F475322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 688 | 355 | 1376 | 438 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10007611|Ga0157374_100076111 |
| Length | 512 |
| Sequence | VKFGDCFGIRPPKRKTSSPPFYLVVQKDELTQIHRILPMFDQLSERLQGAFANLRGGRQLTEENMEDALREVRRALLEADVSLRVIKAFISRVKDRAVGEDVLKSVEPGQQLVKIVHDELVLLLGGESKGLNLDGKPSIIVLFGLQGSGKTTSCGKLALKLRKEGRKPLMVAADVYRPAAIQQLITLGKQIDIPVHTIEGSTDVLAIARSGLERAKSEDFDTLLVDTAGRLQIDTDMMAELLLVERVLEPQEKLLVIDAMTGQEAVAVAETFNSQLDVTGIIVSKLDGDARGGAALSVVEVTGKPIKLIGTSEKLTGLENFHPERMATRILGMGDVISLVEKAQQAFDLDEAQRMEEKMRKSEFSLEDFMKVQKSFKMLGSMEQILGMLPIPGLTKEMREMLSSSGEEQMKKIEVIIQSMTLAERRKPEIIKESRKKRIAKGCGLPEEEISRFLMQFDQMRMMMKQLTKMTDGFKKEHSPAAAGGLKMPRSMKKKXXDGFGDLMKLPDFFGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 166 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 183 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 213 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 266 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 269 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 311 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 312 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 315 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 316 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 317 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 318 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 319 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 320 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 321 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 322 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 323 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 324 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 325 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 326 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 327 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 328 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 329 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 330 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 331 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 332 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 333 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 334 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 335 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 336 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 337 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 338 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 339 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 340 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 341 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 342 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 343 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 344 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 345 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 346 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 347 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 348 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 349 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 350 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 351 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 352 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 353 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 354 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 355 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.31 |
| Metatranscriptomes | 0.73 |
| Isolates | 5.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.18 |
| Nodule | 0.15 |
| Rhizoplane | 0.29 |
| Rhizosphere | 92.59 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 0.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157374_10007611 | 3300013296 | Bacteria | 9245 |
| 2 | JGI24740J21852_10007018 | 3300001979 | Bacteria | 4618 |
| 3 | JGI25152J39213_1000028 | 3300002773 | Bacteria | 100367 |
| 4 | JGI25150J39212_1000006 | 3300002774 | Bacteria | 257228 |
| 5 | JGI25151J46595_10000024 | 3300003187 | Bacteria | 217596 |
| 6 | JGI25153J46596_10000026 | 3300003215 | Bacteria | 217245 |
| 7 | rootH2_10000579 | 3300003320 | Bacteria | 178428 |
| 8 | rootH2_10061209 | 3300003320 | Bacteria | 2278 |
| 9 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 10 | Ga0055530_10003410 | 3300003791 | Bacteria | 9068 |
| 11 | Ga0058862_10098900 | 3300004803 | Unclassified | 2654 |
| 12 | Ga0065714_10064473 | 3300005288 | Bacteria | 60352 |
| 13 | Ga0065714_10090708 | 3300005288 | Bacteria | 1935 |
| 14 | Ga0065707_10172506 | 3300005295 | Bacteria | 1455 |
| 15 | Ga0070658_10000032 | 3300005327 | Bacteria | 147726 |
| 16 | Ga0070658_10013890 | 3300005327 | Bacteria | 6464 |
| 17 | Ga0070658_10047350 | 3300005327 | Bacteria | 3480 |
| 18 | Ga0070676_10005347 | 3300005328 | Bacteria | 6838 |
| 19 | Ga0070676_10005364 | 3300005328 | Bacteria | 6826 |
| 20 | Ga0070676_10026068 | 3300005328 | Bacteria | 3309 |
| 21 | Ga0070676_10037693 | 3300005328 | Bacteria | 2789 |
| 22 | Ga0070683_100000678 | 3300005329 | Bacteria | 24650 |
| 23 | Ga0070683_100008171 | 3300005329 | Bacteria | 8891 |
| 24 | Ga0070683_100056033 | 3300005329 | Bacteria | 3660 |
| 25 | Ga0070683_100094279 | 3300005329 | Bacteria | 2813 |
| 26 | Ga0070690_100103228 | 3300005330 | Bacteria | 1893 |
| 27 | Ga0070670_100013603 | 3300005331 | Bacteria | 6972 |
| 28 | Ga0070670_100056181 | 3300005331 | Bacteria | 3378 |
| 29 | Ga0070670_100170075 | 3300005331 | Bacteria | 1890 |
| 30 | Ga0070677_10025567 | 3300005333 | Bacteria | 2205 |
| 31 | Ga0068869_100028810 | 3300005334 | Bacteria | 3885 |
| 32 | Ga0070666_10053135 | 3300005335 | Bacteria | 2732 |
| 33 | Ga0070660_100008762 | 3300005339 | Bacteria | 7086 |
| 34 | Ga0070687_100027438 | 3300005343 | Bacteria | 2751 |
| 35 | Ga0070668_100231260 | 3300005347 | Bacteria | 1528 |
| 36 | Ga0070669_100002402 | 3300005353 | Bacteria | 13552 |
| 37 | Ga0070675_100038100 | 3300005354 | Bacteria | 3917 |
| 38 | Ga0070674_100025138 | 3300005356 | Bacteria | 3873 |
| 39 | Ga0070673_100079694 | 3300005364 | Bacteria | 2652 |
| 40 | Ga0070659_100051470 | 3300005366 | Bacteria | 3238 |
| 41 | Ga0070659_100100132 | 3300005366 | Bacteria | 2332 |
| 42 | Ga0070667_100037119 | 3300005367 | Bacteria | 4085 |
| 43 | Ga0070714_100000352 | 3300005435 | Bacteria | 34452 |
| 44 | Ga0070713_100046337 | 3300005436 | Bacteria | 3567 |
| 45 | Ga0070713_100088940 | 3300005436 | Bacteria | 2652 |
| 46 | Ga0070701_10045340 | 3300005438 | Bacteria | 2255 |
| 47 | Ga0070700_100109521 | 3300005441 | Bacteria | 1834 |
| 48 | Ga0070708_100000006 | 3300005445 | Bacteria | 150596 |
| 49 | Ga0070708_100000177 | 3300005445 | Bacteria | 45553 |
| 50 | Ga0070678_100157271 | 3300005456 | Bacteria | 1837 |
| 51 | Ga0070662_100007268 | 3300005457 | Bacteria | 7178 |
| 52 | Ga0070681_10007157 | 3300005458 | Bacteria | 10868 |
| 53 | Ga0070681_10264003 | 3300005458 | Bacteria | 1633 |
| 54 | Ga0070685_10001251 | 3300005466 | Bacteria | 13485 |
| 55 | Ga0070707_100000323 | 3300005468 | Bacteria | 47041 |
| 56 | Ga0070698_100000023 | 3300005471 | Bacteria | 102971 |
| 57 | Ga0070699_100000898 | 3300005518 | Bacteria | 27761 |
| 58 | Ga0070699_100046296 | 3300005518 | Bacteria | 3764 |
| 59 | Ga0070679_100030130 | 3300005530 | Bacteria | 5356 |
| 60 | Ga0070684_100019725 | 3300005535 | Bacteria | 5581 |
| 61 | Ga0070684_100073699 | 3300005535 | Bacteria | 3009 |
| 62 | Ga0068853_100009198 | 3300005539 | Bacteria | 7958 |
| 63 | Ga0068853_100026595 | 3300005539 | Bacteria | 4860 |
| 64 | Ga0068853_100111079 | 3300005539 | Bacteria | 2435 |
| 65 | Ga0070672_100016467 | 3300005543 | Bacteria | 5293 |
| 66 | Ga0070686_100000094 | 3300005544 | Bacteria | 61903 |
| 67 | Ga0070686_100050638 | 3300005544 | Bacteria | 2640 |
| 68 | Ga0070696_100000338 | 3300005546 | Bacteria | 28429 |
| 69 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 70 | Ga0070665_100000085 | 3300005548 | Bacteria | 180238 |
| 71 | Ga0070665_100022999 | 3300005548 | Bacteria | 6276 |
| 72 | Ga0070665_100052652 | 3300005548 | Bacteria | 4082 |
| 73 | Ga0068855_100000160 | 3300005563 | Bacteria | 86118 |
| 74 | Ga0068855_100007970 | 3300005563 | Bacteria | 12797 |
| 75 | Ga0068855_100008413 | 3300005563 | Bacteria | 12479 |
| 76 | Ga0068855_100018649 | 3300005563 | Bacteria | 8343 |
| 77 | Ga0070664_100038060 | 3300005564 | Bacteria | 4047 |
| 78 | Ga0070664_100127507 | 3300005564 | Bacteria | 2233 |
| 79 | Ga0068857_100013351 | 3300005577 | Bacteria | 7154 |
| 80 | Ga0068857_100028953 | 3300005577 | Bacteria | 4888 |
| 81 | Ga0068856_100000040 | 3300005614 | Bacteria | 114443 |
| 82 | Ga0068856_100008477 | 3300005614 | Bacteria | 10002 |
| 83 | Ga0068856_100023288 | 3300005614 | Bacteria | 6023 |
| 84 | Ga0068856_100031691 | 3300005614 | Bacteria | 5173 |
| 85 | Ga0068856_100109161 | 3300005614 | Bacteria | 2763 |
| 86 | Ga0068856_100282143 | 3300005614 | Bacteria | 1678 |
| 87 | Ga0068852_100020039 | 3300005616 | Bacteria | 5311 |
| 88 | Ga0068861_100003233 | 3300005719 | Bacteria | 10780 |
| 89 | Ga0068861_100036848 | 3300005719 | Bacteria | 3633 |
| 90 | Ga0068870_10007862 | 3300005840 | Bacteria | 4768 |
| 91 | Ga0068863_100047224 | 3300005841 | Bacteria | 4085 |
| 92 | Ga0068860_100013399 | 3300005843 | Bacteria | 8040 |
| 93 | Ga0068862_100000816 | 3300005844 | Bacteria | 30859 |
| 94 | Ga0068862_100024532 | 3300005844 | Bacteria | 5061 |
| 95 | Ga0068862_100327363 | 3300005844 | Bacteria | 1416 |
| 96 | Ga0081539_10019249 | 3300005985 | Bacteria | 4683 |
| 97 | Ga0070717_10000084 | 3300006028 | Bacteria | 74786 |
| 98 | Ga0070712_100017385 | 3300006175 | Bacteria | 4657 |
| 99 | Ga0068871_100000382 | 3300006358 | Bacteria | 31056 |
| 100 | Ga0075430_100008907 | 3300006846 | Bacteria | 8471 |
| 101 | Ga0075430_100015329 | 3300006846 | Bacteria | 6528 |
| 102 | Ga0075430_100018374 | 3300006846 | Bacteria | 5949 |
| 103 | Ga0075430_100135677 | 3300006846 | Bacteria | 2050 |
| 104 | Ga0075431_100013349 | 3300006847 | Bacteria | 8301 |
| 105 | Ga0075431_100017458 | 3300006847 | Bacteria | 7294 |
| 106 | Ga0075431_100048818 | 3300006847 | Bacteria | 4365 |
| 107 | Ga0075431_100087293 | 3300006847 | Bacteria | 3219 |
| 108 | Ga0075431_100150486 | 3300006847 | Bacteria | 2397 |
| 109 | Ga0075433_10000533 | 3300006852 | Bacteria | 24984 |
| 110 | Ga0075433_10060459 | 3300006852 | Bacteria | 3317 |
| 111 | Ga0075434_100001317 | 3300006871 | Bacteria | 20733 |
| 112 | Ga0075434_100005508 | 3300006871 | Bacteria | 11528 |
| 113 | Ga0075429_100048238 | 3300006880 | Bacteria | 3704 |
| 114 | Ga0068865_100004489 | 3300006881 | Bacteria | 8423 |
| 115 | Ga0075436_100017159 | 3300006914 | Bacteria | 4955 |
| 116 | Ga0105244_10010375 | 3300009036 | Bacteria | 5652 |
| 117 | Ga0105240_10016685 | 3300009093 | Bacteria | 9932 |
| 118 | Ga0111539_10012706 | 3300009094 | Bacteria | 10545 |
| 119 | Ga0111539_10013153 | 3300009094 | Bacteria | 10350 |
| 120 | Ga0111539_10021338 | 3300009094 | Bacteria | 7973 |
| 121 | Ga0111539_10030738 | 3300009094 | Bacteria | 6528 |
| 122 | Ga0111539_10109609 | 3300009094 | Bacteria | 3240 |
| 123 | Ga0111539_10184298 | 3300009094 | Bacteria | 2438 |
| 124 | Ga0111539_10428618 | 3300009094 | Bacteria | 1540 |
| 125 | Ga0114129_10007312 | 3300009147 | Bacteria | 15724 |
| 126 | Ga0114129_10073643 | 3300009147 | Bacteria | 4758 |
| 127 | Ga0105241_10000284 | 3300009174 | Bacteria | 37721 |
| 128 | Ga0105248_10006266 | 3300009177 | Bacteria | 13044 |
| 129 | Ga0105248_10006299 | 3300009177 | Bacteria | 13021 |
| 130 | Ga0105248_10216547 | 3300009177 | Bacteria | 2157 |
| 131 | Ga0105237_10000497 | 3300009545 | Bacteria | 55632 |
| 132 | Ga0105237_10044274 | 3300009545 | Bacteria | 4481 |
| 133 | Ga0105237_10090052 | 3300009545 | Bacteria | 3058 |
| 134 | Ga0105238_10000452 | 3300009551 | Bacteria | 43023 |
| 135 | Ga0105238_10020458 | 3300009551 | Bacteria | 6737 |
| 136 | Ga0105249_10000166 | 3300009553 | Bacteria | 77555 |
| 137 | Ga0105249_10002969 | 3300009553 | Bacteria | 14632 |
| 138 | Ga0105239_10013533 | 3300010375 | Bacteria | 9056 |
| 139 | Ga0105239_10017629 | 3300010375 | Bacteria | 7899 |
| 140 | Ga0105239_10059127 | 3300010375 | Bacteria | 4207 |
| 141 | Ga0105239_10083011 | 3300010375 | Bacteria | 3528 |
| 142 | Ga0105239_10281424 | 3300010375 | Bacteria | 1872 |
| 143 | Ga0157373_10005516 | 3300013100 | Bacteria | 9487 |
| 144 | Ga0157371_10000224 | 3300013102 | Bacteria | 82657 |
| 145 | Ga0157371_10027966 | 3300013102 | Bacteria | 4086 |
| 146 | Ga0157371_10086807 | 3300013102 | Bacteria | 2216 |
| 147 | Ga0157370_10001274 | 3300013104 | Bacteria | 31529 |
| 148 | Ga0157370_10002047 | 3300013104 | Bacteria | 24775 |
| 149 | Ga0157370_10002077 | 3300013104 | Bacteria | 24517 |
| 150 | Ga0157370_10006655 | 3300013104 | Bacteria | 12695 |
| 151 | Ga0157370_10014902 | 3300013104 | Bacteria | 7930 |
| 152 | Ga0157369_10000158 | 3300013105 | Bacteria | 96395 |
| 153 | Ga0157369_10011744 | 3300013105 | Bacteria | 9943 |
| 154 | Ga0157369_10114883 | 3300013105 | Bacteria | 2858 |
| 155 | Ga0157374_10000122 | 3300013296 | Bacteria | 70398 |
| 156 | Ga0157374_10253070 | 3300013296 | Bacteria | 1734 |
| 157 | Ga0157378_10010983 | 3300013297 | Bacteria | 7925 |
| 158 | Ga0157378_10028316 | 3300013297 | Bacteria | 4943 |
| 159 | Ga0163162_10000011 | 3300013306 | Bacteria | 299877 |
| 160 | Ga0163162_10000071 | 3300013306 | Bacteria | 94831 |
| 161 | Ga0163162_10013519 | 3300013306 | Bacteria | 7970 |
| 162 | Ga0157372_10073863 | 3300013307 | Bacteria | 3844 |
| 163 | Ga0157375_10022874 | 3300013308 | Bacteria | 5759 |
| 164 | Ga0157375_10026864 | 3300013308 | Bacteria | 5373 |
| 165 | Ga0157375_10130502 | 3300013308 | Bacteria | 2632 |
| 166 | Ga0157375_10196582 | 3300013308 | Bacteria | 2172 |
| 167 | Ga0163163_10002326 | 3300014325 | Bacteria | 16061 |
| 168 | Ga0157380_10000103 | 3300014326 | Bacteria | 47312 |
| 169 | Ga0157380_10010252 | 3300014326 | Bacteria | 6734 |
| 170 | Ga0157380_10024213 | 3300014326 | Bacteria | 4592 |
| 171 | Ga0182008_10000046 | 3300014497 | Bacteria | 111777 |
| 172 | Ga0182008_10000099 | 3300014497 | Bacteria | 66933 |
| 173 | Ga0157379_10045293 | 3300014968 | Bacteria | 3927 |
| 174 | Ga0182006_1000241 | 3300015261 | Bacteria | 51244 |
| 175 | Ga0182006_1000397 | 3300015261 | Bacteria | 35456 |
| 176 | Ga0182006_1000513 | 3300015261 | Bacteria | 29503 |
| 177 | Ga0182007_10000008 | 3300015262 | Bacteria | 332953 |
| 178 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 179 | Ga0163161_10000570 | 3300017792 | Bacteria | 29671 |
| 180 | Ga0163161_10000650 | 3300017792 | Bacteria | 27726 |
| 181 | Ga0163161_10003225 | 3300017792 | Bacteria | 11476 |
| 182 | Ga0206349_1723532 | 3300020075 | Bacteria | 3582 |
| 183 | Ga0206352_10291344 | 3300020078 | Bacteria | 3842 |
| 184 | Ga0206350_10549468 | 3300020080 | Bacteria | 3373 |
| 185 | Ga0213872_10015603 | 3300021361 | Bacteria | 3531 |
| 186 | Ga0213875_10010425 | 3300021388 | Bacteria | 4651 |
| 187 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 188 | Ga0209129_1000022 | 3300025258 | Bacteria | 440876 |
| 189 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 190 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 191 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 192 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 193 | Ga0207697_10002866 | 3300025315 | Bacteria | 8733 |
| 194 | Ga0207682_10043921 | 3300025893 | Bacteria | 1831 |
| 195 | Ga0207642_10058278 | 3300025899 | Bacteria | 1781 |
| 196 | Ga0207688_10010308 | 3300025901 | Bacteria | 5087 |
| 197 | Ga0207680_10104428 | 3300025903 | Bacteria | 1826 |
| 198 | Ga0207647_10000146 | 3300025904 | Bacteria | 56177 |
| 199 | Ga0207645_10000304 | 3300025907 | Bacteria | 41252 |
| 200 | Ga0207645_10000502 | 3300025907 | Bacteria | 32417 |
| 201 | Ga0207645_10036411 | 3300025907 | Bacteria | 3159 |
| 202 | Ga0207645_10043536 | 3300025907 | Bacteria | 2874 |
| 203 | Ga0207643_10003500 | 3300025908 | Bacteria | 8444 |
| 204 | Ga0207705_10000032 | 3300025909 | Bacteria | 224376 |
| 205 | Ga0207654_10000684 | 3300025911 | Bacteria | 18967 |
| 206 | Ga0207707_10004096 | 3300025912 | Bacteria | 12914 |
| 207 | Ga0207707_10006769 | 3300025912 | Bacteria | 10006 |
| 208 | Ga0207671_10001098 | 3300025914 | Bacteria | 32717 |
| 209 | Ga0207671_10001288 | 3300025914 | Bacteria | 29500 |
| 210 | Ga0207671_10155922 | 3300025914 | Bacteria | 1766 |
| 211 | Ga0207693_10043786 | 3300025915 | Bacteria | 3519 |
| 212 | Ga0207663_10090519 | 3300025916 | Bacteria | 2028 |
| 213 | Ga0207660_10000714 | 3300025917 | Bacteria | 22147 |
| 214 | Ga0207660_10033058 | 3300025917 | Bacteria | 3575 |
| 215 | Ga0207660_10075106 | 3300025917 | Bacteria | 2468 |
| 216 | Ga0207662_10035778 | 3300025918 | Bacteria | 2901 |
| 217 | Ga0207662_10039955 | 3300025918 | Bacteria | 2755 |
| 218 | Ga0207657_10032892 | 3300025919 | Bacteria | 4679 |
| 219 | Ga0207649_10014982 | 3300025920 | Bacteria | 4352 |
| 220 | Ga0207652_10037605 | 3300025921 | Bacteria | 4097 |
| 221 | Ga0207646_10001934 | 3300025922 | Bacteria | 24862 |
| 222 | Ga0207681_10005448 | 3300025923 | Bacteria | 7814 |
| 223 | Ga0207681_10028802 | 3300025923 | Bacteria | 3600 |
| 224 | Ga0207694_10000117 | 3300025924 | Bacteria | 84322 |
| 225 | Ga0207650_10016028 | 3300025925 | Bacteria | 5229 |
| 226 | Ga0207650_10043828 | 3300025925 | Bacteria | 3286 |
| 227 | Ga0207650_10153962 | 3300025925 | Bacteria | 1817 |
| 228 | Ga0207659_10040943 | 3300025926 | Bacteria | 3243 |
| 229 | Ga0207659_10173737 | 3300025926 | Bacteria | 1701 |
| 230 | Ga0207700_10075577 | 3300025928 | Bacteria | 2611 |
| 231 | Ga0207664_10000005 | 3300025929 | Bacteria | 485048 |
| 232 | Ga0207690_10006656 | 3300025932 | Bacteria | 6846 |
| 233 | Ga0207706_10000007 | 3300025933 | Bacteria | 211081 |
| 234 | Ga0207706_10000174 | 3300025933 | Bacteria | 71663 |
| 235 | Ga0207706_10000821 | 3300025933 | Bacteria | 32232 |
| 236 | Ga0207706_10045859 | 3300025933 | Bacteria | 3871 |
| 237 | Ga0207704_10000033 | 3300025938 | Bacteria | 101319 |
| 238 | Ga0207704_10080904 | 3300025938 | Bacteria | 2099 |
| 239 | Ga0207691_10006208 | 3300025940 | Bacteria | 11543 |
| 240 | Ga0207691_10023738 | 3300025940 | Bacteria | 5773 |
| 241 | Ga0207691_10025991 | 3300025940 | Bacteria | 5495 |
| 242 | Ga0207689_10003328 | 3300025942 | Bacteria | 14718 |
| 243 | Ga0207661_10016044 | 3300025944 | Bacteria | 5522 |
| 244 | Ga0207661_10027436 | 3300025944 | Bacteria | 4350 |
| 245 | Ga0207679_10001218 | 3300025945 | Bacteria | 16351 |
| 246 | Ga0207679_10009529 | 3300025945 | Bacteria | 6224 |
| 247 | Ga0207679_10020967 | 3300025945 | Bacteria | 4422 |
| 248 | Ga0207679_10094924 | 3300025945 | Bacteria | 2317 |
| 249 | Ga0207667_10000033 | 3300025949 | Bacteria | 314353 |
| 250 | Ga0207667_10025332 | 3300025949 | Bacteria | 6495 |
| 251 | Ga0207667_10045540 | 3300025949 | Bacteria | 4645 |
| 252 | Ga0207667_10056302 | 3300025949 | Bacteria | 4131 |
| 253 | Ga0207667_10110825 | 3300025949 | Bacteria | 2831 |
| 254 | Ga0207651_10038232 | 3300025960 | Bacteria | 3152 |
| 255 | Ga0207712_10000257 | 3300025961 | Bacteria | 51458 |
| 256 | Ga0207712_10006684 | 3300025961 | Bacteria | 7272 |
| 257 | Ga0207677_10003937 | 3300026023 | Bacteria | 7904 |
| 258 | Ga0207639_10086583 | 3300026041 | Bacteria | 2495 |
| 259 | Ga0207708_10091826 | 3300026075 | Bacteria | 2342 |
| 260 | Ga0207702_10000042 | 3300026078 | Bacteria | 150673 |
| 261 | Ga0207702_10010102 | 3300026078 | Bacteria | 7909 |
| 262 | Ga0207702_10084036 | 3300026078 | Bacteria | 2771 |
| 263 | Ga0207702_10149566 | 3300026078 | Bacteria | 2123 |
| 264 | Ga0207641_10071132 | 3300026088 | Bacteria | 2991 |
| 265 | Ga0207641_10194265 | 3300026088 | Bacteria | 1867 |
| 266 | Ga0207648_10000495 | 3300026089 | Bacteria | 43912 |
| 267 | Ga0207648_10044580 | 3300026089 | Bacteria | 3891 |
| 268 | Ga0207648_10123276 | 3300026089 | Bacteria | 2279 |
| 269 | Ga0207676_10028692 | 3300026095 | Bacteria | 4159 |
| 270 | Ga0207674_10001814 | 3300026116 | Bacteria | 27247 |
| 271 | Ga0207674_10008367 | 3300026116 | Bacteria | 11968 |
| 272 | Ga0207674_10011989 | 3300026116 | Bacteria | 9714 |
| 273 | Ga0207675_100000030 | 3300026118 | Bacteria | 109178 |
| 274 | Ga0207675_100004281 | 3300026118 | Bacteria | 13797 |
| 275 | Ga0207683_10001591 | 3300026121 | Bacteria | 20448 |
| 276 | Ga0207683_10064442 | 3300026121 | Bacteria | 3229 |
| 277 | Ga0207698_10051132 | 3300026142 | Bacteria | 3157 |
| 278 | Ga0209968_1002393 | 3300027526 | Bacteria | 2830 |
| 279 | Ga0209999_1004753 | 3300027543 | Bacteria | 2442 |
| 280 | Ga0209966_1001538 | 3300027695 | Bacteria | 4009 |
| 281 | Ga0207428_10003182 | 3300027907 | Bacteria | 16071 |
| 282 | Ga0207428_10049835 | 3300027907 | Bacteria | 3353 |
| 283 | Ga0207428_10197151 | 3300027907 | Bacteria | 1516 |
| 284 | Ga0268266_10000145 | 3300028379 | Bacteria | 135284 |
| 285 | Ga0268266_10000195 | 3300028379 | Bacteria | 105788 |
| 286 | Ga0268266_10016684 | 3300028379 | Bacteria | 6276 |
| 287 | Ga0268265_10000382 | 3300028380 | Bacteria | 47511 |
| 288 | Ga0268265_10081232 | 3300028380 | Bacteria | 2559 |
| 289 | Ga0268264_10042033 | 3300028381 | Bacteria | 3782 |
| 290 | Ga0265337_1006271 | 3300028556 | Bacteria | 4611 |
| 291 | Ga0265319_1000031 | 3300028563 | Bacteria | 124456 |
| 292 | Ga0265319_1002158 | 3300028563 | Bacteria | 10991 |
| 293 | Ga0265319_1007126 | 3300028563 | Bacteria | 5070 |
| 294 | Ga0265319_1013305 | 3300028563 | Bacteria | 3279 |
| 295 | Ga0265319_1013667 | 3300028563 | Bacteria | 3215 |
| 296 | Ga0265319_1015906 | 3300028563 | Bacteria | 2897 |
| 297 | Ga0265334_10028650 | 3300028573 | Bacteria | 2236 |
| 298 | Ga0265318_10000047 | 3300028577 | Bacteria | 123944 |
| 299 | Ga0265323_10021619 | 3300028653 | Bacteria | 2465 |
| 300 | Ga0265322_10005620 | 3300028654 | Bacteria | 3708 |
| 301 | Ga0265336_10000203 | 3300028666 | Bacteria | 41432 |
| 302 | Ga0265336_10011799 | 3300028666 | Bacteria | 2958 |
| 303 | Ga0307517_10000335 | 3300028786 | Bacteria | 81908 |
| 304 | Ga0307515_10133555 | 3300028794 | Bacteria | 2715 |
| 305 | Ga0265338_10002735 | 3300028800 | Bacteria | 25878 |
| 306 | Ga0265338_10036441 | 3300028800 | Bacteria | 4707 |
| 307 | Ga0265324_10001061 | 3300029957 | Bacteria | 16598 |
| 308 | Ga0265330_10000001 | 3300031235 | Bacteria | 499696 |
| 309 | Ga0265332_10000007 | 3300031238 | Bacteria | 319429 |
| 310 | Ga0265332_10063026 | 3300031238 | Bacteria | 1584 |
| 311 | Ga0265328_10008901 | 3300031239 | Bacteria | 4113 |
| 312 | Ga0265320_10000304 | 3300031240 | Bacteria | 40158 |
| 313 | Ga0265320_10000511 | 3300031240 | Bacteria | 30140 |
| 314 | Ga0265320_10000682 | 3300031240 | Bacteria | 25880 |
| 315 | Ga0265320_10001147 | 3300031240 | Bacteria | 19490 |
| 316 | Ga0265320_10002071 | 3300031240 | Bacteria | 14122 |
| 317 | Ga0265320_10002105 | 3300031240 | Bacteria | 14006 |
| 318 | Ga0265320_10003936 | 3300031240 | Bacteria | 9806 |
| 319 | Ga0265320_10008287 | 3300031240 | Bacteria | 6366 |
| 320 | Ga0265320_10008727 | 3300031240 | Bacteria | 6174 |
| 321 | Ga0265320_10033755 | 3300031240 | Bacteria | 2610 |
| 322 | Ga0265320_10036942 | 3300031240 | Bacteria | 2465 |
| 323 | Ga0265320_10049699 | 3300031240 | Bacteria | 2041 |
| 324 | Ga0265329_10004657 | 3300031242 | Bacteria | 5654 |
| 325 | Ga0265329_10016286 | 3300031242 | Bacteria | 2579 |
| 326 | Ga0265329_10024339 | 3300031242 | Bacteria | 2011 |
| 327 | Ga0265331_10025085 | 3300031250 | Bacteria | 3011 |
| 328 | Ga0265331_10036277 | 3300031250 | Bacteria | 2421 |
| 329 | Ga0265327_10000114 | 3300031251 | Bacteria | 174833 |
| 330 | Ga0265327_10001137 | 3300031251 | Bacteria | 36464 |
| 331 | Ga0265327_10025786 | 3300031251 | Bacteria | 3418 |
| 332 | Ga0265316_10000291 | 3300031344 | Bacteria | 56572 |
| 333 | Ga0265316_10000593 | 3300031344 | Bacteria | 40526 |
| 334 | Ga0265316_10001810 | 3300031344 | Bacteria | 22497 |
| 335 | Ga0265316_10003908 | 3300031344 | Bacteria | 14933 |
| 336 | Ga0265316_10015070 | 3300031344 | Bacteria | 6775 |
| 337 | Ga0265316_10033247 | 3300031344 | Bacteria | 4202 |
| 338 | Ga0265316_10087113 | 3300031344 | Bacteria | 2386 |
| 339 | Ga0307408_100002995 | 3300031548 | Bacteria | 11686 |
| 340 | Ga0265313_10006399 | 3300031595 | Bacteria | 8348 |
| 341 | Ga0265313_10011901 | 3300031595 | Bacteria | 5369 |
| 342 | Ga0265313_10026378 | 3300031595 | Bacteria | 3061 |
| 343 | Ga0265313_10028223 | 3300031595 | Bacteria | 2921 |
| 344 | Ga0307508_10000160 | 3300031616 | Bacteria | 80743 |
| 345 | Ga0316575_10005725 | 3300031665 | Unclassified | 4439 |
| 346 | Ga0265314_10000004 | 3300031711 | Bacteria | 939480 |
| 347 | Ga0265314_10000902 | 3300031711 | Bacteria | 35158 |
| 348 | Ga0265314_10001000 | 3300031711 | Bacteria | 33137 |
| 349 | Ga0265314_10003110 | 3300031711 | Bacteria | 16330 |
| 350 | Ga0265314_10005470 | 3300031711 | Bacteria | 11453 |
| 351 | Ga0265314_10030165 | 3300031711 | Bacteria | 4017 |
| 352 | Ga0265342_10000020 | 3300031712 | Bacteria | 175977 |
| 353 | Ga0265342_10000042 | 3300031712 | Bacteria | 137664 |
| 354 | Ga0265342_10059793 | 3300031712 | Bacteria | 2250 |
| 355 | Ga0316576_10008515 | 3300031727 | Bacteria | 6550 |
| 356 | Ga0316576_10037778 | 3300031727 | Bacteria | 3459 |
| 357 | Ga0316576_10106006 | 3300031727 | Bacteria | 2104 |
| 358 | Ga0316578_10029417 | 3300031728 | Bacteria | 3118 |
| 359 | Ga0316578_10029436 | 3300031728 | Bacteria | 3117 |
| 360 | Ga0307405_10000014 | 3300031731 | Bacteria | 226733 |
| 361 | Ga0307405_10006917 | 3300031731 | Bacteria | 5628 |
| 362 | Ga0316577_10036979 | 3300031733 | Bacteria | 2731 |
| 363 | Ga0307413_10006943 | 3300031824 | Bacteria | 5214 |
| 364 | Ga0307413_10032434 | 3300031824 | Bacteria | 2961 |
| 365 | Ga0307410_10002168 | 3300031852 | Bacteria | 9328 |
| 366 | Ga0307406_10002693 | 3300031901 | Bacteria | 9682 |
| 367 | Ga0307406_10005012 | 3300031901 | Bacteria | 7218 |
| 368 | Ga0307407_10000002 | 3300031903 | Bacteria | 323084 |
| 369 | Ga0307412_10003708 | 3300031911 | Bacteria | 8482 |
| 370 | Ga0307409_100000873 | 3300031995 | Bacteria | 13949 |
| 371 | Ga0307409_100036744 | 3300031995 | Bacteria | 3604 |
| 372 | Ga0307416_100000005 | 3300032002 | Bacteria | 477728 |
| 373 | Ga0307416_100000883 | 3300032002 | Bacteria | 15809 |
| 374 | Ga0307414_10000441 | 3300032004 | Bacteria | 21996 |
| 375 | Ga0307414_10000599 | 3300032004 | Bacteria | 18579 |
| 376 | Ga0307414_10030533 | 3300032004 | Bacteria | 3522 |
| 377 | Ga0307414_10055678 | 3300032004 | Bacteria | 2770 |
| 378 | Ga0307414_10164362 | 3300032004 | Bacteria | 1767 |
| 379 | Ga0307414_10217265 | 3300032004 | Bacteria | 1567 |
| 380 | Ga0307411_10017694 | 3300032005 | Bacteria | 4070 |
| 381 | Ga0307411_10045463 | 3300032005 | Bacteria | 2824 |
| 382 | Ga0307415_100002422 | 3300032126 | Bacteria | 9302 |
| 383 | Ga0316583_10000117 | 3300032133 | Bacteria | 18503 |
| 384 | Ga0316583_10005110 | 3300032133 | Bacteria | 4700 |
| 385 | Ga0307510_10002118 | 3300033180 | Bacteria | 22455 |
| 386 | Ga0316588_1001852 | 3300033528 | Bacteria | 3583 |
| 387 | Ga0373959_0000121 | 3300034820 | Bacteria | 17060 |
| 388 | Ga0373926_0036902 | 3300035083 | Bacteria | 1738 |
| 389 | Ga0373939_0008876 | 3300035114 | Bacteria | 2477 |
| 390 | Ga0373954_0073054 | 3300035118 | Bacteria | 1632 |
| 391 | Ga0373957_0021278 | 3300035120 | Bacteria | 2301 |
| 392 | Ga0373943_0009008 | 3300035170 | Bacteria | 4474 |
| 393 | Ga0316574_0149023 | 3300035398 | Bacteria | 1508 |
| 394 | Ga0373931_0009139 | 3300035691 | Bacteria | 4730 |
| 395 | Ga0373927_0001839 | 3300035695 | Bacteria | 15763 |
| 396 | Ga0316582_0055447 | 3300036647 | Bacteria | 2526 |
| 397 | Ga0316582_0064276 | 3300036647 | Bacteria | 2360 |
| 398 | Ga0316584_0037073 | 3300036712 | Unclassified | 3621 |
| 399 | Ga0373925_0003109 | 3300037068 | Bacteria | 13025 |
| 400 | Ga0395899_0009991 | 3300037312 | Bacteria | 7279 |
| 401 | Ga0395899_0013861 | 3300037312 | Bacteria | 6158 |
| 402 | Ga0395900_0000288 | 3300037418 | Bacteria | 75715 |
| 403 | Ga0395900_0004910 | 3300037418 | Bacteria | 14077 |
| 404 | Ga0395900_0011864 | 3300037418 | Bacteria | 8913 |
| 405 | Ga0395900_0033960 | 3300037418 | Bacteria | 5250 |
| 406 | Ga0395900_0074201 | 3300037418 | Bacteria | 3498 |
| 407 | Ga0395898_0012362 | 3300037466 | Bacteria | 8829 |
| 408 | Ga0395905_0000015 | 3300037471 | Bacteria | 393880 |
| 409 | Ga0395905_0001824 | 3300037471 | Bacteria | 24610 |
| 410 | Ga0395905_0007495 | 3300037471 | Bacteria | 10856 |
| 411 | Ga0395905_0019020 | 3300037471 | Bacteria | 6513 |
| 412 | Ga0395905_0054874 | 3300037471 | Bacteria | 3729 |
| 413 | Ga0395905_0180647 | 3300037471 | Bacteria | 1981 |
| 414 | Ga0436364_0839671 | 3300037853 | Bacteria | 17835 |
| 415 | Ga0395901_0009188 | 3300038443 | Bacteria | 10015 |
| 416 | Ga0395901_0017502 | 3300038443 | Bacteria | 7314 |
| 417 | Ga0395901_0196798 | 3300038443 | Bacteria | 2113 |
| 418 | Ga0400489_96379 | 3300039093 | Bacteria | 5990 |
| 419 | Ga0436361_1222875 | 3300039447 | Bacteria | 13496 |
| 420 | Ga0451577_0000012 | 3300042876 | Bacteria | 575467 |
| 421 | Ga0451577_0000050 | 3300042876 | Bacteria | 301123 |
| 422 | Ga0451577_0000159 | 3300042876 | Bacteria | 148522 |
| 423 | Ga0451577_0000535 | 3300042876 | Bacteria | 62424 |
| 424 | Ga0451577_0101827 | 3300042876 | Bacteria | 2566 |
| 425 | Ga0451577_0199008 | 3300042876 | Bacteria | 1808 |
| 426 | Ga0466972_0002085 | 3300044658 | Bacteria | 9796 |
| 427 | Ga0453683_0000537 | 3300044673 | Bacteria | 42325 |
| 428 | Ga0453683_0001530 | 3300044673 | Bacteria | 19722 |
| 429 | Ga0453683_0006064 | 3300044673 | Bacteria | 8330 |
| 430 | Ga0453683_0018020 | 3300044673 | Bacteria | 4536 |
| 431 | Ga0466961_0002746 | 3300044693 | Bacteria | 10947 |
| 432 | Ga0466961_0006964 | 3300044693 | Bacteria | 7191 |
| 433 | Ga0466963_0160845 | 3300044694 | Bacteria | 1563 |
| 434 | Ga0453684_0000045 | 3300044712 | Bacteria | 582917 |
| 435 | Ga0453684_0000404 | 3300044712 | Bacteria | 177839 |
| 436 | Ga0453684_0004549 | 3300044712 | Bacteria | 29034 |
| 437 | Ga0453684_0009194 | 3300044712 | Bacteria | 17363 |
| 438 | Ga0453684_0011011 | 3300044712 | Bacteria | 15279 |
| 439 | Ga0453684_0020747 | 3300044712 | Bacteria | 9884 |
| 440 | Ga0453684_0025247 | 3300044712 | Bacteria | 8636 |
| 441 | Ga0453684_0038838 | 3300044712 | Bacteria | 6496 |
| 442 | Ga0453684_0042461 | 3300044712 | Bacteria | 6129 |
| 443 | Ga0453684_0045086 | 3300044712 | Bacteria | 5886 |
| 444 | Ga0453684_0074377 | 3300044712 | Unclassified | 4278 |
| 445 | Ga0453684_0083225 | 3300044712 | Bacteria | 3983 |
| 446 | Ga0453684_0089717 | 3300044712 | Bacteria | 3800 |
| 447 | Ga0453684_0095591 | 3300044712 | Bacteria | 3651 |
| 448 | Ga0453684_0130641 | 3300044712 | Bacteria | 3014 |
| 449 | Ga0453684_0253289 | 3300044712 | Unclassified | 2021 |
| 450 | Ga0466959_0003937 | 3300045049 | Bacteria | 9863 |
| 451 | Ga0451576_0000244 | 3300045051 | Bacteria | 133298 |
| 452 | Ga0451576_0000939 | 3300045051 | Bacteria | 54953 |
| 453 | Ga0451576_0001111 | 3300045051 | Bacteria | 49021 |
| 454 | Ga0451576_0002731 | 3300045051 | Bacteria | 25627 |
| 455 | Ga0451576_0003015 | 3300045051 | Bacteria | 23796 |
| 456 | Ga0451576_0011060 | 3300045051 | Bacteria | 10302 |
| 457 | Ga0451576_0042352 | 3300045051 | Bacteria | 4807 |
| 458 | Ga0451576_0054033 | 3300045051 | Bacteria | 4206 |
| 459 | Ga0451576_0085442 | 3300045051 | Bacteria | 3282 |
| 460 | Ga0451576_0097568 | 3300045051 | Bacteria | 3056 |
| 461 | Ga0495627_009190 | 3300046453 | Bacteria | 3647 |
| 462 | Ga0495592_0127573 | 3300046454 | Bacteria | 1783 |
| 463 | Ga0495603_0051928 | 3300046455 | Bacteria | 2435 |
| 464 | Ga0495582_0010050 | 3300046473 | Bacteria | 5209 |
| 465 | Ga0495639_0020073 | 3300046475 | Bacteria | 2919 |
| 466 | Ga0495610_0000204 | 3300046512 | Bacteria | 65887 |
| 467 | Ga0495610_0000279 | 3300046512 | Bacteria | 53150 |
| 468 | Ga0495618_0079719 | 3300046514 | Bacteria | 2089 |
| 469 | Ga0495628_0032791 | 3300046516 | Bacteria | 4190 |
| 470 | Ga0495630_0020425 | 3300046517 | Bacteria | 4884 |
| 471 | Ga0495631_0012861 | 3300046518 | Bacteria | 4076 |
| 472 | Ga0495637_0008596 | 3300046520 | Bacteria | 5011 |
| 473 | Ga0495643_0000008 | 3300046522 | Bacteria | 367010 |
| 474 | Ga0495640_0037262 | 3300046533 | Bacteria | 3431 |
| 475 | Ga0495587_0001600 | 3300046536 | Bacteria | 15066 |
| 476 | Ga0495609_0010103 | 3300046538 | Bacteria | 4541 |
| 477 | Ga0495645_0000867 | 3300046543 | Bacteria | 20621 |
| 478 | Ga0495645_0079323 | 3300046543 | Bacteria | 2358 |
| 479 | Ga0495657_0042941 | 3300046675 | Bacteria | 3084 |
| 480 | Ga0495599_0007492 | 3300046678 | Bacteria | 6617 |
| 481 | Ga0495623_0066645 | 3300046679 | Bacteria | 2249 |
| 482 | Ga0495623_0070843 | 3300046679 | Bacteria | 2171 |
| 483 | Ga0495658_0000860 | 3300046683 | Bacteria | 16338 |
| 484 | Ga0495658_0072222 | 3300046683 | Bacteria | 2007 |
| 485 | Ga0495613_0011460 | 3300046689 | Bacteria | 6592 |
| 486 | Ga0495649_0038454 | 3300046694 | Bacteria | 2625 |
| 487 | Ga0495600_0149492 | 3300046809 | Bacteria | 1513 |
| 488 | Ga0495604_0138469 | 3300047317 | Bacteria | 1742 |
| 489 | Ga0495604_0150433 | 3300047317 | Bacteria | 1655 |
| 490 | Ga0495674_0094823 | 3300047319 | Bacteria | 2545 |
| 491 | Ga0495680_0026573 | 3300047322 | Bacteria | 4769 |
| 492 | Ga0495683_0011040 | 3300047323 | Bacteria | 4764 |
| 493 | Ga0495687_000846 | 3300047443 | Bacteria | 32608 |
| 494 | Ga0495675_0004167 | 3300047444 | Bacteria | 8747 |
| 495 | Ga0495675_0040387 | 3300047444 | Bacteria | 2973 |
| 496 | Ga0495681_0059871 | 3300047470 | Bacteria | 1759 |
| 497 | Ga0495684_0036329 | 3300047471 | Bacteria | 3778 |
| 498 | Ga0495684_0078398 | 3300047471 | Bacteria | 2507 |
| 499 | Ga0495602_0050021 | 3300048088 | Bacteria | 3738 |
| 500 | Ga0496114_0129403 | 3300048917 | Bacteria | 2179 |
| 501 | Ga0496115_0063732 | 3300048918 | Bacteria | 2974 |
| 502 | Ga0496122_0001886 | 3300048925 | Bacteria | 31745 |
| 503 | Ga0496123_0001009 | 3300048926 | Bacteria | 43009 |
| 504 | Ga0496125_0039297 | 3300048928 | Bacteria | 4077 |
| 505 | Ga0501300_001025 | 3300049523 | Bacteria | 4280 |
| 506 | Ga0501031_0004307 | 3300049568 | Bacteria | 9209 |
| 507 | Ga0501031_0023432 | 3300049568 | Bacteria | 4024 |
| 508 | Ga0501031_0038101 | 3300049568 | Bacteria | 3138 |
| 509 | Ga0501031_0044989 | 3300049568 | Bacteria | 2880 |
| 510 | Ga0501032_0001732 | 3300049569 | Bacteria | 17254 |
| 511 | Ga0501032_0004297 | 3300049569 | Bacteria | 10756 |
| 512 | Ga0501032_0043891 | 3300049569 | Bacteria | 3027 |
| 513 | Ga0501032_0050388 | 3300049569 | Bacteria | 2808 |
| 514 | Ga0501033_0002253 | 3300049570 | Bacteria | 16524 |
| 515 | Ga0501033_0008553 | 3300049570 | Bacteria | 7918 |
| 516 | Ga0501033_0012666 | 3300049570 | Bacteria | 6433 |
| 517 | Ga0501033_0211596 | 3300049570 | Bacteria | 1382 |
| 518 | Ga0501034_0000125 | 3300049571 | Bacteria | 142404 |
| 519 | Ga0501034_0037200 | 3300049571 | Bacteria | 4928 |
| 520 | Ga0501034_0040028 | 3300049571 | Bacteria | 4746 |
| 521 | Ga0501036_0000962 | 3300049572 | Bacteria | 21725 |
| 522 | Ga0501036_0003927 | 3300049572 | Bacteria | 11943 |
| 523 | Ga0501036_0056961 | 3300049572 | Bacteria | 3311 |
| 524 | Ga0501037_0003185 | 3300049573 | Bacteria | 11910 |
| 525 | Ga0501037_0057278 | 3300049573 | Bacteria | 2845 |
| 526 | Ga0501038_0014653 | 3300049574 | Bacteria | 7145 |
| 527 | Ga0501038_0030360 | 3300049574 | Bacteria | 4784 |
| 528 | Ga0501038_0034137 | 3300049574 | Bacteria | 4475 |
| 529 | Ga0501039_0005683 | 3300049575 | Bacteria | 9446 |
| 530 | Ga0501039_0016007 | 3300049575 | Bacteria | 5743 |
| 531 | Ga0501039_0068102 | 3300049575 | Bacteria | 2764 |
| 532 | Ga0501040_0001497 | 3300049576 | Bacteria | 14819 |
| 533 | Ga0501040_0001628 | 3300049576 | Bacteria | 14311 |
| 534 | Ga0501040_0007040 | 3300049576 | Bacteria | 7289 |
| 535 | Ga0501040_0050329 | 3300049576 | Bacteria | 2850 |
| 536 | Ga0501040_0062930 | 3300049576 | Bacteria | 2552 |
| 537 | Ga0501041_0007461 | 3300049577 | Bacteria | 6420 |
| 538 | Ga0501041_0049065 | 3300049577 | Bacteria | 2571 |
| 539 | Ga0501042_0001740 | 3300049578 | Bacteria | 13019 |
| 540 | Ga0501042_0004659 | 3300049578 | Bacteria | 8754 |
| 541 | Ga0501043_0010753 | 3300049579 | Bacteria | 7167 |
| 542 | Ga0501046_0005050 | 3300049580 | Bacteria | 11831 |
| 543 | Ga0501046_0016304 | 3300049580 | Bacteria | 6226 |
| 544 | Ga0501046_0087211 | 3300049580 | Bacteria | 2405 |
| 545 | Ga0501046_0199467 | 3300049580 | Bacteria | 1489 |
| 546 | Ga0501047_0002621 | 3300049581 | Bacteria | 17112 |
| 547 | Ga0501047_0007049 | 3300049581 | Bacteria | 10552 |
| 548 | Ga0501047_0007086 | 3300049581 | Bacteria | 10525 |
| 549 | Ga0501047_0019296 | 3300049581 | Bacteria | 6541 |
| 550 | Ga0501048_0001530 | 3300049582 | Bacteria | 17531 |
| 551 | Ga0501048_0004838 | 3300049582 | Bacteria | 10263 |
| 552 | Ga0501048_0049015 | 3300049582 | Bacteria | 3011 |
| 553 | Ga0501048_0111361 | 3300049582 | Bacteria | 1933 |
| 554 | Ga0501067_0056436 | 3300049583 | Bacteria | 2175 |
| 555 | Ga0501068_0011386 | 3300049584 | Bacteria | 5022 |
| 556 | Ga0501068_0015491 | 3300049584 | Bacteria | 4380 |
| 557 | Ga0501070_0062007 | 3300049586 | Bacteria | 3097 |
| 558 | Ga0501070_0230605 | 3300049586 | Bacteria | 1517 |
| 559 | Ga0501071_0000248 | 3300049587 | Bacteria | 25026 |
| 560 | Ga0501071_0003304 | 3300049587 | Bacteria | 10077 |
| 561 | Ga0501071_0017385 | 3300049587 | Bacteria | 4959 |
| 562 | Ga0501071_0048720 | 3300049587 | Bacteria | 3048 |
| 563 | Ga0501072_0000230 | 3300049588 | Bacteria | 41301 |
| 564 | Ga0501072_0000583 | 3300049588 | Bacteria | 26327 |
| 565 | Ga0501072_0025684 | 3300049588 | Bacteria | 4589 |
| 566 | Ga0501072_0036554 | 3300049588 | Bacteria | 3850 |
| 567 | Ga0501072_0037771 | 3300049588 | Bacteria | 3788 |
| 568 | Ga0501073_0053398 | 3300049589 | Bacteria | 2829 |
| 569 | Ga0501074_0003576 | 3300049590 | Bacteria | 11024 |
| 570 | Ga0501074_0011788 | 3300049590 | Bacteria | 6355 |
| 571 | Ga0501074_0021501 | 3300049590 | Bacteria | 4684 |
| 572 | Ga0501074_0115455 | 3300049590 | Bacteria | 1921 |
| 573 | Ga0501075_0000921 | 3300049591 | Bacteria | 18662 |
| 574 | Ga0501075_0003162 | 3300049591 | Bacteria | 11022 |
| 575 | Ga0501075_0047279 | 3300049591 | Bacteria | 3234 |
| 576 | Ga0501075_0212763 | 3300049591 | Bacteria | 1474 |
| 577 | Ga0501076_0002914 | 3300049592 | Bacteria | 11857 |
| 578 | Ga0501076_0012610 | 3300049592 | Bacteria | 6323 |
| 579 | Ga0501076_0037552 | 3300049592 | Bacteria | 3799 |
| 580 | Ga0501076_0056271 | 3300049592 | Bacteria | 3121 |
| 581 | Ga0501077_0000967 | 3300049593 | Bacteria | 17317 |
| 582 | Ga0501077_0008584 | 3300049593 | Bacteria | 6334 |
| 583 | Ga0501077_0032762 | 3300049593 | Bacteria | 3309 |
| 584 | Ga0501079_0001980 | 3300049741 | Bacteria | 14676 |
| 585 | Ga0501079_0008321 | 3300049741 | Bacteria | 7861 |
| 586 | Ga0501079_0009574 | 3300049741 | Bacteria | 7346 |
| 587 | Ga0501079_0024226 | 3300049741 | Bacteria | 4658 |
| 588 | Ga0501079_0028692 | 3300049741 | Bacteria | 4271 |
| 589 | Ga0501079_0178677 | 3300049741 | Bacteria | 1656 |
| 590 | Ga0501079_0204989 | 3300049741 | Bacteria | 1540 |
| 591 | Ga0501080_0012626 | 3300049742 | Bacteria | 7745 |
| 592 | Ga0501080_0027017 | 3300049742 | Bacteria | 5336 |
| 593 | Ga0501080_0046318 | 3300049742 | Bacteria | 4049 |
| 594 | Ga0501080_0168914 | 3300049742 | Bacteria | 2018 |
| 595 | Ga0501081_0004544 | 3300049743 | Bacteria | 8908 |
| 596 | Ga0501081_0017611 | 3300049743 | Bacteria | 4733 |
| 597 | Ga0501081_0027229 | 3300049743 | Bacteria | 3857 |
| 598 | Ga0501083_0004940 | 3300049744 | Bacteria | 9441 |
| 599 | Ga0501083_0009550 | 3300049744 | Bacteria | 6853 |
| 600 | Ga0501035_0000808 | 3300049822 | Bacteria | 33357 |
| 601 | Ga0501035_0003769 | 3300049822 | Bacteria | 14445 |
| 602 | Ga0501035_0027792 | 3300049822 | Bacteria | 5170 |
| 603 | Ga0501044_0000948 | 3300049823 | Bacteria | 34820 |
| 604 | Ga0501044_0003677 | 3300049823 | Bacteria | 17243 |
| 605 | Ga0501044_0005909 | 3300049823 | Bacteria | 13556 |
| 606 | Ga0501044_0044898 | 3300049823 | Bacteria | 4582 |
| 607 | Ga0501044_0045662 | 3300049823 | Bacteria | 4538 |
| 608 | Ga0501044_0181226 | 3300049823 | Bacteria | 2073 |
| 609 | Ga0501045_0058154 | 3300049824 | Bacteria | 2830 |
| 610 | Ga0501045_0130871 | 3300049824 | Bacteria | 1865 |
| 611 | Ga0501045_0168445 | 3300049824 | Bacteria | 1632 |
| 612 | nmdc:mga05p37_67250_c1 | 3300050507 | Bacteria | 4408 |
| 613 | nmdc:mga05p37_80195_c1 | 3300050507 | Bacteria | 4020 |
| 614 | nmdc:mga09592_40450_c1 | 3300050508 | Bacteria | 3916 |
| 615 | nmdc:mga0qj67_19765_c1 | 3300050509 | Bacteria | 5151 |
| 616 | nmdc:mga0qj67_228842_c1 | 3300050509 | Bacteria | 1509 |
| 617 | nmdc:mga0qj67_77631_c1 | 3300050509 | Bacteria | 2657 |
| 618 | nmdc:mga0qj67_9943_c1 | 3300050509 | Bacteria | 7094 |
| 619 | nmdc:mga06r32_214693_c1 | 3300050510 | Bacteria | 1912 |
| 620 | nmdc:mga06r32_3015_c1 | 3300050510 | Bacteria | 15088 |
| 621 | nmdc:mga08y16_100926_c1 | 3300050511 | Bacteria | 3004 |
| 622 | nmdc:mga08y16_178166_c1 | 3300050511 | Bacteria | 2208 |
| 623 | nmdc:mga08y16_189096_c1 | 3300050511 | Bacteria | 2136 |
| 624 | nmdc:mga08y16_54753_c1 | 3300050511 | Bacteria | 4169 |
| 625 | nmdc:mga08y16_56061_c1 | 3300050511 | Bacteria | 4119 |
| 626 | nmdc:mga08y16_9329_c1 | 3300050511 | Bacteria | 10290 |
| 627 | nmdc:mga0n895_5273_c1 | 3300050512 | Bacteria | 10764 |
| 628 | nmdc:mga0n895_7562_c1 | 3300050512 | Bacteria | 9338 |
| 629 | nmdc:mga0rr50_128421_c1 | 3300050513 | Bacteria | 2026 |
| 630 | nmdc:mga0a205_205925_c1 | 3300050515 | Bacteria | 1856 |
| 631 | nmdc:mga0a205_35_c2 | 3300050515 | Bacteria | 29549 |
| 632 | nmdc:mga0a205_43268_c1 | 3300050515 | Bacteria | 4343 |
| 633 | nmdc:mga0a205_89145_c1 | 3300050515 | Bacteria | 2982 |
| 634 | Ga0495619_0028219 | 3300053085 | Bacteria | 3620 |
| 635 | Ga0500608_000658 | 3300053122 | Bacteria | 12674 |
| 636 | Ga0500608_001920 | 3300053122 | Bacteria | 7424 |
| 637 | Ga0500628_000545 | 3300053129 | Bacteria | 6913 |
| 638 | Ga0501084_0001875 | 3300054114 | Bacteria | 16748 |
| 639 | Ga0501084_0020561 | 3300054114 | Bacteria | 5504 |
| 640 | Ga0501084_0156114 | 3300054114 | Bacteria | 1924 |
| 641 | Ga0501082_0005720 | 3300060353 | Bacteria | 10783 |
| 642 | Ga0501082_0012335 | 3300060353 | Bacteria | 7347 |
| 643 | Ga0530510_0004515 | 3300061734 | Bacteria | 9636 |
| 644 | Ga0530510_0017071 | 3300061734 | Bacteria | 5140 |
| 645 | Ga0530510_0023788 | 3300061734 | Bacteria | 4367 |
| 646 | Ga0530510_0025855 | 3300061734 | Bacteria | 4198 |
| 647 | Ga0530510_0060517 | 3300061734 | Bacteria | 2741 |
| 648 | 2524004523 | 2523533629 | Bacteria | 2982326 |
| 649 | 2586207043 | 2585427687 | Bacteria | 5544917 |
| 650 | 2715500935 | 2713897090 | Bacteria | 3353799 |
| 651 | 2738701873 | 2738541273 | Bacteria | 4048577 |
| 652 | 2738755728 | 2738541283 | Bacteria | 7222293 |
| 653 | 2738761611 | 2738541284 | Bacteria | 5199923 |
| 654 | 2738852680 | 2738541302 | Bacteria | 5944758 |
| 655 | 2739256171 | 2738543014 | Bacteria | 4048139 |
| 656 | 2739305349 | 2738543023 | Bacteria | 6767879 |
| 657 | 2739586610 | 2739367651 | Bacteria | 6359826 |
| 658 | 2739614937 | 2739367656 | Bacteria | 5152243 |
| 659 | 2739645965 | 2739367663 | Bacteria | 5040914 |
| 660 | 2740033220 | 2739367866 | Bacteria | 4215900 |
| 661 | 2776615752 | 2775506987 | Bacteria | 5373360 |
| 662 | 2819549782 | 2818991437 | Bacteria | 5805520 |
| 663 | 2834579088 | 2834578030 | Bacteria | 3530182 |
| 664 | 2839991137 | 2839989709 | Bacteria | 3773432 |
| 665 | 2840882349 | 2840878972 | Bacteria | 5483153 |
| 666 | 2842727208 | 2842722452 | Bacteria | 6263924 |
| 667 | 2842910788 | 2842909656 | Bacteria | 6185908 |
| 668 | 2849286682 | 2849281842 | Bacteria | 6065644 |
| 669 | 2852627963 | 2852627209 | Bacteria | 5896285 |
| 670 | 2854685153 | 2854681122 | Bacteria | 4548679 |
| 671 | 2855022687 | 2855020534 | Bacteria | 3204685 |
| 672 | 2857628109 | 2857627736 | Bacteria | 5625397 |
| 673 | 2884636872 | 2884634485 | Bacteria | 3928637 |
| 674 | 2890807524 | 2890804823 | Bacteria | 3717572 |
| 675 | 2898796920 | 2898795034 | Bacteria | 4294459 |
| 676 | 2899259981 | 2899259804 | Bacteria | 3320927 |
| 677 | 2899276189 | 2899275550 | Bacteria | 3958688 |
| 678 | 2902050483 | 2902048731 | Bacteria | 4976191 |
| 679 | 2904447090 | 2904445276 | Bacteria | 5310396 |
| 680 | 2910248264 | 2910245624 | Bacteria | 6935613 |
| 681 | 2919190938 | 2919186247 | Bacteria | 6244071 |
| 682 | 2919679456 | 2919679072 | Bacteria | 4629602 |
| 683 | 2939668852 | 2939664404 | Bacteria | 6364494 |
| 684 | 2945998119 | 2945997725 | Bacteria | 6404843 |
| 685 | 2954020564 | 2954016120 | Bacteria | 6446024 |
| 686 | 3000019812 | 3000017691 | Bacteria | 3772574 |
| 687 | 3000406685 | 3000405567 | Bacteria | 3779330 |
| 688 | 8057134980 | 8057132660 | Bacteria | 4061191 |
| 689 | Ga0157374_10007611 | |||
| 690 | JGI24740J21852_10007018 | |||
| 691 | JGI25152J39213_1000028 | |||
| 692 | JGI25150J39212_1000006 | |||
| 693 | JGI25151J46595_10000024 | |||
| 694 | JGI25153J46596_10000026 | |||
| 695 | rootH2_10000579 | |||
| 696 | rootH2_10061209 | |||
| 697 | Ga0055536_1000002 | |||
| 698 | Ga0055530_10003410 | |||
| 699 | Ga0058862_10098900 | |||
| 700 | Ga0065714_10064473 | |||
| 701 | Ga0065714_10090708 | |||
| 702 | Ga0065707_10172506 | |||
| 703 | Ga0070658_10000032 | |||
| 704 | Ga0070658_10013890 | |||
| 705 | Ga0070658_10047350 | |||
| 706 | Ga0070676_10005347 | |||
| 707 | Ga0070676_10005364 | |||
| 708 | Ga0070676_10026068 | |||
| 709 | Ga0070676_10037693 | |||
| 710 | Ga0070683_100000678 | |||
| 711 | Ga0070683_100008171 | |||
| 712 | Ga0070683_100056033 | |||
| 713 | Ga0070683_100094279 | |||
| 714 | Ga0070690_100103228 | |||
| 715 | Ga0070670_100013603 | |||
| 716 | Ga0070670_100056181 | |||
| 717 | Ga0070670_100170075 | |||
| 718 | Ga0070677_10025567 | |||
| 719 | Ga0068869_100028810 | |||
| 720 | Ga0070666_10053135 | |||
| 721 | Ga0070660_100008762 | |||
| 722 | Ga0070687_100027438 | |||
| 723 | Ga0070668_100231260 | |||
| 724 | Ga0070669_100002402 | |||
| 725 | Ga0070675_100038100 | |||
| 726 | Ga0070674_100025138 | |||
| 727 | Ga0070673_100079694 | |||
| 728 | Ga0070659_100051470 | |||
| 729 | Ga0070659_100100132 | |||
| 730 | Ga0070667_100037119 | |||
| 731 | Ga0070714_100000352 | |||
| 732 | Ga0070713_100046337 | |||
| 733 | Ga0070713_100088940 | |||
| 734 | Ga0070701_10045340 | |||
| 735 | Ga0070700_100109521 | |||
| 736 | Ga0070708_100000006 | |||
| 737 | Ga0070708_100000177 | |||
| 738 | Ga0070678_100157271 | |||
| 739 | Ga0070662_100007268 | |||
| 740 | Ga0070681_10007157 | |||
| 741 | Ga0070681_10264003 | |||
| 742 | Ga0070685_10001251 | |||
| 743 | Ga0070707_100000323 | |||
| 744 | Ga0070698_100000023 | |||
| 745 | Ga0070699_100000898 | |||
| 746 | Ga0070699_100046296 | |||
| 747 | Ga0070679_100030130 | |||
| 748 | Ga0070684_100019725 | |||
| 749 | Ga0070684_100073699 | |||
| 750 | Ga0068853_100009198 | |||
| 751 | Ga0068853_100026595 | |||
| 752 | Ga0068853_100111079 | |||
| 753 | Ga0070672_100016467 | |||
| 754 | Ga0070686_100000094 | |||
| 755 | Ga0070686_100050638 | |||
| 756 | Ga0070696_100000338 | |||
| 757 | Ga0070665_100000017 | |||
| 758 | Ga0070665_100000085 | |||
| 759 | Ga0070665_100022999 | |||
| 760 | Ga0070665_100052652 | |||
| 761 | Ga0068855_100000160 | |||
| 762 | Ga0068855_100007970 | |||
| 763 | Ga0068855_100008413 | |||
| 764 | Ga0068855_100018649 | |||
| 765 | Ga0070664_100038060 | |||
| 766 | Ga0070664_100127507 | |||
| 767 | Ga0068857_100013351 | |||
| 768 | Ga0068857_100028953 | |||
| 769 | Ga0068856_100000040 | |||
| 770 | Ga0068856_100008477 | |||
| 771 | Ga0068856_100023288 | |||
| 772 | Ga0068856_100031691 | |||
| 773 | Ga0068856_100109161 | |||
| 774 | Ga0068856_100282143 | |||
| 775 | Ga0068852_100020039 | |||
| 776 | Ga0068861_100003233 | |||
| 777 | Ga0068861_100036848 | |||
| 778 | Ga0068870_10007862 | |||
| 779 | Ga0068863_100047224 | |||
| 780 | Ga0068860_100013399 | |||
| 781 | Ga0068862_100000816 | |||
| 782 | Ga0068862_100024532 | |||
| 783 | Ga0068862_100327363 | |||
| 784 | Ga0081539_10019249 | |||
| 785 | Ga0070717_10000084 | |||
| 786 | Ga0070712_100017385 | |||
| 787 | Ga0068871_100000382 | |||
| 788 | Ga0075430_100008907 | |||
| 789 | Ga0075430_100015329 | |||
| 790 | Ga0075430_100018374 | |||
| 791 | Ga0075430_100135677 | |||
| 792 | Ga0075431_100013349 | |||
| 793 | Ga0075431_100017458 | |||
| 794 | Ga0075431_100048818 | |||
| 795 | Ga0075431_100087293 | |||
| 796 | Ga0075431_100150486 | |||
| 797 | Ga0075433_10000533 | |||
| 798 | Ga0075433_10060459 | |||
| 799 | Ga0075434_100001317 | |||
| 800 | Ga0075434_100005508 | |||
| 801 | Ga0075429_100048238 | |||
| 802 | Ga0068865_100004489 | |||
| 803 | Ga0075436_100017159 | |||
| 804 | Ga0105244_10010375 | |||
| 805 | Ga0105240_10016685 | |||
| 806 | Ga0111539_10012706 | |||
| 807 | Ga0111539_10013153 | |||
| 808 | Ga0111539_10021338 | |||
| 809 | Ga0111539_10030738 | |||
| 810 | Ga0111539_10109609 | |||
| 811 | Ga0111539_10184298 | |||
| 812 | Ga0111539_10428618 | |||
| 813 | Ga0114129_10007312 | |||
| 814 | Ga0114129_10073643 | |||
| 815 | Ga0105241_10000284 | |||
| 816 | Ga0105248_10006266 | |||
| 817 | Ga0105248_10006299 | |||
| 818 | Ga0105248_10216547 | |||
| 819 | Ga0105237_10000497 | |||
| 820 | Ga0105237_10044274 | |||
| 821 | Ga0105237_10090052 | |||
| 822 | Ga0105238_10000452 | |||
| 823 | Ga0105238_10020458 | |||
| 824 | Ga0105249_10000166 | |||
| 825 | Ga0105249_10002969 | |||
| 826 | Ga0105239_10013533 | |||
| 827 | Ga0105239_10017629 | |||
| 828 | Ga0105239_10059127 | |||
| 829 | Ga0105239_10083011 | |||
| 830 | Ga0105239_10281424 | |||
| 831 | Ga0157373_10005516 | |||
| 832 | Ga0157371_10000224 | |||
| 833 | Ga0157371_10027966 | |||
| 834 | Ga0157371_10086807 | |||
| 835 | Ga0157370_10001274 | |||
| 836 | Ga0157370_10002047 | |||
| 837 | Ga0157370_10002077 | |||
| 838 | Ga0157370_10006655 | |||
| 839 | Ga0157370_10014902 | |||
| 840 | Ga0157369_10000158 | |||
| 841 | Ga0157369_10011744 | |||
| 842 | Ga0157369_10114883 | |||
| 843 | Ga0157374_10000122 | |||
| 844 | Ga0157374_10253070 | |||
| 845 | Ga0157378_10010983 | |||
| 846 | Ga0157378_10028316 | |||
| 847 | Ga0163162_10000011 | |||
| 848 | Ga0163162_10000071 | |||
| 849 | Ga0163162_10013519 | |||
| 850 | Ga0157372_10073863 | |||
| 851 | Ga0157375_10022874 | |||
| 852 | Ga0157375_10026864 | |||
| 853 | Ga0157375_10130502 | |||
| 854 | Ga0157375_10196582 | |||
| 855 | Ga0163163_10002326 | |||
| 856 | Ga0157380_10000103 | |||
| 857 | Ga0157380_10010252 | |||
| 858 | Ga0157380_10024213 | |||
| 859 | Ga0182008_10000046 | |||
| 860 | Ga0182008_10000099 | |||
| 861 | Ga0157379_10045293 | |||
| 862 | Ga0182006_1000241 | |||
| 863 | Ga0182006_1000397 | |||
| 864 | Ga0182006_1000513 | |||
| 865 | Ga0182007_10000008 | |||
| 866 | Ga0183373_1002 | |||
| 867 | Ga0163161_10000570 | |||
| 868 | Ga0163161_10000650 | |||
| 869 | Ga0163161_10003225 | |||
| 870 | Ga0206349_1723532 | |||
| 871 | Ga0206352_10291344 | |||
| 872 | Ga0206350_10549468 | |||
| 873 | Ga0213872_10015603 | |||
| 874 | Ga0213875_10010425 | |||
| 875 | Ga0207425_1000003 | |||
| 876 | Ga0209129_1000022 | |||
| 877 | Ga0209676_1000022 | |||
| 878 | Ga0209025_1000007 | |||
| 879 | Ga0209758_1000012 | |||
| 880 | Ga0209050_1000020 | |||
| 881 | Ga0207697_10002866 | |||
| 882 | Ga0207682_10043921 | |||
| 883 | Ga0207642_10058278 | |||
| 884 | Ga0207688_10010308 | |||
| 885 | Ga0207680_10104428 | |||
| 886 | Ga0207647_10000146 | |||
| 887 | Ga0207645_10000304 | |||
| 888 | Ga0207645_10000502 | |||
| 889 | Ga0207645_10036411 | |||
| 890 | Ga0207645_10043536 | |||
| 891 | Ga0207643_10003500 | |||
| 892 | Ga0207705_10000032 | |||
| 893 | Ga0207654_10000684 | |||
| 894 | Ga0207707_10004096 | |||
| 895 | Ga0207707_10006769 | |||
| 896 | Ga0207671_10001098 | |||
| 897 | Ga0207671_10001288 | |||
| 898 | Ga0207671_10155922 | |||
| 899 | Ga0207693_10043786 | |||
| 900 | Ga0207663_10090519 | |||
| 901 | Ga0207660_10000714 | |||
| 902 | Ga0207660_10033058 | |||
| 903 | Ga0207660_10075106 | |||
| 904 | Ga0207662_10035778 | |||
| 905 | Ga0207662_10039955 | |||
| 906 | Ga0207657_10032892 | |||
| 907 | Ga0207649_10014982 | |||
| 908 | Ga0207652_10037605 | |||
| 909 | Ga0207646_10001934 | |||
| 910 | Ga0207681_10005448 | |||
| 911 | Ga0207681_10028802 | |||
| 912 | Ga0207694_10000117 | |||
| 913 | Ga0207650_10016028 | |||
| 914 | Ga0207650_10043828 | |||
| 915 | Ga0207650_10153962 | |||
| 916 | Ga0207659_10040943 | |||
| 917 | Ga0207659_10173737 | |||
| 918 | Ga0207700_10075577 | |||
| 919 | Ga0207664_10000005 | |||
| 920 | Ga0207690_10006656 | |||
| 921 | Ga0207706_10000007 | |||
| 922 | Ga0207706_10000174 | |||
| 923 | Ga0207706_10000821 | |||
| 924 | Ga0207706_10045859 | |||
| 925 | Ga0207704_10000033 | |||
| 926 | Ga0207704_10080904 | |||
| 927 | Ga0207691_10006208 | |||
| 928 | Ga0207691_10023738 | |||
| 929 | Ga0207691_10025991 | |||
| 930 | Ga0207689_10003328 | |||
| 931 | Ga0207661_10016044 | |||
| 932 | Ga0207661_10027436 | |||
| 933 | Ga0207679_10001218 | |||
| 934 | Ga0207679_10009529 | |||
| 935 | Ga0207679_10020967 | |||
| 936 | Ga0207679_10094924 | |||
| 937 | Ga0207667_10000033 | |||
| 938 | Ga0207667_10025332 | |||
| 939 | Ga0207667_10045540 | |||
| 940 | Ga0207667_10056302 | |||
| 941 | Ga0207667_10110825 | |||
| 942 | Ga0207651_10038232 | |||
| 943 | Ga0207712_10000257 | |||
| 944 | Ga0207712_10006684 | |||
| 945 | Ga0207677_10003937 | |||
| 946 | Ga0207639_10086583 | |||
| 947 | Ga0207708_10091826 | |||
| 948 | Ga0207702_10000042 | |||
| 949 | Ga0207702_10010102 | |||
| 950 | Ga0207702_10084036 | |||
| 951 | Ga0207702_10149566 | |||
| 952 | Ga0207641_10071132 | |||
| 953 | Ga0207641_10194265 | |||
| 954 | Ga0207648_10000495 | |||
| 955 | Ga0207648_10044580 | |||
| 956 | Ga0207648_10123276 | |||
| 957 | Ga0207676_10028692 | |||
| 958 | Ga0207674_10001814 | |||
| 959 | Ga0207674_10008367 | |||
| 960 | Ga0207674_10011989 | |||
| 961 | Ga0207675_100000030 | |||
| 962 | Ga0207675_100004281 | |||
| 963 | Ga0207683_10001591 | |||
| 964 | Ga0207683_10064442 | |||
| 965 | Ga0207698_10051132 | |||
| 966 | Ga0209968_1002393 | |||
| 967 | Ga0209999_1004753 | |||
| 968 | Ga0209966_1001538 | |||
| 969 | Ga0207428_10003182 | |||
| 970 | Ga0207428_10049835 | |||
| 971 | Ga0207428_10197151 | |||
| 972 | Ga0268266_10000145 | |||
| 973 | Ga0268266_10000195 | |||
| 974 | Ga0268266_10016684 | |||
| 975 | Ga0268265_10000382 | |||
| 976 | Ga0268265_10081232 | |||
| 977 | Ga0268264_10042033 | |||
| 978 | Ga0265337_1006271 | |||
| 979 | Ga0265319_1000031 | |||
| 980 | Ga0265319_1002158 | |||
| 981 | Ga0265319_1007126 | |||
| 982 | Ga0265319_1013305 | |||
| 983 | Ga0265319_1013667 | |||
| 984 | Ga0265319_1015906 | |||
| 985 | Ga0265334_10028650 | |||
| 986 | Ga0265318_10000047 | |||
| 987 | Ga0265323_10021619 | |||
| 988 | Ga0265322_10005620 | |||
| 989 | Ga0265336_10000203 | |||
| 990 | Ga0265336_10011799 | |||
| 991 | Ga0307517_10000335 | |||
| 992 | Ga0307515_10133555 | |||
| 993 | Ga0265338_10002735 | |||
| 994 | Ga0265338_10036441 | |||
| 995 | Ga0265324_10001061 | |||
| 996 | Ga0265330_10000001 | |||
| 997 | Ga0265332_10000007 | |||
| 998 | Ga0265332_10063026 | |||
| 999 | Ga0265328_10008901 | |||
| 1000 | Ga0265320_10000304 | |||
| 1001 | Ga0265320_10000511 | |||
| 1002 | Ga0265320_10000682 | |||
| 1003 | Ga0265320_10001147 | |||
| 1004 | Ga0265320_10002071 | |||
| 1005 | Ga0265320_10002105 | |||
| 1006 | Ga0265320_10003936 | |||
| 1007 | Ga0265320_10008287 | |||
| 1008 | Ga0265320_10008727 | |||
| 1009 | Ga0265320_10033755 | |||
| 1010 | Ga0265320_10036942 | |||
| 1011 | Ga0265320_10049699 | |||
| 1012 | Ga0265329_10004657 | |||
| 1013 | Ga0265329_10016286 | |||
| 1014 | Ga0265329_10024339 | |||
| 1015 | Ga0265331_10025085 | |||
| 1016 | Ga0265331_10036277 | |||
| 1017 | Ga0265327_10000114 | |||
| 1018 | Ga0265327_10001137 | |||
| 1019 | Ga0265327_10025786 | |||
| 1020 | Ga0265316_10000291 | |||
| 1021 | Ga0265316_10000593 | |||
| 1022 | Ga0265316_10001810 | |||
| 1023 | Ga0265316_10003908 | |||
| 1024 | Ga0265316_10015070 | |||
| 1025 | Ga0265316_10033247 | |||
| 1026 | Ga0265316_10087113 | |||
| 1027 | Ga0307408_100002995 | |||
| 1028 | Ga0265313_10006399 | |||
| 1029 | Ga0265313_10011901 | |||
| 1030 | Ga0265313_10026378 | |||
| 1031 | Ga0265313_10028223 | |||
| 1032 | Ga0307508_10000160 | |||
| 1033 | Ga0316575_10005725 | |||
| 1034 | Ga0265314_10000004 | |||
| 1035 | Ga0265314_10000902 | |||
| 1036 | Ga0265314_10001000 | |||
| 1037 | Ga0265314_10003110 | |||
| 1038 | Ga0265314_10005470 | |||
| 1039 | Ga0265314_10030165 | |||
| 1040 | Ga0265342_10000020 | |||
| 1041 | Ga0265342_10000042 | |||
| 1042 | Ga0265342_10059793 | |||
| 1043 | Ga0316576_10008515 | |||
| 1044 | Ga0316576_10037778 | |||
| 1045 | Ga0316576_10106006 | |||
| 1046 | Ga0316578_10029417 | |||
| 1047 | Ga0316578_10029436 | |||
| 1048 | Ga0307405_10000014 | |||
| 1049 | Ga0307405_10006917 | |||
| 1050 | Ga0316577_10036979 | |||
| 1051 | Ga0307413_10006943 | |||
| 1052 | Ga0307413_10032434 | |||
| 1053 | Ga0307410_10002168 | |||
| 1054 | Ga0307406_10002693 | |||
| 1055 | Ga0307406_10005012 | |||
| 1056 | Ga0307407_10000002 | |||
| 1057 | Ga0307412_10003708 | |||
| 1058 | Ga0307409_100000873 | |||
| 1059 | Ga0307409_100036744 | |||
| 1060 | Ga0307416_100000005 | |||
| 1061 | Ga0307416_100000883 | |||
| 1062 | Ga0307414_10000441 | |||
| 1063 | Ga0307414_10000599 | |||
| 1064 | Ga0307414_10030533 | |||
| 1065 | Ga0307414_10055678 | |||
| 1066 | Ga0307414_10164362 | |||
| 1067 | Ga0307414_10217265 | |||
| 1068 | Ga0307411_10017694 | |||
| 1069 | Ga0307411_10045463 | |||
| 1070 | Ga0307415_100002422 | |||
| 1071 | Ga0316583_10000117 | |||
| 1072 | Ga0316583_10005110 | |||
| 1073 | Ga0307510_10002118 | |||
| 1074 | Ga0316588_1001852 | |||
| 1075 | Ga0373959_0000121 | |||
| 1076 | Ga0373926_0036902 | |||
| 1077 | Ga0373939_0008876 | |||
| 1078 | Ga0373954_0073054 | |||
| 1079 | Ga0373957_0021278 | |||
| 1080 | Ga0373943_0009008 | |||
| 1081 | Ga0316574_0149023 | |||
| 1082 | Ga0373931_0009139 | |||
| 1083 | Ga0373927_0001839 | |||
| 1084 | Ga0316582_0055447 | |||
| 1085 | Ga0316582_0064276 | |||
| 1086 | Ga0316584_0037073 | |||
| 1087 | Ga0373925_0003109 | |||
| 1088 | Ga0395899_0009991 | |||
| 1089 | Ga0395899_0013861 | |||
| 1090 | Ga0395900_0000288 | |||
| 1091 | Ga0395900_0004910 | |||
| 1092 | Ga0395900_0011864 | |||
| 1093 | Ga0395900_0033960 | |||
| 1094 | Ga0395900_0074201 | |||
| 1095 | Ga0395898_0012362 | |||
| 1096 | Ga0395905_0000015 | |||
| 1097 | Ga0395905_0001824 | |||
| 1098 | Ga0395905_0007495 | |||
| 1099 | Ga0395905_0019020 | |||
| 1100 | Ga0395905_0054874 | |||
| 1101 | Ga0395905_0180647 | |||
| 1102 | Ga0436364_0839671 | |||
| 1103 | Ga0395901_0009188 | |||
| 1104 | Ga0395901_0017502 | |||
| 1105 | Ga0395901_0196798 | |||
| 1106 | Ga0400489_96379 | |||
| 1107 | Ga0436361_1222875 | |||
| 1108 | Ga0451577_0000012 | |||
| 1109 | Ga0451577_0000050 | |||
| 1110 | Ga0451577_0000159 | |||
| 1111 | Ga0451577_0000535 | |||
| 1112 | Ga0451577_0101827 | |||
| 1113 | Ga0451577_0199008 | |||
| 1114 | Ga0466972_0002085 | |||
| 1115 | Ga0453683_0000537 | |||
| 1116 | Ga0453683_0001530 | |||
| 1117 | Ga0453683_0006064 | |||
| 1118 | Ga0453683_0018020 | |||
| 1119 | Ga0466961_0002746 | |||
| 1120 | Ga0466961_0006964 | |||
| 1121 | Ga0466963_0160845 | |||
| 1122 | Ga0453684_0000045 | |||
| 1123 | Ga0453684_0000404 | |||
| 1124 | Ga0453684_0004549 | |||
| 1125 | Ga0453684_0009194 | |||
| 1126 | Ga0453684_0011011 | |||
| 1127 | Ga0453684_0020747 | |||
| 1128 | Ga0453684_0025247 | |||
| 1129 | Ga0453684_0038838 | |||
| 1130 | Ga0453684_0042461 | |||
| 1131 | Ga0453684_0045086 | |||
| 1132 | Ga0453684_0074377 | |||
| 1133 | Ga0453684_0083225 | |||
| 1134 | Ga0453684_0089717 | |||
| 1135 | Ga0453684_0095591 | |||
| 1136 | Ga0453684_0130641 | |||
| 1137 | Ga0453684_0253289 | |||
| 1138 | Ga0466959_0003937 | |||
| 1139 | Ga0451576_0000244 | |||
| 1140 | Ga0451576_0000939 | |||
| 1141 | Ga0451576_0001111 | |||
| 1142 | Ga0451576_0002731 | |||
| 1143 | Ga0451576_0003015 | |||
| 1144 | Ga0451576_0011060 | |||
| 1145 | Ga0451576_0042352 | |||
| 1146 | Ga0451576_0054033 | |||
| 1147 | Ga0451576_0085442 | |||
| 1148 | Ga0451576_0097568 | |||
| 1149 | Ga0495627_009190 | |||
| 1150 | Ga0495592_0127573 | |||
| 1151 | Ga0495603_0051928 | |||
| 1152 | Ga0495582_0010050 | |||
| 1153 | Ga0495639_0020073 | |||
| 1154 | Ga0495610_0000204 | |||
| 1155 | Ga0495610_0000279 | |||
| 1156 | Ga0495618_0079719 | |||
| 1157 | Ga0495628_0032791 | |||
| 1158 | Ga0495630_0020425 | |||
| 1159 | Ga0495631_0012861 | |||
| 1160 | Ga0495637_0008596 | |||
| 1161 | Ga0495643_0000008 | |||
| 1162 | Ga0495640_0037262 | |||
| 1163 | Ga0495587_0001600 | |||
| 1164 | Ga0495609_0010103 | |||
| 1165 | Ga0495645_0000867 | |||
| 1166 | Ga0495645_0079323 | |||
| 1167 | Ga0495657_0042941 | |||
| 1168 | Ga0495599_0007492 | |||
| 1169 | Ga0495623_0066645 | |||
| 1170 | Ga0495623_0070843 | |||
| 1171 | Ga0495658_0000860 | |||
| 1172 | Ga0495658_0072222 | |||
| 1173 | Ga0495613_0011460 | |||
| 1174 | Ga0495649_0038454 | |||
| 1175 | Ga0495600_0149492 | |||
| 1176 | Ga0495604_0138469 | |||
| 1177 | Ga0495604_0150433 | |||
| 1178 | Ga0495674_0094823 | |||
| 1179 | Ga0495680_0026573 | |||
| 1180 | Ga0495683_0011040 | |||
| 1181 | Ga0495687_000846 | |||
| 1182 | Ga0495675_0004167 | |||
| 1183 | Ga0495675_0040387 | |||
| 1184 | Ga0495681_0059871 | |||
| 1185 | Ga0495684_0036329 | |||
| 1186 | Ga0495684_0078398 | |||
| 1187 | Ga0495602_0050021 | |||
| 1188 | Ga0496114_0129403 | |||
| 1189 | Ga0496115_0063732 | |||
| 1190 | Ga0496122_0001886 | |||
| 1191 | Ga0496123_0001009 | |||
| 1192 | Ga0496125_0039297 | |||
| 1193 | Ga0501300_001025 | |||
| 1194 | Ga0501031_0004307 | |||
| 1195 | Ga0501031_0023432 | |||
| 1196 | Ga0501031_0038101 | |||
| 1197 | Ga0501031_0044989 | |||
| 1198 | Ga0501032_0001732 | |||
| 1199 | Ga0501032_0004297 | |||
| 1200 | Ga0501032_0043891 | |||
| 1201 | Ga0501032_0050388 | |||
| 1202 | Ga0501033_0002253 | |||
| 1203 | Ga0501033_0008553 | |||
| 1204 | Ga0501033_0012666 | |||
| 1205 | Ga0501033_0211596 | |||
| 1206 | Ga0501034_0000125 | |||
| 1207 | Ga0501034_0037200 | |||
| 1208 | Ga0501034_0040028 | |||
| 1209 | Ga0501036_0000962 | |||
| 1210 | Ga0501036_0003927 | |||
| 1211 | Ga0501036_0056961 | |||
| 1212 | Ga0501037_0003185 | |||
| 1213 | Ga0501037_0057278 | |||
| 1214 | Ga0501038_0014653 | |||
| 1215 | Ga0501038_0030360 | |||
| 1216 | Ga0501038_0034137 | |||
| 1217 | Ga0501039_0005683 | |||
| 1218 | Ga0501039_0016007 | |||
| 1219 | Ga0501039_0068102 | |||
| 1220 | Ga0501040_0001497 | |||
| 1221 | Ga0501040_0001628 | |||
| 1222 | Ga0501040_0007040 | |||
| 1223 | Ga0501040_0050329 | |||
| 1224 | Ga0501040_0062930 | |||
| 1225 | Ga0501041_0007461 | |||
| 1226 | Ga0501041_0049065 | |||
| 1227 | Ga0501042_0001740 | |||
| 1228 | Ga0501042_0004659 | |||
| 1229 | Ga0501043_0010753 | |||
| 1230 | Ga0501046_0005050 | |||
| 1231 | Ga0501046_0016304 | |||
| 1232 | Ga0501046_0087211 | |||
| 1233 | Ga0501046_0199467 | |||
| 1234 | Ga0501047_0002621 | |||
| 1235 | Ga0501047_0007049 | |||
| 1236 | Ga0501047_0007086 | |||
| 1237 | Ga0501047_0019296 | |||
| 1238 | Ga0501048_0001530 | |||
| 1239 | Ga0501048_0004838 | |||
| 1240 | Ga0501048_0049015 | |||
| 1241 | Ga0501048_0111361 | |||
| 1242 | Ga0501067_0056436 | |||
| 1243 | Ga0501068_0011386 | |||
| 1244 | Ga0501068_0015491 | |||
| 1245 | Ga0501070_0062007 | |||
| 1246 | Ga0501070_0230605 | |||
| 1247 | Ga0501071_0000248 | |||
| 1248 | Ga0501071_0003304 | |||
| 1249 | Ga0501071_0017385 | |||
| 1250 | Ga0501071_0048720 | |||
| 1251 | Ga0501072_0000230 | |||
| 1252 | Ga0501072_0000583 | |||
| 1253 | Ga0501072_0025684 | |||
| 1254 | Ga0501072_0036554 | |||
| 1255 | Ga0501072_0037771 | |||
| 1256 | Ga0501073_0053398 | |||
| 1257 | Ga0501074_0003576 | |||
| 1258 | Ga0501074_0011788 | |||
| 1259 | Ga0501074_0021501 | |||
| 1260 | Ga0501074_0115455 | |||
| 1261 | Ga0501075_0000921 | |||
| 1262 | Ga0501075_0003162 | |||
| 1263 | Ga0501075_0047279 | |||
| 1264 | Ga0501075_0212763 | |||
| 1265 | Ga0501076_0002914 | |||
| 1266 | Ga0501076_0012610 | |||
| 1267 | Ga0501076_0037552 | |||
| 1268 | Ga0501076_0056271 | |||
| 1269 | Ga0501077_0000967 | |||
| 1270 | Ga0501077_0008584 | |||
| 1271 | Ga0501077_0032762 | |||
| 1272 | Ga0501079_0001980 | |||
| 1273 | Ga0501079_0008321 | |||
| 1274 | Ga0501079_0009574 | |||
| 1275 | Ga0501079_0024226 | |||
| 1276 | Ga0501079_0028692 | |||
| 1277 | Ga0501079_0178677 | |||
| 1278 | Ga0501079_0204989 | |||
| 1279 | Ga0501080_0012626 | |||
| 1280 | Ga0501080_0027017 | |||
| 1281 | Ga0501080_0046318 | |||
| 1282 | Ga0501080_0168914 | |||
| 1283 | Ga0501081_0004544 | |||
| 1284 | Ga0501081_0017611 | |||
| 1285 | Ga0501081_0027229 | |||
| 1286 | Ga0501083_0004940 | |||
| 1287 | Ga0501083_0009550 | |||
| 1288 | Ga0501035_0000808 | |||
| 1289 | Ga0501035_0003769 | |||
| 1290 | Ga0501035_0027792 | |||
| 1291 | Ga0501044_0000948 | |||
| 1292 | Ga0501044_0003677 | |||
| 1293 | Ga0501044_0005909 | |||
| 1294 | Ga0501044_0044898 | |||
| 1295 | Ga0501044_0045662 | |||
| 1296 | Ga0501044_0181226 | |||
| 1297 | Ga0501045_0058154 | |||
| 1298 | Ga0501045_0130871 | |||
| 1299 | Ga0501045_0168445 | |||
| 1300 | nmdc:mga05p37_67250_c1 | |||
| 1301 | nmdc:mga05p37_80195_c1 | |||
| 1302 | nmdc:mga09592_40450_c1 | |||
| 1303 | nmdc:mga0qj67_19765_c1 | |||
| 1304 | nmdc:mga0qj67_228842_c1 | |||
| 1305 | nmdc:mga0qj67_77631_c1 | |||
| 1306 | nmdc:mga0qj67_9943_c1 | |||
| 1307 | nmdc:mga06r32_214693_c1 | |||
| 1308 | nmdc:mga06r32_3015_c1 | |||
| 1309 | nmdc:mga08y16_100926_c1 | |||
| 1310 | nmdc:mga08y16_178166_c1 | |||
| 1311 | nmdc:mga08y16_189096_c1 | |||
| 1312 | nmdc:mga08y16_54753_c1 | |||
| 1313 | nmdc:mga08y16_56061_c1 | |||
| 1314 | nmdc:mga08y16_9329_c1 | |||
| 1315 | nmdc:mga0n895_5273_c1 | |||
| 1316 | nmdc:mga0n895_7562_c1 | |||
| 1317 | nmdc:mga0rr50_128421_c1 | |||
| 1318 | nmdc:mga0a205_205925_c1 | |||
| 1319 | nmdc:mga0a205_35_c2 | |||
| 1320 | nmdc:mga0a205_43268_c1 | |||
| 1321 | nmdc:mga0a205_89145_c1 | |||
| 1322 | Ga0495619_0028219 | |||
| 1323 | Ga0500608_000658 | |||
| 1324 | Ga0500608_001920 | |||
| 1325 | Ga0500628_000545 | |||
| 1326 | Ga0501084_0001875 | |||
| 1327 | Ga0501084_0020561 | |||
| 1328 | Ga0501084_0156114 | |||
| 1329 | Ga0501082_0005720 | |||
| 1330 | Ga0501082_0012335 | |||
| 1331 | Ga0530510_0004515 | |||
| 1332 | Ga0530510_0017071 | |||
| 1333 | Ga0530510_0023788 | |||
| 1334 | Ga0530510_0025855 | |||
| 1335 | Ga0530510_0060517 | |||
| 1336 | 2524004523 | |||
| 1337 | 2586207043 | |||
| 1338 | 2715500935 | |||
| 1339 | 2738701873 | |||
| 1340 | 2738755728 | |||
| 1341 | 2738761611 | |||
| 1342 | 2738852680 | |||
| 1343 | 2739256171 | |||
| 1344 | 2739305349 | |||
| 1345 | 2739586610 | |||
| 1346 | 2739614937 | |||
| 1347 | 2739645965 | |||
| 1348 | 2740033220 | |||
| 1349 | 2776615752 | |||
| 1350 | 2819549782 | |||
| 1351 | 2834579088 | |||
| 1352 | 2839991137 | |||
| 1353 | 2840882349 | |||
| 1354 | 2842727208 | |||
| 1355 | 2842910788 | |||
| 1356 | 2849286682 | |||
| 1357 | 2852627963 | |||
| 1358 | 2854685153 | |||
| 1359 | 2855022687 | |||
| 1360 | 2857628109 | |||
| 1361 | 2884636872 | |||
| 1362 | 2890807524 | |||
| 1363 | 2898796920 | |||
| 1364 | 2899259981 | |||
| 1365 | 2899276189 | |||
| 1366 | 2902050483 | |||
| 1367 | 2904447090 | |||
| 1368 | 2910248264 | |||
| 1369 | 2919190938 | |||
| 1370 | 2919679456 | |||
| 1371 | 2939668852 | |||
| 1372 | 2945998119 | |||
| 1373 | 2954020564 | |||
| 1374 | 3000019812 | |||
| 1375 | 3000406685 | |||
| 1376 | 8057134980 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pxt-assembly1.cif.gz_A | variant 15 of ribonucleoprotein core of the e. coli signal recognition particle | 0.9697 | 327 | 424 |
| 7o9f-assembly1.cif.gz_A | bacillus subtilis ffh in complex with ppgpp | 0.9631 | 2 | 298 |
| 7o9f-assembly3.cif.gz_C | bacillus subtilis ffh in complex with ppgpp | 0.9599 | 2 | 298 |
| 1hq1-assembly1.cif.gz_A | structural and energetic analysis of rna recognition by a universally conserved protein from the signal recognition particle | 0.9579 | 327 | 426 |
| 7o9f-assembly1.cif.gz_A | bacillus subtilis ffh in complex with ppgpp | 0.9506 | 2 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5l3rC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.962 | 91 | 282 | 3.40.50.300 |
| 1hq1A00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);Signal recognition particle, SRP54 subunit, M-domain | 0.9579 | 327 | 426 | 1.10.260.30 |
| 5l3rC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9523 | 91 | 282 | 3.40.50.300 |
| af_A0A0R0L4Y4_128_288_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9428 | 98 | 238 | 3.40.50.300 |
| af_Q4DKX0_351_574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9408 | 98 | 294 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1IBY6-F1-model_v4 | Signal recognition particle protein | 0.9819 | 1 | 270 |
GO:0003924
GO:0005525 GO:0006614 GO:0016887 GO:0048500 |
| AF-A0A519XJ53-F1-model_v4 | Signal recognition particle protein | 0.9806 | 1 | 302 |
GO:0003924
GO:0005525 GO:0006614 GO:0016887 GO:0048500 |
| AF-A0A3M1IBY6-F1-model_v4 | Signal recognition particle protein | 0.9748 | 1 | 270 |
GO:0003924
GO:0005525 GO:0006614 GO:0016887 GO:0048500 |
| AF-A0A519XJ53-F1-model_v4 | Signal recognition particle protein | 0.9742 | 1 | 302 |
GO:0003924
GO:0005525 GO:0006614 GO:0016887 GO:0048500 |
| AF-A0A7J7AU57-F1-model_v4 | deleted | 0.9712 | 1 | 216 |
|