F475336

General Info

Members Datasets Scaffolds Average Seq Length
688 604 1376 217

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10024415|Ga0307513_100244154
Length 247
Sequence MFDNLPEFISTILDGLGLTLAATLGGIAISAVLSFVFGLAMLSGSRIVRVVARIYVEIWRGTSEVVQLFWIFFVLPVLVGYQIVPLMAGIVVLGLNFGAYGAEIVRGAIQAVPRAQYEGAIALSLTPAQRMRRVILPQALVEMVPPFNNLFIQLLKGSALLTMITVPEMTNQARNVLMDLYTGQAGLIWTVLLVFYLLLSVLITFGMKFLERRAARIVGRGPSQAARDRGLAIAVEAGAGRGGGFPT

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
30 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
33 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
34 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
35 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
36 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
37 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
38 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
51 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
60 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
63 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
64 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
65 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
66 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
67 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
68 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
69 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
70 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
73 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
74 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
190 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
200 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
201 2509276019 Ensifer aridi TW10 Isolate Nodule
202 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
203 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
204 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
205 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
206 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
207 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
208 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
209 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
210 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
211 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
212 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
213 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
214 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
215 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
216 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
217 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
218 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
219 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
220 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
221 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
222 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
223 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
224 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
225 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
226 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
227 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
228 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
229 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
230 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
231 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
232 2516143018 Ensifer sp. BR816 Isolate Nodule
233 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
234 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
235 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
236 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
237 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
238 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
239 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
240 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
241 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
242 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
243 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
244 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
245 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
246 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
247 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
248 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
249 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
250 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
251 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
252 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
253 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
254 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
255 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
256 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
257 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
258 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
259 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
260 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
261 2643221557 Ensifer sp. Root558 Isolate Unclassified
262 2643221594 Achromobacter sp. Root170 Isolate Unclassified
263 2643221607 Rhizobium sp. Root73 Isolate Unclassified
264 2643221610 Ensifer sp. Root74 Isolate Unclassified
265 2643221618 Ensifer sp. Root231 Isolate Unclassified
266 2643221626 Ensifer sp. Root31 Isolate Unclassified
267 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
268 2643221655 Ensifer sp. Root1252 Isolate Unclassified
269 2643221659 Ensifer sp. Root127 Isolate Unclassified
270 2643221668 Ensifer sp. Root423 Isolate Unclassified
271 2643221675 Ensifer sp. Root1298 Isolate Unclassified
272 2643221680 Ensifer sp. Root1312 Isolate Unclassified
273 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
274 2643221688 Rhizobium sp. Root482 Isolate Unclassified
275 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
276 2643221698 Ensifer sp. Root142 Isolate Unclassified
277 2643221712 Ensifer sp. Root258 Isolate Unclassified
278 2643221726 Ensifer sp. Root954 Isolate Unclassified
279 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
280 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
281 2718217882 Rhizobium sp. N741 Isolate Nodule
282 2718217927 Rhizobium sp. N324 Isolate Nodule
283 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
284 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
285 2718218009 Rhizobium sp. N561 Isolate Nodule
286 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
287 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
288 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
289 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
290 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
291 2718218363 Rhizobium sp. N113 Isolate Nodule
292 2718218365 Rhizobium sp. N731 Isolate Nodule
293 2718218366 Rhizobium sp. N621 Isolate Nodule
294 2718218423 Rhizobium sp. N941 Isolate Nodule
295 2721755514 Rhizobium sp. N6212 Isolate Nodule
296 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
297 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
298 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
299 2721755809 Rhizobium sp. N541 Isolate Nodule
300 2721755810 Rhizobium sp. N871 Isolate Nodule
301 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
302 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
303 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
304 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
305 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
306 2728369365 Rhizobium sp. N1341 Isolate Nodule
307 2728369397 Rhizobium sp. N1314 Isolate Nodule
308 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
309 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
310 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
311 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
312 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
313 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
314 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
315 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
316 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
317 2791355256 Rhizobium sp. M10 Isolate Nodule
318 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
319 2791355262 Rhizobium sp. M1 Isolate Nodule
320 2791355264 Rhizobium sp. S9 Isolate Nodule
321 2791355265 Rhizobium sp. H4 Isolate Nodule
322 2791355266 Rhizobium sp. L43 Isolate Nodule
323 2791355267 Rhizobium sp. L18 Isolate Nodule
324 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
325 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
326 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
327 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
328 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
329 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
330 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
331 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
332 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
333 2802429633 Rhizobium anhuiense J3 Isolate Nodule
334 2802429634 Rhizobium anhuiense S10 Isolate Nodule
335 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
336 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
337 2802429637 Rhizobium anhuiense C15 Isolate Nodule
338 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
339 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
340 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
341 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
342 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
343 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
344 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
345 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
346 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
347 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
348 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
349 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
350 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
351 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
352 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
353 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
354 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
355 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
356 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
357 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
358 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
359 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
360 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
361 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
362 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
363 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
364 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
365 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
366 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
367 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
368 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
369 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
370 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
371 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
372 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
373 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
374 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
375 2844163670 Ensifer sp. 1H6 Isolate Unclassified
376 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
377 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
378 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
379 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
380 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
381 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
382 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
383 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
384 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
385 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
386 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
387 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
388 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
389 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
390 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
391 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
392 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
393 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
394 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
395 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
396 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
397 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
398 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
399 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
400 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
401 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
402 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
403 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
404 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
405 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
406 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
407 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
408 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
409 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
410 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
411 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
412 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
413 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
414 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
415 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
416 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
417 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
418 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
419 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
420 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
421 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
422 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
423 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
424 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
425 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
426 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
427 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
428 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
429 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
430 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
431 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
432 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
433 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
434 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
435 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
436 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
437 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
438 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
439 2933599457 Rhizobium phaseoli M3 Isolate Nodule
440 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
441 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
442 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
443 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
444 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
445 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
446 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
447 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
448 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
449 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
450 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
451 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
452 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
453 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
454 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
455 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
456 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
457 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
458 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
459 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
460 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
461 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
462 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
463 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
464 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
465 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
466 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
467 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
468 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
469 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
470 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
471 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
472 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
473 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
474 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
475 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
476 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
477 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
478 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
479 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
480 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
481 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
482 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
483 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
484 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
485 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
486 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
487 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
488 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
489 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
490 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
491 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
492 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
493 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
494 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
495 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
496 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
497 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
498 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
499 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
500 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
501 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
502 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
503 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
504 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
505 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
506 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
507 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
508 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
509 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
510 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
511 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
512 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
513 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
514 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
515 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
516 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
517 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
518 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
519 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
520 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
521 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
522 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
523 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
524 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
525 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
526 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
527 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
528 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
529 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
530 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
531 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
532 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
533 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
534 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
535 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
536 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
537 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
538 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
539 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
540 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
541 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
542 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
543 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
544 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
545 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
546 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
547 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
548 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
549 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
550 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
551 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
552 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
553 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
554 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
555 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
556 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
557 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
558 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
559 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
560 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
561 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
562 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
563 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
564 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
565 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
566 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
567 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
568 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
569 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
570 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
571 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
572 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
573 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
574 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
575 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
576 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
577 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
578 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
579 8005275841 Rhizobium sp. N4311 Isolate Nodule
580 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
581 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
582 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
583 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
584 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
585 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
586 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
587 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
588 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
589 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
590 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
591 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
592 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
593 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
594 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
595 8018176218 Rhizobium sp. N122 Isolate Nodule
596 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
597 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
598 8024501048 Rhizobium sp. H4 Isolate Nodule
599 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
600 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
601 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
602 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
603 8056382006 Rhizobium croatiense 13T Isolate Nodule
604 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.99
Metatranscriptomes 0
Isolates 59.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.76
Nodule 50.73
Rhizoplane 1.74
Rhizosphere 23.69
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10024415 3300031456 Bacteria 7033
2 JGI25151J46595_10005696 3300003187 Bacteria 6394
3 rootH2_10039980 3300003320 Bacteria 2592
4 rootH1_10044850 3300003323 Bacteria 2968
5 JGI25160J50197_1001143 3300003354 Bacteria 13576
6 JGI25161J50226_1007798 3300003374 Bacteria 1730
7 Ga0055529_1000683 3300003763 Bacteria 23311
8 Ga0055526_1002351 3300003771 Bacteria 12849
9 Ga0055526_1046410 3300003771 Bacteria 1029
10 Ga0055524_1000517 3300003775 Bacteria 29782
11 Ga0055524_1002854 3300003775 Bacteria 8665
12 Ga0055524_1007706 3300003775 Bacteria 4546
13 Ga0055528_1000982 3300003790 Bacteria 18925
14 Ga0055528_1013213 3300003790 Bacteria 3147
15 Ga0055540_1000096 3300003792 Bacteria 96969
16 Ga0055540_1004097 3300003792 Bacteria 6750
17 Ga0055540_1007276 3300003792 Bacteria 4216
18 Ga0055531_10053546 3300003794 Bacteria 1041
19 Ga0065165_1005520 3300005262 Bacteria 7067
20 Ga0065704_10194511 3300005289 Bacteria 1171
21 Ga0070680_100067434 3300005336 Bacteria 2935
22 Ga0070671_100013519 3300005355 Bacteria 6582
23 Ga0068863_100001682 3300005841 Bacteria 21896
24 Ga0068862_100004591 3300005844 Bacteria 11636
25 Ga0081540_1000664 3300005983 Bacteria 32418
26 Ga0075365_10000808 3300006038 Bacteria 12863
27 Ga0075368_10041594 3300006042 Bacteria 1806
28 Ga0075364_10006271 3300006051 Bacteria 6979
29 Ga0075364_10008042 3300006051 Bacteria 6289
30 Ga0075364_10009352 3300006051 Bacteria 5874
31 Ga0075364_10036068 3300006051 Bacteria 3197
32 Ga0075364_10140890 3300006051 Bacteria 1622
33 Ga0075362_10002642 3300006177 Bacteria 6081
34 Ga0075366_10001529 3300006195 Bacteria 11567
35 Ga0075370_10003493 3300006353 Bacteria 7489
36 Ga0105247_10057365 3300009101 Bacteria 2407
37 Ga0123342_1024877 3300009766 Bacteria 3686
38 Ga0105239_11428250 3300010375 Bacteria 799
39 Ga0157326_1008495 3300012513 Bacteria 1121
40 Ga0171463_1012 3300013249 Bacteria 176554
41 Ga0157379_10041012 3300014968 Bacteria 4132
42 Ga0183363_1193 3300015690 Bacteria 12837
43 Ga0214544_1000018 3300021320 Bacteria 187095
44 Ga0214542_1001937 3300021321 Bacteria 42815
45 Ga0214542_1024565 3300021321 Bacteria 3341
46 Ga0214542_1037892 3300021321 Bacteria 1352
47 Ga0214543_1000012 3300021327 Bacteria 338982
48 Ga0214543_1000042 3300021327 Bacteria 164433
49 Ga0214543_1000162 3300021327 Bacteria 96261
50 Ga0228711_1002155 3300022739 Bacteria 29954
51 Ga0228710_1002282 3300022740 Bacteria 30071
52 Ga0209455_1000503 3300025272 Bacteria 28146
53 Ga0209673_1000105 3300025273 Bacteria 186267
54 Ga0209673_1002092 3300025273 Bacteria 15006
55 Ga0209130_1013856 3300025284 Bacteria 2048
56 Ga0209564_1000913 3300025295 Bacteria 38633
57 Ga0209564_1001922 3300025295 Bacteria 18544
58 Ga0209564_1032182 3300025295 Bacteria 1584
59 Ga0209758_1000380 3300025297 Bacteria 77252
60 Ga0209050_1003406 3300025298 Bacteria 11784
61 Ga0209256_1000260 3300025299 Bacteria 93956
62 Ga0209256_1000281 3300025299 Bacteria 89636
63 Ga0209256_1001129 3300025299 Bacteria 30423
64 Ga0209256_1002297 3300025299 Bacteria 16069
65 Ga0207426_1000350 3300025302 Bacteria 84510
66 Ga0209051_1000027 3300025303 Bacteria 412172
67 Ga0209051_1001030 3300025303 Bacteria 26476
68 Ga0209051_1023350 3300025303 Bacteria 2574
69 Ga0209257_1001771 3300025304 Bacteria 23907
70 Ga0209257_1011780 3300025304 Bacteria 4152
71 Ga0207644_10010531 3300025931 Bacteria 6095
72 Ga0207641_10004926 3300026088 Bacteria 11470
73 Ga0209281_1000655 3300027111 Bacteria 37203
74 Ga0209281_1000789 3300027111 Bacteria 29982
75 Ga0209282_1000216 3300027666 Bacteria 30081
76 Ga0268266_10436754 3300028379 Bacteria 1243
77 Ga0307515_10000121 3300028794 Bacteria 188657
78 Ga0307515_10070741 3300028794 Bacteria 4743
79 Ga0307515_10202033 3300028794 Bacteria 1860
80 Ga0307513_10163080 3300031456 Bacteria 2118
81 Ga0307513_10488593 3300031456 Bacteria 950
82 Ga0307405_10313770 3300031731 Bacteria 1195
83 Ga0307406_10101787 3300031901 Bacteria 1958
84 Ga0315914_1002167 3300031967 Bacteria 30071
85 Ga0307416_100237577 3300032002 Bacteria 1763
86 Ga0307414_10310820 3300032004 Bacteria 1337
87 Ga0315913_1000874 3300033430 Bacteria 30079
88 Ga0315915_1001277 3300033464 Bacteria 30071
89 Ga0395905_0000157 3300037471 Bacteria 112004
90 Ga0395905_0003131 3300037471 Bacteria 17831
91 Ga0400483_182281 3300039062 Bacteria 1833
92 Ga0439436_0025457 3300041404 Bacteria 1738
93 Ga0439436_0154682 3300041404 Bacteria 647
94 Ga0439439_0034147 3300041406 Bacteria 1304
95 Ga0439466_0100521 3300041411 Bacteria 902
96 Ga0439465_0003152 3300041413 Bacteria 5385
97 Ga0439465_0024355 3300041413 Bacteria 1907
98 Ga0451835_1258197 3300041492 Bacteria 1068
99 Ga0451841_0078269 3300041498 Bacteria 1891
100 Ga0451851_0389910 3300041507 Bacteria 980
101 Ga0451855_1395754 3300041511 Bacteria 631
102 Ga0451853_2152199 3300041512 Bacteria 1740
103 Ga0439449_0065659 3300042007 Bacteria 1338
104 Ga0450907_014384 3300042146 Bacteria 1321
105 Ga0439434_0148717 3300042435 Bacteria 775
106 Ga0466958_0128555 3300045836 Bacteria 1590
107 Ga0466967_0226497 3300045976 Bacteria 1779
108 Ga0466967_0247429 3300045976 Bacteria 1702
109 Ga0495617_018024 3300046452 Bacteria 2387
110 Ga0495592_0000229 3300046454 Bacteria 48485
111 Ga0495590_0029931 3300046457 Bacteria 1908
112 Ga0495591_000101 3300046458 Bacteria 99240
113 Ga0495629_0000561 3300046459 Bacteria 30335
114 Ga0495638_0000163 3300046460 Bacteria 103363
115 Ga0495638_0008099 3300046460 Bacteria 7473
116 Ga0495638_0013770 3300046460 Bacteria 5491
117 Ga0495638_0023236 3300046460 Bacteria 4058
118 Ga0495638_0194310 3300046460 Bacteria 1150
119 Ga0495638_0277412 3300046460 Bacteria 912
120 Ga0495641_0133854 3300046461 Bacteria 1107
121 Ga0495651_0000730 3300046462 Bacteria 25378
122 Ga0495653_0009573 3300046463 Bacteria 7924
123 Ga0495580_0000681 3300046472 Bacteria 28955
124 Ga0495605_0012887 3300046474 Bacteria 4627
125 Ga0495662_0018963 3300046476 Bacteria 3329
126 Ga0495664_0021184 3300046477 Bacteria 3755
127 Ga0495585_0015817 3300046492 Bacteria 4380
128 Ga0495585_0154128 3300046492 Bacteria 1196
129 Ga0495596_0000146 3300046500 Bacteria 48977
130 Ga0495583_0000449 3300046506 Bacteria 61654
131 Ga0495583_0064561 3300046506 Bacteria 1624
132 Ga0495583_0066549 3300046506 Bacteria 1594
133 Ga0495606_0002598 3300046507 Bacteria 20659
134 Ga0495608_0000241 3300046511 Bacteria 39695
135 Ga0495616_0038823 3300046513 Bacteria 2442
136 Ga0495618_0001966 3300046514 Bacteria 13476
137 Ga0495620_0064666 3300046515 Bacteria 1512
138 Ga0495628_0005725 3300046516 Bacteria 10886
139 Ga0495630_0000147 3300046517 Bacteria 54656
140 Ga0495631_0010810 3300046518 Bacteria 4509
141 Ga0495632_0007429 3300046519 Bacteria 6881
142 Ga0495648_0000164 3300046524 Bacteria 78546
143 Ga0495648_0013155 3300046524 Bacteria 6134
144 Ga0495648_0016222 3300046524 Bacteria 5374
145 Ga0495666_0000107 3300046526 Bacteria 33827
146 Ga0495652_0006343 3300046529 Bacteria 11014
147 Ga0495654_0000553 3300046530 Bacteria 30194
148 Ga0495665_0000827 3300046531 Bacteria 16201
149 Ga0495640_0000282 3300046533 Bacteria 34895
150 Ga0495586_0012956 3300046535 Bacteria 4420
151 Ga0495587_0002606 3300046536 Bacteria 12040
152 Ga0495609_0015374 3300046538 Bacteria 3583
153 Ga0495597_0032186 3300046542 Bacteria 2381
154 Ga0495667_0016834 3300046559 Bacteria 4937
155 Ga0495656_0139403 3300046615 Bacteria 1162
156 Ga0495668_0004281 3300046616 Bacteria 10239
157 Ga0495668_0146819 3300046616 Bacteria 1291
158 Ga0495634_0001199 3300046642 Bacteria 23908
159 Ga0495611_0014527 3300046648 Bacteria 3365
160 Ga0495625_0008338 3300046660 Bacteria 8850
161 Ga0495625_0038721 3300046660 Bacteria 3488
162 Ga0495625_0154478 3300046660 Bacteria 1541
163 Ga0495635_0000218 3300046663 Bacteria 36175
164 Ga0495661_0000818 3300046665 Bacteria 29194
165 Ga0495599_0001820 3300046678 Bacteria 12374
166 Ga0495623_0000895 3300046679 Bacteria 20191
167 Ga0495646_0000372 3300046680 Bacteria 23306
168 Ga0495613_0000353 3300046689 Bacteria 40648
169 Ga0495624_0000869 3300046690 Bacteria 23955
170 Ga0495671_0009578 3300046692 Bacteria 5408
171 Ga0495649_0000211 3300046694 Bacteria 51291
172 Ga0495649_0021376 3300046694 Bacteria 3626
173 Ga0495589_0000213 3300046794 Bacteria 49333
174 Ga0495600_0004656 3300046809 Bacteria 8221
175 Ga0495660_0050092 3300046810 Bacteria 2277
176 Ga0495581_0021845 3300047315 Bacteria 3709
177 Ga0495604_0004103 3300047317 Bacteria 11572
178 Ga0495674_0032747 3300047319 Bacteria 4711
179 Ga0495672_0001856 3300047320 Bacteria 20144
180 Ga0495672_0034279 3300047320 Bacteria 3138
181 Ga0495676_0016763 3300047321 Bacteria 6489
182 Ga0495680_0026038 3300047322 Bacteria 4830
183 Ga0495683_0000435 3300047323 Bacteria 33153
184 Ga0495683_0029434 3300047323 Bacteria 2807
185 Ga0495683_0128221 3300047323 Bacteria 1199
186 Ga0495675_0000151 3300047444 Bacteria 48734
187 Ga0495679_000093 3300047446 Bacteria 81614
188 Ga0495673_0002198 3300047469 Bacteria 14112
189 Ga0495673_0002375 3300047469 Bacteria 13348
190 Ga0495593_0000123 3300047673 Bacteria 37582
191 Ga0495602_0006996 3300048088 Bacteria 11842
192 Ga0495614_0000139 3300048089 Bacteria 25932
193 Ga0495626_0000623 3300048091 Bacteria 34507
194 Ga0495626_0091521 3300048091 Bacteria 1337
195 Ga0496100_0011869 3300048903 Bacteria 4973
196 Ga0496101_0001230 3300048904 Bacteria 15327
197 Ga0496102_0000030 3300048905 Bacteria 221326
198 Ga0496103_0000068 3300048906 Bacteria 121996
199 Ga0496104_0142888 3300048907 Bacteria 2299
200 Ga0496105_0023939 3300048908 Bacteria 4960
201 Ga0496107_0352649 3300048910 Bacteria 1095
202 Ga0496109_0213226 3300048912 Bacteria 1816
203 Ga0496111_0320724 3300048914 Bacteria 1148
204 Ga0496116_0000152 3300048919 Bacteria 141311
205 Ga0496116_0098478 3300048919 Bacteria 1754
206 Ga0496116_0157969 3300048919 Unclassified 1248
207 Ga0496117_0000059 3300048920 Bacteria 260163
208 Ga0496118_0000061 3300048921 Bacteria 220889
209 Ga0496119_0000431 3300048922 Bacteria 57748
210 Ga0496120_0005138 3300048923 Bacteria 10575
211 Ga0496120_0020033 3300048923 Bacteria 4262
212 Ga0496121_0000174 3300048924 Bacteria 143186
213 Ga0496121_0007649 3300048924 Bacteria 12978
214 Ga0496121_0089367 3300048924 Bacteria 2412
215 Ga0496122_0047492 3300048925 Bacteria 3314
216 Ga0496122_0284068 3300048925 Unclassified 902
217 Ga0496123_0065207 3300048926 Bacteria 2316
218 Ga0496124_0000036 3300048927 Bacteria 318032
219 Ga0496124_0027824 3300048927 Bacteria 5066
220 Ga0496124_0059283 3300048927 Bacteria 3216
221 Ga0496125_0000093 3300048928 Bacteria 210896
222 Ga0496125_0000292 3300048928 Bacteria 98599
223 Ga0496125_0124168 3300048928 Bacteria 1833
224 Ga0496126_0000213 3300048929 Bacteria 128366
225 Ga0496126_0503450 3300048929 Bacteria 967
226 Ga0495678_021209 3300049459 Bacteria 2864
227 Ga0495682_0000499 3300049460 Bacteria 27163
228 Ga0495682_0002037 3300049460 Bacteria 9921
229 Ga0495682_0041118 3300049460 Bacteria 1695
230 Ga0501033_0119062 3300049570 Bacteria 1917
231 Ga0501034_0006800 3300049571 Bacteria 12232
232 Ga0501034_0101292 3300049571 Bacteria 2874
233 Ga0501034_0196729 3300049571 Bacteria 1975
234 Ga0501036_0161103 3300049572 Bacteria 1892
235 Ga0501037_0026919 3300049573 Bacteria 4248
236 Ga0501037_0551708 3300049573 Bacteria 778
237 Ga0501038_0140136 3300049574 Bacteria 1979
238 Ga0501043_0048042 3300049579 Bacteria 3355
239 Ga0501069_0057301 3300049585 Bacteria 2171
240 Ga0501069_0109020 3300049585 Bacteria 1576
241 Ga0501070_0004351 3300049586 Bacteria 12177
242 Ga0501070_0025986 3300049586 Bacteria 4912
243 Ga0501070_0597300 3300049586 Bacteria 880
244 Ga0501072_0476087 3300049588 Bacteria 988
245 Ga0501074_0043608 3300049590 Bacteria 3247
246 Ga0501076_0283990 3300049592 Bacteria 1356
247 Ga0501202_070714 3300049652 Bacteria 804
248 Ga0501080_0038950 3300049742 Bacteria 4436
249 Ga0501035_0071459 3300049822 Bacteria 3072
250 Ga0501035_0235513 3300049822 Bacteria 1559
251 Ga0501035_0341724 3300049822 Bacteria 1254
252 Ga0501044_0055951 3300049823 Bacteria 4050
253 Ga0501044_0313997 3300049823 Bacteria 1493
254 nmdc:mga03683_2599_c1 3300050489 Bacteria 5637
255 nmdc:mga00v17_123288_c1 3300050491 Bacteria 1652
256 nmdc:mga00v17_15855_c1 3300050491 Bacteria 4239
257 nmdc:mga00v17_238387_c1 3300050491 Bacteria 1179
258 nmdc:mga00v17_47863_c1 3300050491 Bacteria 2590
259 nmdc:mga00v17_49367_c1 3300050491 Bacteria 2553
260 nmdc:mga00v17_4957_c1 3300050491 Bacteria 6117
261 nmdc:mga0yw44_40411_c1 3300050492 Bacteria 2771
262 nmdc:mga0k408_15225_c1 3300050493 Bacteria 4250
263 nmdc:mga0k408_460092_c1 3300050493 Bacteria 755
264 nmdc:mga07m45_5702_c1 3300050496 Bacteria 6227
265 nmdc:mga0sz30_7116_c2 3300050516 Bacteria 3619
266 Ga0500578_0451004 3300053086 Bacteria 732
267 Ga0500644_0073379 3300053088 Bacteria 1239
268 Ga0500557_002795 3300053105 Bacteria 3300
269 Ga0500569_030380 3300053109 Bacteria 1511
270 Ga0500594_0001612 3300053118 Bacteria 4905
271 Ga0500594_0132027 3300053118 Bacteria 792
272 Ga0500642_0007323 3300053130 Bacteria 3701
273 Ga0500642_0079526 3300053130 Bacteria 1503
274 Ga0500658_0000932 3300053134 Bacteria 11919
275 Ga0500658_0003225 3300053134 Bacteria 6199
276 Ga0500568_0000210 3300053139 Bacteria 50927
277 Ga0500577_0020677 3300053142 Bacteria 2158
278 Ga0500577_0091198 3300053142 Bacteria 1232
279 Ga0500604_0011514 3300053151 Bacteria 2376
280 Ga0500616_0002480 3300053153 Bacteria 15299
281 Ga0500622_0082992 3300053156 Bacteria 1602
282 Ga0500609_001377 3300053731 Bacteria 3560
283 2509110661 2508501122 Bacteria 6292184
284 2509377482 2509276019 Bacteria 6802256
285 2509390738 2509276021 Bacteria 7634384
286 2509442049 2509276033 Bacteria 7180565
287 2510136346 2510065019 Bacteria 6903379
288 2510248512 2510065045 Bacteria 7761063
289 2510302957 2510065057 Bacteria 6649661
290 2510892638 2510461076 Bacteria 8618824
291 2511389458 2511231027 Bacteria 5013807
292 2511496949 2511231052 Bacteria 6974333
293 2512529388 2512047086 Bacteria 6850303
294 2512969032 2512875026 Bacteria 6861065
295 2513568643 2513237084 Bacteria 7231967
296 2513583390 2513237086 Bacteria 7265287
297 2513607014 2513237089 Bacteria 6553624
298 2513614936 2513237091 Bacteria 6900273
299 2513630495 2513237093 Bacteria 7545552
300 2513711257 2513237103 Bacteria 7647401
301 2513869981 2513237138 Bacteria 7368160
302 2513883944 2513237140 Bacteria 7076289
303 2513901610 2513237143 Bacteria 6664116
304 2513914565 2513237144 Bacteria 7530820
305 2513923927 2513237146 Bacteria 7166346
306 2513987704 2513237156 Bacteria 6402557
307 2514008832 2513237160 Bacteria 6650282
308 2514018489 2513237162 Bacteria 7468464
309 2515108709 2515075009 Bacteria 7288508
310 2515612188 2515154107 Bacteria 6795637
311 2515632573 2515154113 Bacteria 7807172
312 2515656576 2515154116 Bacteria 7552979
313 2515684197 2515154122 Bacteria 8609520
314 2515738192 2515154134 Bacteria 7220242
315 2516208232 2516143018 Bacteria 6951533
316 2516895821 2516653046 Bacteria 6989037
317 2517040642 2516653077 Bacteria 7555578
318 2517098271 2517093000 Bacteria 7412387
319 2517409766 2517287029 Bacteria 6905599
320 2517566215 2517487022 Bacteria 7227575
321 2524449177 2524023207 Bacteria 6813453
322 2530648917 2529292951 Bacteria 6916614
323 2551678709 2551306084 Bacteria 8942552
324 2551681947 2551306084 Bacteria 8942552
325 2551683268 2551306085 Bacteria 7347181
326 2551696710 2551306086 Bacteria 6843938
327 2551699874 2551306087 Bacteria 7351905
328 2551714127 2551306089 Bacteria 7162724
329 2551716751 2551306090 Bacteria 7953713
330 2551731400 2551306091 Bacteria 7086830
331 2551739075 2551306092 Bacteria 6992595
332 2551744250 2551306093 Bacteria 7064773
333 2558865016 2558860100 Bacteria 8458965
334 2585169482 2582581283 Bacteria 6030556
335 2585268573 2582581306 Bacteria 6450535
336 2585389236 2582581865 Bacteria 6644329
337 2585530001 2585427526 Bacteria 7258840
338 2585543464 2585427528 Bacteria 6842387
339 2585841920 2585427593 Bacteria 7141551
340 2585993718 2585427633 Bacteria 6413184
341 2586004567 2585427634 Bacteria 6455027
342 2599415969 2599185170 Bacteria 7295545
343 2600195624 2599185352 Bacteria 7228948
344 2616297845 2615840624 Bacteria 6557588
345 2643809560 2643221557 Bacteria 7184309
346 2643981712 2643221594 Bacteria 5811388
347 2644048911 2643221607 Bacteria 6314006
348 2644066709 2643221610 Bacteria 7480339
349 2644107102 2643221618 Bacteria 7717186
350 2644147843 2643221626 Bacteria 8069654
351 2644203689 2643221636 Bacteria 6583769
352 2644311407 2643221655 Bacteria 7722067
353 2644335116 2643221659 Bacteria 7890716
354 2644375900 2643221668 Bacteria 7306521
355 2644415078 2643221675 Bacteria 7473456
356 2644451489 2643221680 Bacteria 7473610
357 2644482878 2643221686 Bacteria 6310811
358 2644494955 2643221688 Bacteria 5260751
359 2644497624 2643221689 Bacteria 6042950
360 2644543977 2643221698 Bacteria 7756764
361 2644617082 2643221712 Bacteria 7729434
362 2644693135 2643221726 Bacteria 7455827
363 2657685148 2657244999 Bacteria 5946535
364 2692319576 2690316117 Bacteria 6800650
365 2719184680 2718217882 Bacteria 6556348
366 2719389304 2718217927 Bacteria 6972593
367 2719643061 2718217991 Bacteria 7829542
368 2719668673 2718217997 Bacteria 6740740
369 2719728700 2718218009 Bacteria 6478651
370 2720489366 2718218199 Bacteria 6740745
371 2720610040 2718218232 Bacteria 6720332
372 2720617464 2718218233 Bacteria 6662049
373 2720628610 2718218235 Bacteria 6630699
374 2720772560 2718218269 Bacteria 6906114
375 2721144391 2718218363 Bacteria 6524337
376 2721156344 2718218365 Bacteria 6274507
377 2721161761 2718218366 Bacteria 6425255
378 2721402070 2718218423 Bacteria 6438183
379 2722842906 2721755514 Bacteria 6424414
380 2723029999 2721755556 Bacteria 6745503
381 2723564404 2721755684 Bacteria 6859907
382 2723569955 2721755685 Bacteria 6704835
383 2724035903 2721755809 Bacteria 6438790
384 2724041725 2721755810 Bacteria 6479005
385 2724092589 2721755819 Bacteria 6906405
386 2724101502 2721755822 Bacteria 6726041
387 2724112972 2721755823 Bacteria 6752556
388 2725949610 2724679232 Bacteria 7646494
389 2730110532 2728369352 Bacteria 6745171
390 2730160795 2728369365 Bacteria 6555560
391 2730295877 2728369397 Bacteria 6274511
392 2739035359 2738541333 Bacteria 7106503
393 2765465603 2765235802 Bacteria 5618596
394 2766069102 2765235942 Bacteria 7445910
395 2770197598 2767802442 Bacteria 5747986
396 2792580923 2791355082 Bacteria 5973319
397 2792619308 2791355091 Bacteria 6135441
398 2792627081 2791355092 Bacteria 6248105
399 2792639884 2791355094 Bacteria 7011481
400 2792839211 2791355137 Bacteria 9654227
401 2793297831 2791355256 Bacteria 6798008
402 2793312615 2791355259 Bacteria 7254731
403 2793337561 2791355262 Bacteria 6774204
404 2793345570 2791355264 Bacteria 6429314
405 2793354978 2791355265 Bacteria 6539969
406 2793363718 2791355266 Bacteria 7116587
407 2793370346 2791355267 Bacteria 7222458
408 2802721847 2802428858 Bacteria 6636079
409 2802728549 2802428859 Bacteria 6667919
410 2802734593 2802428860 Bacteria 6525526
411 2802741210 2802428861 Bacteria 6534206
412 2802747493 2802428862 Bacteria 6633353
413 2802754063 2802428863 Bacteria 6410669
414 2804754402 2802429268 Bacteria 6094027
415 2805927239 2802429605 Bacteria 6875453
416 2805934333 2802429606 Bacteria 6346811
417 2806048281 2802429633 Bacteria 7341974
418 2806056066 2802429634 Bacteria 7083200
419 2806062883 2802429635 Bacteria 7650140
420 2806070487 2802429636 Bacteria 7597525
421 2806077397 2802429637 Bacteria 7067217
422 2816505113 2816332139 Bacteria 9138787
423 2834578497 2834578030 Bacteria 3530182
424 2837679692 2837678835 Bacteria 5252418
425 2838025307 2838022645 Bacteria 6494267
426 2838036085 2838035591 Bacteria 7166484
427 2838068660 2838068647 Bacteria 6208656
428 2838667349 2838661181 Bacteria 7385261
429 2838669446 2838668709 Bacteria 6671819
430 2838701817 2838701080 Bacteria 6669771
431 2840770469 2840764183 Bacteria 6358399
432 2841865948 2841864319 Bacteria 6742987
433 2842116371 2842110456 Bacteria 7656360
434 2842164139 2842163707 Bacteria 6916235
435 2842196086 2842192696 Bacteria 6147454
436 2842200873 2842198810 Bacteria 6608673
437 2842209745 2842205361 Bacteria 6340321
438 2842219897 2842217011 Bacteria 7497767
439 2842251759 2842250916 Bacteria 6579627
440 2842264991 2842264693 Bacteria 6472963
441 2842283199 2842278818 Bacteria 6340002
442 2842320159 2842317721 Bacteria 6793725
443 2842347687 2842341865 Bacteria 7003929
444 2842364194 2842363717 Bacteria 6844742
445 2842397192 2842395702 Bacteria 6780583
446 2842405779 2842402390 Bacteria 6681310
447 2842412362 2842409023 Bacteria 6687331
448 2842419008 2842415677 Bacteria 6596907
449 2842422806 2842422224 Bacteria 6239196
450 2842428955 2842428310 Bacteria 6767288
451 2842435569 2842434925 Bacteria 6502746
452 2842441569 2842441272 Bacteria 6769273
453 2842458047 2842454564 Bacteria 8730687
454 2842463380 2842462802 Bacteria 6588055
455 2842469899 2842469257 Bacteria 6752936
456 2842489735 2842489311 Bacteria 6620893
457 2842498221 2842495871 Bacteria 6820686
458 2842872728 2842871566 Bacteria 4827117
459 2844164353 2844163670 Bacteria 7266046
460 2847421921 2847417321 Bacteria 6913799
461 2848996686 2848992105 Bacteria 6810864
462 2850084734 2850079185 Bacteria 6848280
463 2854917256 2854916844 Bacteria 5725939
464 2855829362 2855825444 Bacteria 6785811
465 2855844461 2855839649 Bacteria 7135830
466 2855874956 2855872281 Bacteria 6964271
467 2857517929 2857516855 Bacteria 7787325
468 2857546911 2857542790 Bacteria 5326616
469 2858806078 2858800743 Bacteria 6603254
470 2863070863 2863067949 Bacteria 8541735
471 2870783843 2870782633 Bacteria 9624083
472 2885273567 2885270888 Bacteria 9831543
473 2899260165 2899259804 Bacteria 3320927
474 2902687443 2902682994 Bacteria 8951596
475 2904583167 2904578770 Bacteria 5302906
476 2904625389 2904615490 Bacteria 10047340
477 2913297160 2913295892 Bacteria 6333755
478 2915985110 2915980308 Bacteria 6624279
479 2915988119 2915986958 Bacteria 6739310
480 2915993837 2915993759 Bacteria 7016183
481 2916005460 2916000859 Bacteria 6865702
482 2916008806 2916007675 Bacteria 6898660
483 2916021508 2916014648 Bacteria 6946486
484 2916021669 2916021584 Bacteria 6854472
485 2916028520 2916028427 Bacteria 6748433
486 2916037515 2916035215 Bacteria 6755766
487 2916042021 2916041962 Bacteria 6820487
488 2916048793 2916048683 Bacteria 6543552
489 2916059857 2916055098 Bacteria 6758838
490 2916067655 2916061851 Bacteria 6737736
491 2916070627 2916068649 Bacteria 6943657
492 2916077486 2916076590 Bacteria 6596108
493 2919123816 2919119836 Bacteria 5208557
494 2920826485 2920822456 Bacteria 6897201
495 2921205307 2921201388 Bacteria 6926299
496 2921212097 2921208531 Bacteria 6745326
497 2921237344 2921237296 Bacteria 6876710
498 2921249233 2921244191 Bacteria 6568419
499 2921256028 2921250672 Bacteria 6677771
500 2921259452 2921257292 Bacteria 6808382
501 2921268100 2921263974 Bacteria 6864552
502 2921288652 2921282425 Bacteria 6826397
503 2921295104 2921289301 Bacteria 7316391
504 2921298005 2921296804 Bacteria 7176999
505 2923562076 2923556063 Bacteria 6793593
506 2924150433 2924144063 Bacteria 6883928
507 2924157178 2924150972 Bacteria 7169444
508 2924161711 2924158325 Bacteria 7188855
509 2924171192 2924165586 Bacteria 7260590
510 2924175033 2924172951 Bacteria 6749356
511 2924182704 2924179722 Bacteria 6843264
512 2924189127 2924186466 Bacteria 6876637
513 2924196823 2924193448 Bacteria 6955718
514 2924200547 2924200457 Bacteria 6757188
515 2924212096 2924207177 Bacteria 6917007
516 2924219273 2924214083 Bacteria 7080103
517 2924223665 2924221636 Bacteria 7113495
518 2924233394 2924228884 Bacteria 6633132
519 2928523260 2928521798 Bacteria 4960112
520 2929143839 2929138655 Bacteria 5810547
521 2933018384 2933016740 Bacteria 6355406
522 2933592588 2933586486 Bacteria 7667493
523 2933600278 2933599457 Bacteria 5858799
524 2935903240 2935901341 Bacteria 7341747
525 2936374465 2936367885 Bacteria 7324495
526 2936378693 2936375103 Bacteria 6652732
527 2936998411 2936996657 Bacteria 6298727
528 2937003003 2937002841 Bacteria 6934057
529 2937009852 2937009748 Bacteria 6746052
530 2937019994 2937016420 Bacteria 6782579
531 2937025170 2937023124 Bacteria 6815156
532 2937034751 2937029754 Bacteria 6424026
533 2937041699 2937036028 Bacteria 6846469
534 2937049731 2937042894 Bacteria 6741576
535 2937054570 2937049772 Bacteria 6757901
536 2937058656 2937056579 Bacteria 7107896
537 2937063932 2937063883 Bacteria 7199456
538 2937077751 2937071275 Bacteria 6984483
539 2937083426 2937078374 Bacteria 6610289
540 2937090925 2937084907 Bacteria 6618516
541 2937094412 2937091812 Bacteria 6979387
542 2937101448 2937098957 Bacteria 7249374
543 2937108034 2937106411 Bacteria 6947143
544 2937115432 2937113482 Bacteria 6505872
545 2937120079 2937119839 Bacteria 6597547
546 2937128206 2937126314 Bacteria 6771275
547 2941506555 2941499720 Bacteria 7599444
548 2954015530 2954011201 Bacteria 4762601
549 2957380910 2957375807 Bacteria 6425588
550 2957382279 2957382221 Bacteria 6737050
551 2957395512 2957388812 Bacteria 6778072
552 2957397990 2957395598 Bacteria 6822399
553 2957404275 2957402308 Bacteria 6741770
554 2957414792 2957408893 Bacteria 6558585
555 2957421126 2957415311 Bacteria 6991633
556 2957429211 2957422303 Bacteria 7172205
557 2957431338 2957430029 Bacteria 7022557
558 2957442646 2957437181 Bacteria 6568994
559 2957446003 2957443900 Bacteria 6869977
560 2957451104 2957450854 Bacteria 6765715
561 2957461737 2957457609 Bacteria 6967680
562 2957465982 2957464669 Bacteria 6568877
563 2957474531 2957471148 Bacteria 6797643
564 2957483302 2957478035 Bacteria 6756658
565 2957487706 2957484790 Bacteria 6703082
566 2957496567 2957491536 Bacteria 6695180
567 2957502005 2957498199 Bacteria 7126688
568 2957505543 2957505466 Bacteria 7253085
569 2960584071 2960584000 Bacteria 6864594
570 2960596310 2960591022 Bacteria 6622873
571 2960603088 2960597568 Bacteria 6550735
572 2960604148 2960603979 Bacteria 6898737
573 2960610952 2960610863 Bacteria 6691244
574 2960622317 2960617483 Bacteria 6727748
575 2960624377 2960624210 Bacteria 6875384
576 2960636758 2960631154 Bacteria 6732508
577 2960637973 2960637947 Bacteria 7296468
578 2960649230 2960645483 Bacteria 7211087
579 2960653288 2960652885 Bacteria 7083688
580 2960663697 2960660292 Bacteria 7041660
581 2960667518 2960667422 Bacteria 6763020
582 2960676571 2960674078 Bacteria 6609048
583 2960685925 2960680706 Bacteria 6624464
584 2964611044 2964607997 Bacteria 7101408
585 2964615473 2964615318 Bacteria 6809089
586 2964628154 2964621998 Bacteria 6834995
587 2964628974 2964628898 Bacteria 7083044
588 2964636080 2964636051 Bacteria 7091832
589 2964643424 2964643177 Bacteria 6820887
590 2964653963 2964649959 Bacteria 6675118
591 2964656676 2964656573 Bacteria 7100150
592 2964664044 2964663802 Bacteria 7019362
593 2964676041 2964670856 Bacteria 6851364
594 2964682331 2964678106 Bacteria 6792020
595 2964690722 2964685014 Bacteria 6839111
596 2964698862 2964698721 Bacteria 6765331
597 2964707576 2964705432 Bacteria 7114648
598 2964717778 2964712639 Bacteria 6695970
599 2964721799 2964719344 Bacteria 7286602
600 2967664516 2967664464 Bacteria 6948836
601 2967672451 2967671571 Bacteria 7021409
602 2967683273 2967678726 Bacteria 7264382
603 2967691853 2967686174 Bacteria 6678622
604 2967698563 2967693043 Bacteria 6804451
605 2967706189 2967699805 Bacteria 6854538
606 2967713886 2967706974 Bacteria 7186053
607 2967718636 2967714385 Bacteria 7000047
608 2967723149 2967721400 Bacteria 7073753
609 2967734007 2967728569 Bacteria 6641507
610 2967737456 2967735183 Bacteria 6827012
611 2967748061 2967742019 Bacteria 6794534
612 2967749220 2967748971 Bacteria 6733771
613 2967755972 2967755722 Bacteria 6814706
614 2967762525 2967762386 Bacteria 6923502
615 2967769411 2967769361 Bacteria 6587838
616 2967778390 2967775926 Bacteria 6738189
617 2970019706 2970019648 Bacteria 7072033
618 2970027020 2970026789 Bacteria 6785236
619 2970033899 2970033650 Bacteria 7118744
620 2970044080 2970040964 Bacteria 6731123
621 2970051044 2970047711 Bacteria 7088379
622 2970058373 2970054988 Bacteria 6611507
623 2970065187 2970061556 Bacteria 7099761
624 2970075862 2970068827 Bacteria 7123112
625 2970077967 2970076120 Bacteria 6697332
626 2970084507 2970082768 Bacteria 6183754
627 2970091864 2970088815 Bacteria 6933825
628 2970097712 2970095765 Bacteria 6936963
629 2970102927 2970102677 Bacteria 6812532
630 2970111380 2970109326 Bacteria 6863976
631 2970119012 2970116247 Bacteria 6501857
632 2970129304 2970122695 Bacteria 6625855
633 2970135374 2970129317 Bacteria 6806560
634 2970143505 2970136068 Bacteria 7207982
635 2970149646 2970143518 Bacteria 6446480
636 2970152173 2970149975 Bacteria 6779706
637 2970160104 2970156795 Bacteria 7168044
638 2970164812 2970164137 Bacteria 6861252
639 2970171228 2970170962 Bacteria 6876229
640 2970179975 2970177841 Bacteria 6768001
641 2970191439 2970184632 Bacteria 7054431
642 2970195066 2970191845 Bacteria 7032787
643 2977521737 2977516862 Bacteria 6940108
644 2977525826 2977523885 Bacteria 6960446
645 2977536635 2977530762 Bacteria 6951399
646 2977539881 2977537788 Bacteria 6929320
647 2977550996 2977544691 Bacteria 6875412
648 2977556199 2977551784 Bacteria 7125765
649 2977559106 2977558990 Bacteria 6863948
650 2977566036 2977565890 Bacteria 6901543
651 2977574547 2977572785 Bacteria 6763888
652 2977584985 2977579622 Bacteria 6772100
653 2977979596 2977971508 Bacteria 7472917
654 2989353594 2989349275 Bacteria 6349068
655 2989774823 2989771324 Bacteria 5605128
656 2996312236 2996310559 Bacteria 6357320
657 639644821 639633055 Bacteria 7751309
658 643824179 643692032 Bacteria 6891900
659 648735473 648276728 Bacteria 6968865
660 8003996985 8003992118 Bacteria 7266902
661 8004004684 8003999396 Bacteria 7063185
662 8004397303 8004395343 Bacteria 6620908
663 8005277647 8005275841 Bacteria 6929066
664 8005288498 8005282627 Bacteria 6675747
665 8005290490 8005289223 Bacteria 6634003
666 8005301091 8005301065 Bacteria 6614431
667 8005308009 8005307578 Bacteria 7395396
668 8005379730 8005376324 Bacteria 6590079
669 8005431416 8005430974 Bacteria 6689030
670 8005467117 8005460587 Bacteria 7157962
671 8005502913 8005497431 Bacteria 6477605
672 8005571603 8005570704 Bacteria 6957481
673 8005624064 8005619151 Bacteria 7030230
674 8005629329 8005626139 Bacteria 6534237
675 8005674343 8005668836 Bacteria 6953162
676 8005689095 8005688590 Bacteria 6610080
677 8005697820 8005695170 Bacteria 6912330
678 8018132116 8018127388 Bacteria 7351159
679 8018180514 8018176218 Bacteria 6896178
680 8023681826 8023680758 Bacteria 7729763
681 8024482326 8024479707 Bacteria 6954785
682 8024507262 8024501048 Bacteria 6427847
683 8049297279 8049293176 Bacteria 6128433
684 8054475043 8054472261 Bacteria 7464355
685 8056211788 8056207758 Bacteria 8639239
686 8056377879 8056375014 Bacteria 7006639
687 8056382545 8056382006 Bacteria 6408074
688 8057878177 8057874678 Bacteria 7494653
689 Ga0307513_10024415
690 JGI25151J46595_10005696
691 rootH2_10039980
692 rootH1_10044850
693 JGI25160J50197_1001143
694 JGI25161J50226_1007798
695 Ga0055529_1000683
696 Ga0055526_1002351
697 Ga0055526_1046410
698 Ga0055524_1000517
699 Ga0055524_1002854
700 Ga0055524_1007706
701 Ga0055528_1000982
702 Ga0055528_1013213
703 Ga0055540_1000096
704 Ga0055540_1004097
705 Ga0055540_1007276
706 Ga0055531_10053546
707 Ga0065165_1005520
708 Ga0065704_10194511
709 Ga0070680_100067434
710 Ga0070671_100013519
711 Ga0068863_100001682
712 Ga0068862_100004591
713 Ga0081540_1000664
714 Ga0075365_10000808
715 Ga0075368_10041594
716 Ga0075364_10006271
717 Ga0075364_10008042
718 Ga0075364_10009352
719 Ga0075364_10036068
720 Ga0075364_10140890
721 Ga0075362_10002642
722 Ga0075366_10001529
723 Ga0075370_10003493
724 Ga0105247_10057365
725 Ga0123342_1024877
726 Ga0105239_11428250
727 Ga0157326_1008495
728 Ga0171463_1012
729 Ga0157379_10041012
730 Ga0183363_1193
731 Ga0214544_1000018
732 Ga0214542_1001937
733 Ga0214542_1024565
734 Ga0214542_1037892
735 Ga0214543_1000012
736 Ga0214543_1000042
737 Ga0214543_1000162
738 Ga0228711_1002155
739 Ga0228710_1002282
740 Ga0209455_1000503
741 Ga0209673_1000105
742 Ga0209673_1002092
743 Ga0209130_1013856
744 Ga0209564_1000913
745 Ga0209564_1001922
746 Ga0209564_1032182
747 Ga0209758_1000380
748 Ga0209050_1003406
749 Ga0209256_1000260
750 Ga0209256_1000281
751 Ga0209256_1001129
752 Ga0209256_1002297
753 Ga0207426_1000350
754 Ga0209051_1000027
755 Ga0209051_1001030
756 Ga0209051_1023350
757 Ga0209257_1001771
758 Ga0209257_1011780
759 Ga0207644_10010531
760 Ga0207641_10004926
761 Ga0209281_1000655
762 Ga0209281_1000789
763 Ga0209282_1000216
764 Ga0268266_10436754
765 Ga0307515_10000121
766 Ga0307515_10070741
767 Ga0307515_10202033
768 Ga0307513_10163080
769 Ga0307513_10488593
770 Ga0307405_10313770
771 Ga0307406_10101787
772 Ga0315914_1002167
773 Ga0307416_100237577
774 Ga0307414_10310820
775 Ga0315913_1000874
776 Ga0315915_1001277
777 Ga0395905_0000157
778 Ga0395905_0003131
779 Ga0400483_182281
780 Ga0439436_0025457
781 Ga0439436_0154682
782 Ga0439439_0034147
783 Ga0439466_0100521
784 Ga0439465_0003152
785 Ga0439465_0024355
786 Ga0451835_1258197
787 Ga0451841_0078269
788 Ga0451851_0389910
789 Ga0451855_1395754
790 Ga0451853_2152199
791 Ga0439449_0065659
792 Ga0450907_014384
793 Ga0439434_0148717
794 Ga0466958_0128555
795 Ga0466967_0226497
796 Ga0466967_0247429
797 Ga0495617_018024
798 Ga0495592_0000229
799 Ga0495590_0029931
800 Ga0495591_000101
801 Ga0495629_0000561
802 Ga0495638_0000163
803 Ga0495638_0008099
804 Ga0495638_0013770
805 Ga0495638_0023236
806 Ga0495638_0194310
807 Ga0495638_0277412
808 Ga0495641_0133854
809 Ga0495651_0000730
810 Ga0495653_0009573
811 Ga0495580_0000681
812 Ga0495605_0012887
813 Ga0495662_0018963
814 Ga0495664_0021184
815 Ga0495585_0015817
816 Ga0495585_0154128
817 Ga0495596_0000146
818 Ga0495583_0000449
819 Ga0495583_0064561
820 Ga0495583_0066549
821 Ga0495606_0002598
822 Ga0495608_0000241
823 Ga0495616_0038823
824 Ga0495618_0001966
825 Ga0495620_0064666
826 Ga0495628_0005725
827 Ga0495630_0000147
828 Ga0495631_0010810
829 Ga0495632_0007429
830 Ga0495648_0000164
831 Ga0495648_0013155
832 Ga0495648_0016222
833 Ga0495666_0000107
834 Ga0495652_0006343
835 Ga0495654_0000553
836 Ga0495665_0000827
837 Ga0495640_0000282
838 Ga0495586_0012956
839 Ga0495587_0002606
840 Ga0495609_0015374
841 Ga0495597_0032186
842 Ga0495667_0016834
843 Ga0495656_0139403
844 Ga0495668_0004281
845 Ga0495668_0146819
846 Ga0495634_0001199
847 Ga0495611_0014527
848 Ga0495625_0008338
849 Ga0495625_0038721
850 Ga0495625_0154478
851 Ga0495635_0000218
852 Ga0495661_0000818
853 Ga0495599_0001820
854 Ga0495623_0000895
855 Ga0495646_0000372
856 Ga0495613_0000353
857 Ga0495624_0000869
858 Ga0495671_0009578
859 Ga0495649_0000211
860 Ga0495649_0021376
861 Ga0495589_0000213
862 Ga0495600_0004656
863 Ga0495660_0050092
864 Ga0495581_0021845
865 Ga0495604_0004103
866 Ga0495674_0032747
867 Ga0495672_0001856
868 Ga0495672_0034279
869 Ga0495676_0016763
870 Ga0495680_0026038
871 Ga0495683_0000435
872 Ga0495683_0029434
873 Ga0495683_0128221
874 Ga0495675_0000151
875 Ga0495679_000093
876 Ga0495673_0002198
877 Ga0495673_0002375
878 Ga0495593_0000123
879 Ga0495602_0006996
880 Ga0495614_0000139
881 Ga0495626_0000623
882 Ga0495626_0091521
883 Ga0496100_0011869
884 Ga0496101_0001230
885 Ga0496102_0000030
886 Ga0496103_0000068
887 Ga0496104_0142888
888 Ga0496105_0023939
889 Ga0496107_0352649
890 Ga0496109_0213226
891 Ga0496111_0320724
892 Ga0496116_0000152
893 Ga0496116_0098478
894 Ga0496116_0157969
895 Ga0496117_0000059
896 Ga0496118_0000061
897 Ga0496119_0000431
898 Ga0496120_0005138
899 Ga0496120_0020033
900 Ga0496121_0000174
901 Ga0496121_0007649
902 Ga0496121_0089367
903 Ga0496122_0047492
904 Ga0496122_0284068
905 Ga0496123_0065207
906 Ga0496124_0000036
907 Ga0496124_0027824
908 Ga0496124_0059283
909 Ga0496125_0000093
910 Ga0496125_0000292
911 Ga0496125_0124168
912 Ga0496126_0000213
913 Ga0496126_0503450
914 Ga0495678_021209
915 Ga0495682_0000499
916 Ga0495682_0002037
917 Ga0495682_0041118
918 Ga0501033_0119062
919 Ga0501034_0006800
920 Ga0501034_0101292
921 Ga0501034_0196729
922 Ga0501036_0161103
923 Ga0501037_0026919
924 Ga0501037_0551708
925 Ga0501038_0140136
926 Ga0501043_0048042
927 Ga0501069_0057301
928 Ga0501069_0109020
929 Ga0501070_0004351
930 Ga0501070_0025986
931 Ga0501070_0597300
932 Ga0501072_0476087
933 Ga0501074_0043608
934 Ga0501076_0283990
935 Ga0501202_070714
936 Ga0501080_0038950
937 Ga0501035_0071459
938 Ga0501035_0235513
939 Ga0501035_0341724
940 Ga0501044_0055951
941 Ga0501044_0313997
942 nmdc:mga03683_2599_c1
943 nmdc:mga00v17_123288_c1
944 nmdc:mga00v17_15855_c1
945 nmdc:mga00v17_238387_c1
946 nmdc:mga00v17_47863_c1
947 nmdc:mga00v17_49367_c1
948 nmdc:mga00v17_4957_c1
949 nmdc:mga0yw44_40411_c1
950 nmdc:mga0k408_15225_c1
951 nmdc:mga0k408_460092_c1
952 nmdc:mga07m45_5702_c1
953 nmdc:mga0sz30_7116_c2
954 Ga0500578_0451004
955 Ga0500644_0073379
956 Ga0500557_002795
957 Ga0500569_030380
958 Ga0500594_0001612
959 Ga0500594_0132027
960 Ga0500642_0007323
961 Ga0500642_0079526
962 Ga0500658_0000932
963 Ga0500658_0003225
964 Ga0500568_0000210
965 Ga0500577_0020677
966 Ga0500577_0091198
967 Ga0500604_0011514
968 Ga0500616_0002480
969 Ga0500622_0082992
970 Ga0500609_001377
971 2509110661
972 2509377482
973 2509390738
974 2509442049
975 2510136346
976 2510248512
977 2510302957
978 2510892638
979 2511389458
980 2511496949
981 2512529388
982 2512969032
983 2513568643
984 2513583390
985 2513607014
986 2513614936
987 2513630495
988 2513711257
989 2513869981
990 2513883944
991 2513901610
992 2513914565
993 2513923927
994 2513987704
995 2514008832
996 2514018489
997 2515108709
998 2515612188
999 2515632573
1000 2515656576
1001 2515684197
1002 2515738192
1003 2516208232
1004 2516895821
1005 2517040642
1006 2517098271
1007 2517409766
1008 2517566215
1009 2524449177
1010 2530648917
1011 2551678709
1012 2551681947
1013 2551683268
1014 2551696710
1015 2551699874
1016 2551714127
1017 2551716751
1018 2551731400
1019 2551739075
1020 2551744250
1021 2558865016
1022 2585169482
1023 2585268573
1024 2585389236
1025 2585530001
1026 2585543464
1027 2585841920
1028 2585993718
1029 2586004567
1030 2599415969
1031 2600195624
1032 2616297845
1033 2643809560
1034 2643981712
1035 2644048911
1036 2644066709
1037 2644107102
1038 2644147843
1039 2644203689
1040 2644311407
1041 2644335116
1042 2644375900
1043 2644415078
1044 2644451489
1045 2644482878
1046 2644494955
1047 2644497624
1048 2644543977
1049 2644617082
1050 2644693135
1051 2657685148
1052 2692319576
1053 2719184680
1054 2719389304
1055 2719643061
1056 2719668673
1057 2719728700
1058 2720489366
1059 2720610040
1060 2720617464
1061 2720628610
1062 2720772560
1063 2721144391
1064 2721156344
1065 2721161761
1066 2721402070
1067 2722842906
1068 2723029999
1069 2723564404
1070 2723569955
1071 2724035903
1072 2724041725
1073 2724092589
1074 2724101502
1075 2724112972
1076 2725949610
1077 2730110532
1078 2730160795
1079 2730295877
1080 2739035359
1081 2765465603
1082 2766069102
1083 2770197598
1084 2792580923
1085 2792619308
1086 2792627081
1087 2792639884
1088 2792839211
1089 2793297831
1090 2793312615
1091 2793337561
1092 2793345570
1093 2793354978
1094 2793363718
1095 2793370346
1096 2802721847
1097 2802728549
1098 2802734593
1099 2802741210
1100 2802747493
1101 2802754063
1102 2804754402
1103 2805927239
1104 2805934333
1105 2806048281
1106 2806056066
1107 2806062883
1108 2806070487
1109 2806077397
1110 2816505113
1111 2834578497
1112 2837679692
1113 2838025307
1114 2838036085
1115 2838068660
1116 2838667349
1117 2838669446
1118 2838701817
1119 2840770469
1120 2841865948
1121 2842116371
1122 2842164139
1123 2842196086
1124 2842200873
1125 2842209745
1126 2842219897
1127 2842251759
1128 2842264991
1129 2842283199
1130 2842320159
1131 2842347687
1132 2842364194
1133 2842397192
1134 2842405779
1135 2842412362
1136 2842419008
1137 2842422806
1138 2842428955
1139 2842435569
1140 2842441569
1141 2842458047
1142 2842463380
1143 2842469899
1144 2842489735
1145 2842498221
1146 2842872728
1147 2844164353
1148 2847421921
1149 2848996686
1150 2850084734
1151 2854917256
1152 2855829362
1153 2855844461
1154 2855874956
1155 2857517929
1156 2857546911
1157 2858806078
1158 2863070863
1159 2870783843
1160 2885273567
1161 2899260165
1162 2902687443
1163 2904583167
1164 2904625389
1165 2913297160
1166 2915985110
1167 2915988119
1168 2915993837
1169 2916005460
1170 2916008806
1171 2916021508
1172 2916021669
1173 2916028520
1174 2916037515
1175 2916042021
1176 2916048793
1177 2916059857
1178 2916067655
1179 2916070627
1180 2916077486
1181 2919123816
1182 2920826485
1183 2921205307
1184 2921212097
1185 2921237344
1186 2921249233
1187 2921256028
1188 2921259452
1189 2921268100
1190 2921288652
1191 2921295104
1192 2921298005
1193 2923562076
1194 2924150433
1195 2924157178
1196 2924161711
1197 2924171192
1198 2924175033
1199 2924182704
1200 2924189127
1201 2924196823
1202 2924200547
1203 2924212096
1204 2924219273
1205 2924223665
1206 2924233394
1207 2928523260
1208 2929143839
1209 2933018384
1210 2933592588
1211 2933600278
1212 2935903240
1213 2936374465
1214 2936378693
1215 2936998411
1216 2937003003
1217 2937009852
1218 2937019994
1219 2937025170
1220 2937034751
1221 2937041699
1222 2937049731
1223 2937054570
1224 2937058656
1225 2937063932
1226 2937077751
1227 2937083426
1228 2937090925
1229 2937094412
1230 2937101448
1231 2937108034
1232 2937115432
1233 2937120079
1234 2937128206
1235 2941506555
1236 2954015530
1237 2957380910
1238 2957382279
1239 2957395512
1240 2957397990
1241 2957404275
1242 2957414792
1243 2957421126
1244 2957429211
1245 2957431338
1246 2957442646
1247 2957446003
1248 2957451104
1249 2957461737
1250 2957465982
1251 2957474531
1252 2957483302
1253 2957487706
1254 2957496567
1255 2957502005
1256 2957505543
1257 2960584071
1258 2960596310
1259 2960603088
1260 2960604148
1261 2960610952
1262 2960622317
1263 2960624377
1264 2960636758
1265 2960637973
1266 2960649230
1267 2960653288
1268 2960663697
1269 2960667518
1270 2960676571
1271 2960685925
1272 2964611044
1273 2964615473
1274 2964628154
1275 2964628974
1276 2964636080
1277 2964643424
1278 2964653963
1279 2964656676
1280 2964664044
1281 2964676041
1282 2964682331
1283 2964690722
1284 2964698862
1285 2964707576
1286 2964717778
1287 2964721799
1288 2967664516
1289 2967672451
1290 2967683273
1291 2967691853
1292 2967698563
1293 2967706189
1294 2967713886
1295 2967718636
1296 2967723149
1297 2967734007
1298 2967737456
1299 2967748061
1300 2967749220
1301 2967755972
1302 2967762525
1303 2967769411
1304 2967778390
1305 2970019706
1306 2970027020
1307 2970033899
1308 2970044080
1309 2970051044
1310 2970058373
1311 2970065187
1312 2970075862
1313 2970077967
1314 2970084507
1315 2970091864
1316 2970097712
1317 2970102927
1318 2970111380
1319 2970119012
1320 2970129304
1321 2970135374
1322 2970143505
1323 2970149646
1324 2970152173
1325 2970160104
1326 2970164812
1327 2970171228
1328 2970179975
1329 2970191439
1330 2970195066
1331 2977521737
1332 2977525826
1333 2977536635
1334 2977539881
1335 2977550996
1336 2977556199
1337 2977559106
1338 2977566036
1339 2977574547
1340 2977584985
1341 2977979596
1342 2989353594
1343 2989774823
1344 2996312236
1345 639644821
1346 643824179
1347 648735473
1348 8003996985
1349 8004004684
1350 8004397303
1351 8005277647
1352 8005288498
1353 8005290490
1354 8005301091
1355 8005308009
1356 8005379730
1357 8005431416
1358 8005467117
1359 8005502913
1360 8005571603
1361 8005624064
1362 8005629329
1363 8005674343
1364 8005689095
1365 8005697820
1366 8018132116
1367 8018180514
1368 8023681826
1369 8024482326
1370 8024507262
1371 8049297279
1372 8054475043
1373 8056211788
1374 8056377879
1375 8056382545
1376 8057878177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

30

216

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8844 4 208
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8468 4 208
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8264 10 209
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.8113 10 201
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8112 8 209
ID Description Score Start End Superfamily
af_P45767_178_390_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9495 78 209 1.10.3720.10
af_P0AER3_18_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9365 7 209 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9297 6 210 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9286 6 212 1.10.3720.10
af_P0AE34_6_232_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9225 11 210 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A853ACP7-F1-model_v4 Polar amino acid transport system permease protein 0.9799 6 214 GO:0006865
GO:0022857
GO:0043190
AF-A0A7G9NUD2-F1-model_v4 Ectoine/hydroxyectoine ABC transporter permease subunit EhuC 0.9756 7 215 GO:0006865
GO:0022857
GO:0043190
AF-A0A5C5V8I1-F1-model_v4 Inner membrane amino-acid ABC transporter permease protein YecS 0.9744 8 214 GO:0006865
GO:0022857
GO:0043190
AF-A0A7U9KXX8-F1-model_v4 Ectoine/hydroxyectoine ABC transporter permease subunit EhuC 0.9742 6 214 GO:0006865
GO:0022857
GO:0043190
AF-A0A7W4JQA3-F1-model_v4 Ectoine/hydroxyectoine ABC transporter permease subunit EhuC 0.974 1 210 GO:0006865
GO:0022857
GO:0043190

Map