221392
976 Ga0157370_10114950
977 Ga0157370_10141257
978 Ga0157370_10150084
979 Ga0157370_10210610
980 Ga0157369_10000297
981 Ga0157369_10004291
982 Ga0157369_10015876
983 Ga0157369_10066644
984 Ga0157374_10000357
985 Ga0157374_10001545
986 Ga0157374_10001620
987 Ga0157374_10001876
988 Ga0157374_10075968
989 Ga0157374_10167999
990 Ga0157378_10000133
991 Ga0157378_10000970
992 Ga0157378_10009203
993 Ga0157378_10018115
994 Ga0157378_10037172
995 Ga0157378_10046849
996 Ga0163162_10001107
997 Ga0163162_10009985
998 Ga0163162_10036746
999 Ga0157372_10000544
1000 Ga0157372_10000749
1001 Ga0157372_10002337
1002 Ga0157372_10053060
1003 Ga0157372_10111813
1004 Ga0157372_10208841
1005 Ga0157372_10243572
1006 Ga0157372_10358666
1007 Ga0157372_10589640
1008 Ga0157375_10147731
1009 Ga0157375_10390409
1010 Ga0163163_10041486
1011 Ga0163163_10118100
1012 Ga0163163_10310268
1013 Ga0157380_10086862
1014 Ga0157380_10187513
1015 Ga0182008_10021047
1016 Ga0157377_10000704
1017 Ga0157379_10036033
1018 Ga0157379_10148276
1019 Ga0157379_10248894
1020 Ga0157376_10002166
1021 Ga0157376_10023839
1022 Ga0157376_10084238
1023 Ga0157376_10339339
1024 Ga0182007_10007804
1025 Ga0163161_10010962
1026 Ga0228598_1007166
1027 Ga0207656_10064673
1028 Ga0207682_10026377
1029 Ga0207692_10088723
1030 Ga0207710_10004125
1031 Ga0207688_10009395
1032 Ga0207688_10032133
1033 Ga0207680_10000193
1034 Ga0207680_10035685
1035 Ga0207647_10001725
1036 Ga0207647_10095040
1037 Ga0207699_10014129
1038 Ga0207699_10030809
1039 Ga0207699_10160356
1040 Ga0207699_10199802
1041 Ga0207699_10201656
1042 Ga0207645_10000104
1043 Ga0207643_10000512
1044 Ga0207643_10006921
1045 Ga0207684_10000457
1046 Ga0207684_10054018
1047 Ga0207654_10001980
1048 Ga0207654_10018281
1049 Ga0207654_10130020
1050 Ga0207654_10160948
1051 Ga0207707_10001372
1052 Ga0207707_10012202
1053 Ga0207707_10063186
1054 Ga0207695_10070288
1055 Ga0207695_10070744
1056 Ga0207695_10093475
1057 Ga0207695_10162121
1058 Ga0207695_10199351
1059 Ga0207695_10214937
1060 Ga0207695_10262885
1061 Ga0207671_10001799
1062 Ga0207671_10009175
1063 Ga0207671_10025778
1064 Ga0207671_10042066
1065 Ga0207671_10112587
1066 Ga0207693_10001454
1067 Ga0207693_10007586
1068 Ga0207693_10012077
1069 Ga0207693_10034746
1070 Ga0207693_10090013
1071 Ga0207693_10262333
1072 Ga0207663_10023888
1073 Ga0207663_10079133
1074 Ga0207660_10050806
1075 Ga0207660_10190271
1076 Ga0207660_10333916
1077 Ga0207662_10028514
1078 Ga0207657_10002030
1079 Ga0207649_10000149
1080 Ga0207652_10000098
1081 Ga0207652_10014836
1082 Ga0207646_10013710
1083 Ga0207646_10148211
1084 Ga0207646_10191675
1085 Ga0207646_10284928
1086 Ga0207681_10006994
1087 Ga0207694_10057084
1088 Ga0207694_10113525
1089 Ga0207650_10000442
1090 Ga0207650_10032174
1091 Ga0207650_10037358
1092 Ga0207659_10006779
1093 Ga0207687_10001854
1094 Ga0207700_10004348
1095 Ga0207700_10005883
1096 Ga0207700_10007126
1097 Ga0207700_10028787
1098 Ga0207664_10001649
1099 Ga0207664_10010810
1100 Ga0207664_10028600
1101 Ga0207664_10084133
1102 Ga0207664_10235851
1103 Ga0207644_10276281
1104 Ga0207706_10000651
1105 Ga0207706_10014413
1106 Ga0207686_10081199
1107 Ga0207709_10182258
1108 Ga0207669_10053883
1109 Ga0207704_10005806
1110 Ga0207704_10025863
1111 Ga0207704_10139319
1112 Ga0207704_10222833
1113 Ga0207704_10256779
1114 Ga0207665_10000884
1115 Ga0207665_10032359
1116 Ga0207691_10000312
1117 Ga0207691_10006924
1118 Ga0207691_10015832
1119 Ga0207711_10002489
1120 Ga0207711_10073624
1121 Ga0207689_10000706
1122 Ga0207689_10003386
1123 Ga0207689_10003649
1124 Ga0207689_10048022
1125 Ga0207661_10000213
1126 Ga0207661_10012169
1127 Ga0207661_10065711
1128 Ga0207661_10255183
1129 Ga0207661_10272824
1130 Ga0207679_10000080
1131 Ga0207679_10037097
1132 Ga0207679_10157560
1133 Ga0207667_10000475
1134 Ga0207667_10001648
1135 Ga0207667_10011648
1136 Ga0207667_10067837
1137 Ga0207667_10108728
1138 Ga0207651_10000653
1139 Ga0207651_10251174
1140 Ga0207712_10026102
1141 Ga0207712_10027693
1142 Ga0207712_10143522
1143 Ga0207640_10007162
1144 Ga0207640_10044860
1145 Ga0207640_10124342
1146 Ga0207640_10299638
1147 Ga0207658_10228740
1148 Ga0207677_10000965
1149 Ga0207677_10001580
1150 Ga0207677_10004544
1151 Ga0207677_10006822
1152 Ga0207677_10179879
1153 Ga0207677_10206307
1154 Ga0207703_10001934
1155 Ga0207703_10003058
1156 Ga0207703_10004846
1157 Ga0207703_10005756
1158 Ga0207703_10014844
1159 Ga0207703_10043426
1160 Ga0207639_10040501
1161 Ga0207639_10089042
1162 Ga0207639_10093972
1163 Ga0207678_10000687
1164 Ga0207708_10006721
1165 Ga0207708_10026128
1166 Ga0207702_10005732
1167 Ga0207702_10011714
1168 Ga0207702_10027898
1169 Ga0207702_10047228
1170 Ga0207702_10447264
1171 Ga0207641_10000015
1172 Ga0207641_10000432
1173 Ga0207641_10008617
1174 Ga0207641_10123736
1175 Ga0207648_10001706
1176 Ga0207648_10066522
1177 Ga0207648_10078093
1178 Ga0207676_10000586
1179 Ga0207676_10002258
1180 Ga0207676_10474770
1181 Ga0207674_10000165
1182 Ga0207674_10001107
1183 Ga0207674_10015293
1184 Ga0207675_100068498
1185 Ga0207675_100077216
1186 Ga0207675_100169987
1187 Ga0207675_100513610
1188 Ga0207683_10004384
1189 Ga0207683_10016959
1190 Ga0207698_10009978
1191 Ga0207698_10105318
1192 Ga0268265_10005678
1193 Ga0268264_10005599
1194 Ga0268264_10009685
1195 Ga0268264_10032967
1196 Ga0268264_10063071
1197 Ga0268264_10125444
1198 Ga0307515_10000031
1199 Ga0307515_10000133
1200 Ga0265338_10052948
1201 Ga0265762_1003446
1202 Ga0265760_10007449
1203 Ga0265760_10008099
1204 Ga0265760_10016441
1205 Ga0265325_10001387
1206 Ga0265325_10027690
1207 Ga0265339_10004017
1208 Ga0265339_10016016
1209 Ga0265331_10014653
1210 Ga0265316_10006073
1211 Ga0265316_10011504
1212 Ga0265316_10015996
1213 Ga0307509_10044659
1214 Ga0307408_100022706
1215 Ga0265313_10005589
1216 Ga0307508_10004635
1217 Ga0307514_10019165
1218 Ga0316575_10008094
1219 Ga0316579_10003282
1220 Ga0265314_10001960
1221 Ga0265314_10005810
1222 Ga0265314_10138090
1223 Ga0316576_10031932
1224 Ga0316578_10099723
1225 Ga0316577_10123048
1226 Ga0307410_10024366
1227 Ga0307407_10061268
1228 Ga0307409_100000699
1229 Ga0307416_100023449
1230 Ga0307411_10003407
1231 Ga0307411_10011260
1232 Ga0316583_10021225
1233 Ga0316585_10005751
1234 Ga0307510_10004925
1235 Ga0373934_0027441
1236 Ga0373936_0085152
1237 Ga0373956_0007195
1238 Ga0373956_0025356
1239 Ga0373943_0082046
1240 Ga0373943_0211543
1241 Ga0373955_0023631
1242 Ga0316574_0082453
1243 Ga0373931_0033111
1244 Ga0373931_0091653
1245 Ga0373935_0005093
1246 Ga0373927_0043324
1247 Ga0373927_0162460
1248 Ga0373927_0227235
1249 Ga0373933_0000545
1250 Ga0373947_0227224
1251 Ga0373937_0000074
1252 Ga0373937_0000827
1253 Ga0373937_0013056
1254 Ga0373937_0128313
1255 Ga0373937_0180135
1256 Ga0373937_0388890
1257 Ga0316582_0061461
1258 Ga0316582_0096846
1259 Ga0316584_0044986
1260 Ga0373925_0003807
1261 Ga0373925_0079754
1262 Ga0395899_0002500
1263 Ga0395899_0071908
1264 Ga0395900_0006705
1265 Ga0395900_0041142
1266 Ga0395898_0001101
1267 Ga0395901_0022924
1268 Ga0400489_01028
1269 Ga0436365_0595099
1270 Ga0439445_0007815
1271 Ga0451577_0022384
1272 Ga0451577_0155216
1273 Ga0451577_0202955
1274 Ga0466963_0222045
1275 Ga0453684_0007454
1276 Ga0466957_0022232
1277 Ga0466957_0225036
1278 Ga0466959_0004141
1279 Ga0466959_0104947
1280 Ga0451576_0003645
1281 Ga0451576_0015526
1282 Ga0451576_0059225
1283 Ga0451576_0161748
1284 Ga0451576_0170572
1285 Ga0466958_0020168
1286 Ga0466967_0032255
1287 Ga0466967_0045037
1288 Ga0466967_0052110
1289 Ga0466967_0201009
1290 Ga0466967_0302039
1291 Ga0495651_0001464
1292 Ga0495651_0176196
1293 Ga0495653_0045441
1294 Ga0495580_0000223
1295 Ga0495580_0002222
1296 Ga0495580_0012137
1297 Ga0495580_0037632
1298 Ga0495580_0037850
1299 Ga0495580_0043029
1300 Ga0495580_0085538
1301 Ga0495582_0010349
1302 Ga0495594_0072602
1303 Ga0495606_0037411
1304 Ga0495608_0106130
1305 Ga0495652_0135735
1306 Ga0495665_0008695
1307 Ga0495586_0082604
1308 Ga0495587_0000113
1309 Ga0495645_0013197
1310 Ga0495667_0095675
1311 Ga0495667_0117257
1312 Ga0495634_0112444
1313 Ga0495625_0064441
1314 Ga0495599_0336704
1315 Ga0495623_0064847
1316 Ga0495647_0006947
1317 Ga0495658_0034724
1318 Ga0495669_0038467
1319 Ga0495669_0135431
1320 Ga0495669_0150902
1321 Ga0495649_0004267
1322 Ga0495604_0021951
1323 Ga0495680_0079534
1324 Ga0495675_0000317
1325 Ga0495686_0000473
1326 Ga0495602_0000069
1327 Ga0495602_0107559
1328 Ga0496100_0069823
1329 Ga0496102_0074118
1330 Ga0496102_0075100
1331 Ga0496102_0145760
1332 Ga0496102_0241491
1333 Ga0496103_0005215
1334 Ga0496104_0109708
1335 Ga0496105_0013709
1336 Ga0496105_0060775
1337 Ga0496108_0000228
1338 Ga0496109_0000362
1339 Ga0496110_0012685
1340 Ga0496110_0137359
1341 Ga0496111_0001468
1342 Ga0496111_0028145
1343 Ga0496111_0346327
1344 Ga0496112_0000034
1345 Ga0496112_0003539
1346 Ga0496112_0035814
1347 Ga0496112_0038831
1348 Ga0496112_0047241
1349 Ga0496112_0066889
1350 Ga0496112_0081759
1351 Ga0496112_0101844
1352 Ga0496113_0000391
1353 Ga0496113_0448522
1354 Ga0496115_0101896
1355 Ga0496115_0197690
1356 Ga0501034_0024828
1357 Ga0501038_0121881
1358 Ga0501076_0202829
1359 Ga0501044_0181513
1360 nmdc:mga0k408_7554_c1
1361 nmdc:mga0n895_15786_c1
1362 nmdc:mga0n895_3115_c1
1363 nmdc:mga0n895_327185_c1
1364 nmdc:mga0n895_6567_c1
1365 nmdc:mga0rr50_1398_c1
1366 nmdc:mga0rr50_511127_c1
1367 nmdc:mga08x19_17986_c1
1368 nmdc:mga08x19_185975_c1
1369 nmdc:mga08x19_46063_c1
1370 nmdc:mga08x19_5765_c1
1371 nmdc:mga08x19_9044_c1
1372 nmdc:mga0a205_1031_c1
1373 nmdc:mga0a205_493912_c1
1374 Ga0495601_0037734
1375 Ga0466962_0051791
1376 2919139599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

75

171

0.95

PF00571

CBS

CBS domain

328

378

0.93

PF00571

CBS

CBS domain

261

318

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.971 2 202
3fxa-assembly1.cif.gz_D crystal structure of a putative sugar-phosphate isomerase (lmof2365_0531) from listeria monocytogenes str. 4b f2365 at 1.60 a resolution 0.953 4 213
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9492 2 202
3fna-assembly3.cif.gz_A crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.9427 218 339
3k2v-assembly1.cif.gz_B structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. 0.9394 215 339
ID Description Score Start End Superfamily
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9743 2 219 3.40.50.10490
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9544 2 219 3.40.50.10490
3fnaA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9489 218 339 3.10.580.10
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.947 221 341 3.10.580.10
3fxaD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9398 4 213 3.40.50.10490
ID Description Score Start End GO Terms
AF-K1Z903-F1-model_v4 SIS domain-containing protein 0.9808 8 169 GO:0097367
GO:1901135
AF-A0A660PIE3-F1-model_v4 D-arabinose 5-phosphate isomerase 0.9797 3 196 GO:0016853
GO:0097367
GO:1901135
AF-A0A7G3ELT6-F1-model_v4 deleted 0.9779 1 213
AF-A0A656SJ60-F1-model_v4 deleted 0.9738 38 119
AF-A0A5C4YD10-F1-model_v4 KpsF/GutQ family sugar-phosphate isomerase 0.9719 3 221 GO:0005975
GO:0016853
GO:0097367
GO:1901135

Map