F475340

General Info

Members Datasets Scaffolds Average Seq Length
688 413 1376 256

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0032508|Ga0395905_0032508_3948_4844
Length 298
Sequence MSIATRLAWSIFGFVLGVLAAPCLELIILYNNNPPIRQPGDMNTPDIHFELQGAVAIVRLARPAKRNAISDELILGIRSTFESMPEGVGAIVLDGQGDHFCAGLDLSELKERDAGAGMHHSRMWHAALETVQFGPAPVIAALHGAVVGGGLELAAACHIRVADETAFYSLPEGSRGIFVGGGGAVRIPRLIGEARMADMMFTGRVYDAKEGERIGLSQYIVPAGTAFAKAMELAERVAKNAPLTNYALMHALPRISEQPADQGFLTEALMAAIAQSAPEAKTRVREFLEGRGPKVKKG

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
111 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
157 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
159 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
168 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
169 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
170 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
171 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
172 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
173 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
174 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
194 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
195 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
212 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
213 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
214 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
218 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
228 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
229 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
232 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
233 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
234 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
235 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
236 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
237 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
238 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
239 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
242 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
294 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
295 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
298 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
299 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
332 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
333 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
334 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
335 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
338 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
350 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
353 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
354 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
355 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
356 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
357 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
358 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
361 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
364 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
365 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
366 2547132374 Acidovorax radicis N35 Isolate Unclassified
367 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
368 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
369 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
370 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
371 2643221570 Acidovorax sp. Root568 Isolate Unclassified
372 2643221596 Acidovorax sp. Root70 Isolate Unclassified
373 2643221611 Acidovorax sp. Root219 Isolate Unclassified
374 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
375 2643221652 Acidovorax sp. Root402 Isolate Unclassified
376 2643221658 Variovorax sp. Root411 Isolate Unclassified
377 2643221672 Variovorax sp. Root434 Isolate Unclassified
378 2643221683 Variovorax sp. Root473 Isolate Unclassified
379 2643221717 Acidovorax sp. Root267 Isolate Unclassified
380 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
381 2738541277 Variovorax sp. GV051 Isolate Unclassified
382 2738541307 Variovorax sp. GV008 Isolate Unclassified
383 2738543012 Acidovorax sp. CF301 Isolate Unclassified
384 2738543013 Variovorax sp. BT01 Isolate Unclassified
385 2738543019 Variovorax sp. GV040 Isolate Unclassified
386 2816332133 Acidovorax radicis 2721A Isolate Unclassified
387 2818991446 Variovorax sp. 1180 Isolate Unclassified
388 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
389 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
390 2842677519 Variovorax sp. R-72495 Isolate Unclassified
391 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
392 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
393 2885198086 Variovorax sp. 679 Isolate Unclassified
394 2885211737 Variovorax sp. 553 Isolate Unclassified
395 2899924645 Variovorax sp. 369 Isolate Unclassified
396 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
397 2904456579 Variovorax sp. 2002 Isolate Unclassified
398 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
399 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
400 2928037797 Variovorax sp. 1126 Isolate Unclassified
401 2928044640 Variovorax sp. 1128 Isolate Unclassified
402 2928051484 Variovorax sp. 1133 Isolate Unclassified
403 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
404 2928070936 Variovorax gossypii 1167 Isolate Unclassified
405 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
406 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
407 2929520902 Variovorax beijingensis 502 Isolate Unclassified
408 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
409 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
410 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
411 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
412 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
413 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.3
Metatranscriptomes 0.44
Isolates 7.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.47
Nodule 1.16
Rhizoplane 6.25
Rhizosphere 54.65
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0032508 3300037471 Bacteria 4907
2 JGI24739J22299_10034117 3300001989 Bacteria 1736
3 JGI25155J39150_1000009 3300002704 Bacteria 224358
4 JGI25156J39149_1000009 3300002705 Bacteria 224379
5 JGI25154J39366_1000024 3300002738 Bacteria 211372
6 JGI25157J39369_1000007 3300002741 Bacteria 224377
7 JGI25152J39213_1010759 3300002773 Bacteria 2068
8 JGI25150J39212_1005464 3300002774 Bacteria 2709
9 JGI25159J45721_1000286 3300002987 Bacteria 23822
10 JGI25151J46595_10010871 3300003187 Bacteria 4211
11 JGI25151J46595_10013564 3300003187 Bacteria 3663
12 JGI25151J46595_10028708 3300003187 Bacteria 2212
13 JGI25153J46596_10026233 3300003215 Bacteria 2067
14 JGI25153J46596_10036612 3300003215 Bacteria 1570
15 rootH1_10010835 3300003316 Bacteria 3326
16 rootH2_10131427 3300003320 Bacteria 2314
17 rootH1_10398388 3300003323 Bacteria 1153
18 JGI25160J50197_1000242 3300003354 Bacteria 42399
19 JGI25161J50226_1000009 3300003374 Bacteria 224699
20 Ga0006562J51391_1032156 3300003578 Bacteria 1910
21 Ga0006562J51391_1050707 3300003578 Bacteria 1180
22 Ga0055535_1000422 3300003761 Bacteria 39771
23 Ga0055542_1000074 3300003762 Bacteria 141185
24 Ga0055526_1000764 3300003771 Bacteria 24002
25 Ga0055526_1002603 3300003771 Bacteria 12065
26 Ga0055537_1000235 3300003773 Bacteria 40558
27 Ga0055537_1001179 3300003773 Bacteria 11166
28 Ga0055537_1004150 3300003773 Bacteria 4225
29 Ga0055537_1005789 3300003773 Bacteria 3247
30 Ga0055537_1008729 3300003773 Bacteria 2307
31 Ga0055524_1000143 3300003775 Bacteria 84686
32 Ga0055536_1001550 3300003781 Bacteria 13780
33 Ga0055536_1002402 3300003781 Bacteria 10534
34 Ga0055534_1000612 3300003784 Bacteria 18479
35 Ga0055534_1001150 3300003784 Bacteria 11173
36 Ga0055534_1007325 3300003784 Bacteria 2643
37 Ga0055534_1009176 3300003784 Bacteria 2169
38 Ga0055534_1009747 3300003784 Bacteria 2061
39 Ga0055528_1001546 3300003790 Bacteria 13849
40 Ga0055528_1003188 3300003790 Bacteria 8390
41 Ga0055528_1007187 3300003790 Bacteria 4953
42 Ga0055528_1012716 3300003790 Bacteria 3247
43 Ga0055528_1022021 3300003790 Bacteria 1998
44 Ga0055530_10000474 3300003791 Bacteria 34978
45 Ga0055530_10001693 3300003791 Bacteria 15609
46 Ga0055530_10012948 3300003791 Bacteria 2877
47 Ga0055530_10053448 3300003791 Bacteria 927
48 Ga0055540_1000027 3300003792 Bacteria 187454
49 Ga0055540_1001360 3300003792 Bacteria 14663
50 Ga0055540_1004336 3300003792 Bacteria 6448
51 Ga0055531_10000465 3300003794 Bacteria 37499
52 Ga0055531_10001603 3300003794 Bacteria 16421
53 Ga0055531_10001892 3300003794 Bacteria 14663
54 Ga0055543_1001141 3300004625 Bacteria 11343
55 Ga0055543_1001635 3300004625 Bacteria 8548
56 Ga0065165_1004502 3300005262 Bacteria 8567
57 Ga0065165_1005558 3300005262 Bacteria 7011
58 Ga0065165_1006879 3300005262 Bacteria 5781
59 Ga0065714_10105539 3300005288 Bacteria 1536
60 Ga0070658_10034550 3300005327 Bacteria 4068
61 Ga0070658_10108697 3300005327 Bacteria 2296
62 Ga0070683_100056060 3300005329 Bacteria 3659
63 Ga0070666_10106400 3300005335 Bacteria 1938
64 Ga0070680_100136961 3300005336 Bacteria 2051
65 Ga0068868_100056705 3300005338 Bacteria 3094
66 Ga0068868_100114392 3300005338 Bacteria 2195
67 Ga0070660_100029168 3300005339 Bacteria 4133
68 Ga0070689_100005913 3300005340 Bacteria 8413
69 Ga0070673_100331359 3300005364 Bacteria 1347
70 Ga0070659_100293976 3300005366 Bacteria 1353
71 Ga0070667_100017811 3300005367 Bacteria 5886
72 Ga0070667_100629041 3300005367 Bacteria 990
73 Ga0070663_100107872 3300005455 Bacteria 2088
74 Ga0070678_100210272 3300005456 Bacteria 1611
75 Ga0070662_100009652 3300005457 Bacteria 6313
76 Ga0070662_100309717 3300005457 Bacteria 1285
77 Ga0068867_100030840 3300005459 Bacteria 3867
78 Ga0070707_100184730 3300005468 Bacteria 2033
79 Ga0070679_100206942 3300005530 Bacteria 1926
80 Ga0068853_100059027 3300005539 Bacteria 3313
81 Ga0068853_100074017 3300005539 Bacteria 2971
82 Ga0068853_100255784 3300005539 Bacteria 1608
83 Ga0070665_100011220 3300005548 Bacteria 9060
84 Ga0068855_100605676 3300005563 Bacteria 1181
85 Ga0070664_100006223 3300005564 Bacteria 9642
86 Ga0070664_100053777 3300005564 Bacteria 3414
87 Ga0070664_100121530 3300005564 Bacteria 2287
88 Ga0068857_100042748 3300005577 Bacteria 4020
89 Ga0068854_100155187 3300005578 Bacteria 1768
90 Ga0068852_100018914 3300005616 Bacteria 5440
91 Ga0068852_100411181 3300005616 Bacteria 1333
92 Ga0068864_100093567 3300005618 Bacteria 2655
93 Ga0068864_100161123 3300005618 Bacteria 2039
94 Ga0068864_100452994 3300005618 Bacteria 1227
95 Ga0068866_10263672 3300005718 Bacteria 1060
96 Ga0068866_10267595 3300005718 Bacteria 1053
97 Ga0068861_100043266 3300005719 Bacteria 3379
98 Ga0068851_10004316 3300005834 Bacteria 6400
99 Ga0068870_10019601 3300005840 Bacteria 3282
100 Ga0068863_100181602 3300005841 Unclassified 2020
101 Ga0068862_100120510 3300005844 Bacteria 2312
102 Ga0075365_10007399 3300006038 Bacteria 6144
103 Ga0075365_10041110 3300006038 Bacteria 3018
104 Ga0075365_10046436 3300006038 Bacteria 2852
105 Ga0075363_100054659 3300006048 Bacteria 2137
106 Ga0075363_100056327 3300006048 Bacteria 2107
107 Ga0075363_100065449 3300006048 Bacteria 1965
108 Ga0075363_100112523 3300006048 Bacteria 1514
109 Ga0075363_100150362 3300006048 Bacteria 1314
110 Ga0075363_100165829 3300006048 Bacteria 1252
111 Ga0075432_10010858 3300006058 Bacteria 3095
112 Ga0075362_10029242 3300006177 Bacteria 2373
113 Ga0075362_10071658 3300006177 Bacteria 1583
114 Ga0075362_10099937 3300006177 Bacteria 1355
115 Ga0075362_10119556 3300006177 Bacteria 1246
116 Ga0075362_10184126 3300006177 Bacteria 1013
117 Ga0075367_10140358 3300006178 Bacteria 1496
118 Ga0075366_10002402 3300006195 Bacteria 9611
119 Ga0075366_10010869 3300006195 Bacteria 5122
120 Ga0075366_10061274 3300006195 Bacteria 2236
121 Ga0075366_10160694 3300006195 Bacteria 1361
122 Ga0097621_100014841 3300006237 Bacteria 5843
123 Ga0075370_10000174 3300006353 Bacteria 22330
124 Ga0075370_10009118 3300006353 Bacteria 5134
125 Ga0075370_10024397 3300006353 Bacteria 3339
126 Ga0075370_10063897 3300006353 Bacteria 2099
127 Ga0075370_10250572 3300006353 Bacteria 1049
128 Ga0068871_100820359 3300006358 Bacteria 858
129 Ga0075430_100050168 3300006846 Bacteria 3521
130 Ga0079104_1022241 3300006946 Bacteria 1710
131 Ga0079104_1042794 3300006946 Bacteria 1047
132 Ga0099826_10003378 3300006948 Bacteria 10802
133 Ga0105244_10001684 3300009036 Bacteria 17460
134 Ga0105240_10075554 3300009093 Bacteria 4156
135 Ga0111539_10043864 3300009094 Bacteria 5360
136 Ga0105245_10103501 3300009098 Bacteria 2638
137 Ga0105245_10112726 3300009098 Bacteria 2531
138 Ga0105243_10000651 3300009148 Bacteria 34393
139 Ga0105243_10022415 3300009148 Bacteria 4800
140 Ga0105241_10035536 3300009174 Bacteria 3747
141 Ga0105241_10056041 3300009174 Bacteria 3021
142 Ga0105241_10660247 3300009174 Bacteria 951
143 Ga0105248_10079427 3300009177 Bacteria 3687
144 Ga0105237_10010332 3300009545 Bacteria 9943
145 Ga0105237_10195666 3300009545 Bacteria 2022
146 Ga0105237_10339405 3300009545 Bacteria 1507
147 Ga0105238_10061871 3300009551 Bacteria 3745
148 Ga0105238_10394048 3300009551 Bacteria 1377
149 Ga0105249_10086461 3300009553 Bacteria 2924
150 Ga0105239_10052265 3300010375 Bacteria 4480
151 Ga0105239_10422318 3300010375 Bacteria 1511
152 Ga0105246_10244001 3300011119 Bacteria 1422
153 Ga0157326_1002040 3300012513 Bacteria 2190
154 Ga0157373_10097251 3300013100 Bacteria 2072
155 Ga0157373_10101670 3300013100 Bacteria 2022
156 Ga0157371_10011999 3300013102 Bacteria 6641
157 Ga0157370_10010090 3300013104 Bacteria 9977
158 Ga0157369_10104078 3300013105 Bacteria 3023
159 Ga0157378_10113331 3300013297 Bacteria 2489
160 Ga0157378_10214115 3300013297 Bacteria 1828
161 Ga0163162_10004457 3300013306 Bacteria 13490
162 Ga0163162_10141172 3300013306 Bacteria 2522
163 Ga0163162_10290805 3300013306 Bacteria 1766
164 Ga0163162_10603683 3300013306 Bacteria 1223
165 Ga0163162_10701174 3300013306 Bacteria 1134
166 Ga0163163_10032774 3300014325 Bacteria 5020
167 Ga0163163_10151219 3300014325 Bacteria 2365
168 Ga0157380_10102885 3300014326 Bacteria 2382
169 Ga0182008_10002904 3300014497 Bacteria 10607
170 Ga0182008_10003704 3300014497 Bacteria 9120
171 Ga0182008_10049983 3300014497 Bacteria 2075
172 Ga0157379_10030520 3300014968 Bacteria 4798
173 Ga0157376_10001487 3300014969 Bacteria 15450
174 Ga0157376_10315775 3300014969 Bacteria 1484
175 Ga0157376_10458427 3300014969 Bacteria 1245
176 Ga0182006_1001051 3300015261 Bacteria 17843
177 Ga0182007_10001491 3300015262 Bacteria 12532
178 Ga0182007_10006789 3300015262 Bacteria 4875
179 Ga0183362_10005 3300015683 Bacteria 437616
180 Ga0163161_10010507 3300017792 Bacteria 6411
181 Ga0163161_10080406 3300017792 Bacteria 2398
182 Ga0163161_10100266 3300017792 Bacteria 2155
183 Ga0209435_100051 3300025206 Bacteria 90866
184 Ga0209672_100519 3300025228 Bacteria 21142
185 Ga0209147_100419 3300025229 Bacteria 27989
186 Ga0209258_100176 3300025242 Bacteria 141261
187 Ga0207425_1000873 3300025245 Bacteria 14742
188 Ga0207425_1001688 3300025245 Bacteria 8790
189 Ga0207425_1001776 3300025245 Bacteria 8382
190 Ga0209646_1000029 3300025246 Bacteria 386414
191 Ga0209026_1000016 3300025250 Bacteria 386457
192 Ga0209148_1000033 3300025254 Bacteria 555508
193 Ga0209759_1000016 3300025256 Bacteria 386414
194 Ga0209129_1000270 3300025258 Bacteria 50956
195 Ga0209129_1003689 3300025258 Bacteria 6499
196 Ga0209129_1008653 3300025258 Bacteria 2799
197 Ga0209129_1008732 3300025258 Bacteria 2776
198 Ga0209129_1010651 3300025258 Bacteria 2274
199 Ga0209565_1000020 3300025263 Bacteria 432627
200 Ga0209565_1000122 3300025263 Bacteria 111132
201 Ga0209565_1000373 3300025263 Bacteria 38291
202 Ga0209565_1001818 3300025263 Bacteria 8564
203 Ga0209565_1003152 3300025263 Bacteria 5498
204 Ga0209673_1000209 3300025273 Bacteria 117670
205 Ga0209673_1000302 3300025273 Bacteria 91221
206 Ga0209673_1001386 3300025273 Bacteria 23772
207 Ga0209673_1003803 3300025273 Bacteria 8564
208 Ga0209130_1000014 3300025284 Bacteria 412039
209 Ga0209130_1000335 3300025284 Bacteria 53993
210 Ga0209130_1000487 3300025284 Bacteria 40823
211 Ga0209130_1000495 3300025284 Bacteria 40276
212 Ga0209130_1001175 3300025284 Bacteria 18766
213 Ga0209130_1007904 3300025284 Bacteria 3211
214 Ga0209130_1013513 3300025284 Bacteria 2087
215 Ga0209675_1000014 3300025291 Bacteria 421902
216 Ga0209675_1000098 3300025291 Bacteria 130512
217 Ga0209675_1001308 3300025291 Bacteria 14763
218 Ga0209675_1003982 3300025291 Bacteria 6748
219 Ga0209675_1005447 3300025291 Bacteria 5326
220 Ga0209675_1014889 3300025291 Bacteria 2341
221 Ga0209676_1000013 3300025292 Bacteria 816080
222 Ga0209676_1000048 3300025292 Bacteria 403716
223 Ga0209676_1000124 3300025292 Bacteria 194206
224 Ga0209676_1000604 3300025292 Bacteria 52933
225 Ga0209676_1003874 3300025292 Bacteria 8733
226 Ga0209676_1006692 3300025292 Bacteria 5613
227 Ga0209025_1000324 3300025294 Bacteria 106257
228 Ga0209025_1000597 3300025294 Bacteria 65153
229 Ga0209025_1000733 3300025294 Bacteria 55578
230 Ga0209025_1004202 3300025294 Bacteria 12704
231 Ga0209025_1005897 3300025294 Bacteria 9789
232 Ga0209025_1005974 3300025294 Bacteria 9674
233 Ga0209025_1010658 3300025294 Bacteria 6191
234 Ga0209025_1016839 3300025294 Bacteria 4271
235 Ga0209564_1000423 3300025295 Bacteria 74528
236 Ga0209564_1001169 3300025295 Bacteria 30538
237 Ga0209564_1001202 3300025295 Bacteria 29560
238 Ga0209564_1003808 3300025295 Bacteria 9782
239 Ga0209564_1004130 3300025295 Bacteria 9113
240 Ga0209758_1000833 3300025297 Bacteria 43061
241 Ga0209758_1003579 3300025297 Bacteria 13912
242 Ga0209758_1025763 3300025297 Bacteria 2569
243 Ga0209050_1000008 3300025298 Bacteria 1144179
244 Ga0209050_1000012 3300025298 Bacteria 813717
245 Ga0209050_1001045 3300025298 Bacteria 34179
246 Ga0209050_1002039 3300025298 Bacteria 18656
247 Ga0209050_1006385 3300025298 Bacteria 6995
248 Ga0209256_1000039 3300025299 Bacteria 372337
249 Ga0209256_1000095 3300025299 Bacteria 206120
250 Ga0209256_1000527 3300025299 Bacteria 55578
251 Ga0207426_1000161 3300025302 Bacteria 172765
252 Ga0207426_1000224 3300025302 Bacteria 130233
253 Ga0207426_1000955 3300025302 Bacteria 28485
254 Ga0207426_1001771 3300025302 Bacteria 16279
255 Ga0209051_1000005 3300025303 Bacteria 1142353
256 Ga0209051_1000019 3300025303 Bacteria 511268
257 Ga0209051_1000099 3300025303 Bacteria 165161
258 Ga0209051_1000117 3300025303 Bacteria 150156
259 Ga0209051_1000207 3300025303 Bacteria 103683
260 Ga0209051_1000833 3300025303 Bacteria 31762
261 Ga0209051_1011109 3300025303 Bacteria 4474
262 Ga0209051_1078175 3300025303 Bacteria 965
263 Ga0209257_1000024 3300025304 Bacteria 726068
264 Ga0209257_1000031 3300025304 Bacteria 688770
265 Ga0209257_1000161 3300025304 Bacteria 176089
266 Ga0209257_1000258 3300025304 Bacteria 122220
267 Ga0209257_1004843 3300025304 Bacteria 9963
268 Ga0209257_1009295 3300025304 Bacteria 5309
269 Ga0209257_1011333 3300025304 Bacteria 4311
270 Ga0209257_1061272 3300025304 Bacteria 1021
271 Ga0207656_10007159 3300025321 Bacteria 4055
272 Ga0207656_10036545 3300025321 Bacteria 2062
273 Ga0207655_1001510 3300025728 Bacteria 21219
274 Ga0207655_1079886 3300025728 Bacteria 1184
275 Ga0207680_10272860 3300025903 Bacteria 1173
276 Ga0207645_10005156 3300025907 Bacteria 9549
277 Ga0207645_10008002 3300025907 Bacteria 7415
278 Ga0207695_10133853 3300025913 Bacteria 2434
279 Ga0207657_10026290 3300025919 Bacteria 5351
280 Ga0207657_10041810 3300025919 Bacteria 4049
281 Ga0207652_10178927 3300025921 Bacteria 1905
282 Ga0207694_10319898 3300025924 Bacteria 1280
283 Ga0207650_10001983 3300025925 Bacteria 14357
284 Ga0207650_10253994 3300025925 Bacteria 1424
285 Ga0207687_10034205 3300025927 Bacteria 3450
286 Ga0207687_10046561 3300025927 Bacteria 3003
287 Ga0207644_10030857 3300025931 Bacteria 3731
288 Ga0207706_10001771 3300025933 Bacteria 21193
289 Ga0207706_10008031 3300025933 Bacteria 9739
290 Ga0207706_10142747 3300025933 Bacteria 2106
291 Ga0207709_10000313 3300025935 Bacteria 52906
292 Ga0207709_10000669 3300025935 Bacteria 27749
293 Ga0207670_10043362 3300025936 Bacteria 2970
294 Ga0207669_10422166 3300025937 Bacteria 1050
295 Ga0207691_10003250 3300025940 Bacteria 15835
296 Ga0207691_10242744 3300025940 Bacteria 1557
297 Ga0207711_10046284 3300025941 Bacteria 3717
298 Ga0207689_10012071 3300025942 Bacteria 7400
299 Ga0207689_10161431 3300025942 Bacteria 1846
300 Ga0207679_10010834 3300025945 Bacteria 5877
301 Ga0207667_10898832 3300025949 Bacteria 877
302 Ga0207640_10033788 3300025981 Bacteria 3186
303 Ga0207640_10344330 3300025981 Bacteria 1195
304 Ga0207658_10089906 3300025986 Bacteria 2378
305 Ga0207677_10050142 3300026023 Bacteria 2822
306 Ga0207677_10068824 3300026023 Bacteria 2487
307 Ga0207639_10003657 3300026041 Bacteria 10333
308 Ga0207678_10002574 3300026067 Bacteria 16522
309 Ga0207708_10000993 3300026075 Bacteria 21204
310 Ga0207702_10144336 3300026078 Bacteria 2158
311 Ga0207702_10320911 3300026078 Bacteria 1475
312 Ga0207641_10253602 3300026088 Bacteria 1644
313 Ga0207648_10000840 3300026089 Bacteria 34588
314 Ga0207648_10012123 3300026089 Bacteria 8084
315 Ga0207648_10238338 3300026089 Bacteria 1619
316 Ga0207674_10033584 3300026116 Bacteria 5370
317 Ga0207674_10243751 3300026116 Bacteria 1744
318 Ga0207683_10004959 3300026121 Bacteria 11445
319 Ga0209281_1018111 3300027111 Bacteria 1415
320 Ga0209281_1029678 3300027111 Bacteria 985
321 Ga0209973_1002078 3300027252 Bacteria 1829
322 Ga0209282_1003178 3300027666 Bacteria 9720
323 Ga0209971_1005374 3300027682 Bacteria 3045
324 Ga0209813_10078738 3300027866 Bacteria 1085
325 Ga0209974_10015870 3300027876 Bacteria 2501
326 Ga0207428_10098286 3300027907 Bacteria 2265
327 Ga0268266_10021473 3300028379 Bacteria 5499
328 Ga0268265_10247966 3300028380 Bacteria 1575
329 Ga0268264_10090835 3300028381 Bacteria 2633
330 Ga0307515_10000040 3300028794 Bacteria 322704
331 Ga0307515_10000458 3300028794 Bacteria 97523
332 Ga0307515_10106766 3300028794 Bacteria 3317
333 Ga0307515_10147541 3300028794 Bacteria 2482
334 Ga0307512_10174892 3300030522 Bacteria 1221
335 Ga0316177_1103696 3300030731 Bacteria 2402
336 Ga0314311_1049345 3300030733 Bacteria 11896
337 Ga0316178_1053423 3300030735 Bacteria 7152
338 Ga0316183_1023591 3300030742 Bacteria 5350
339 Ga0316183_1194403 3300030742 Bacteria 2630
340 Ga0316181_1061609 3300030744 Bacteria 914
341 Ga0316182_1044621 3300030745 Bacteria 5736
342 Ga0265330_10054816 3300031235 Bacteria 1742
343 Ga0265332_10003751 3300031238 Bacteria 7264
344 Ga0265331_10060652 3300031250 Bacteria 1786
345 Ga0265327_10119761 3300031251 Bacteria 1248
346 Ga0265327_10140962 3300031251 Bacteria 1127
347 Ga0307513_10000194 3300031456 Bacteria 87921
348 Ga0307513_10001393 3300031456 Bacteria 34808
349 Ga0307513_10154016 3300031456 Bacteria 2201
350 Ga0307408_100000171 3300031548 Bacteria 73180
351 Ga0307408_100007277 3300031548 Bacteria 7321
352 Ga0307408_100076061 3300031548 Bacteria 2496
353 Ga0307514_10000828 3300031649 Bacteria 49982
354 Ga0307514_10026727 3300031649 Bacteria 4666
355 Ga0316579_10000177 3300031691 Bacteria 18623
356 Ga0265314_10020869 3300031711 Bacteria 5050
357 Ga0265314_10036600 3300031711 Bacteria 3565
358 Ga0265342_10022315 3300031712 Bacteria 4027
359 Ga0265342_10047726 3300031712 Bacteria 2569
360 Ga0316576_10018905 3300031727 Bacteria 4713
361 Ga0316578_10028686 3300031728 Bacteria 3153
362 Ga0307516_10006663 3300031730 Bacteria 13500
363 Ga0307405_10028542 3300031731 Bacteria 3251
364 Ga0307405_10139849 3300031731 Bacteria 1686
365 Ga0316577_10001607 3300031733 Bacteria 10769
366 Ga0307406_10001400 3300031901 Bacteria 13402
367 Ga0307406_10007237 3300031901 Bacteria 6147
368 Ga0307406_10188084 3300031901 Bacteria 1509
369 Ga0307412_10084078 3300031911 Bacteria 2208
370 Ga0307412_10214401 3300031911 Bacteria 1471
371 Ga0307412_10252776 3300031911 Bacteria 1369
372 Ga0307412_10490751 3300031911 Bacteria 1020
373 Ga0307412_10523127 3300031911 Bacteria 991
374 Ga0307416_100222755 3300032002 Bacteria 1811
375 Ga0307416_100494104 3300032002 Bacteria 1286
376 Ga0307416_100506143 3300032002 Bacteria 1273
377 Ga0307411_10138374 3300032005 Bacteria 1791
378 Ga0316585_10021205 3300032137 Bacteria 1994
379 Ga0316580_10000077 3300032139 Bacteria 16967
380 Ga0316592_1019927 3300033524 Bacteria 1422
381 Ga0373944_0007063 3300035089 Bacteria 3000
382 Ga0373954_0144809 3300035118 Bacteria 1160
383 Ga0373946_0054221 3300035171 Bacteria 1686
384 Ga0316574_0000453 3300035398 Bacteria 16452
385 Ga0373935_0027835 3300035692 Bacteria 3493
386 Ga0373927_0049634 3300035695 Bacteria 2713
387 Ga0373947_0127411 3300035725 Bacteria 1622
388 Ga0316582_0002708 3300036647 Bacteria 8411
389 Ga0316584_0061444 3300036712 Bacteria 2813
390 Ga0395899_0086470 3300037312 Bacteria 2277
391 Ga0395900_0052621 3300037418 Bacteria 4191
392 Ga0395900_0266776 3300037418 Bacteria 1708
393 Ga0395898_0004483 3300037466 Bacteria 15266
394 Ga0395898_0019317 3300037466 Bacteria 6938
395 Ga0395898_0150582 3300037466 Bacteria 2226
396 Ga0395898_0330291 3300037466 Bacteria 1454
397 Ga0395905_0000132 3300037471 Bacteria 123636
398 Ga0395905_0000773 3300037471 Bacteria 42104
399 Ga0395905_0020265 3300037471 Bacteria 6300
400 Ga0395905_0020548 3300037471 Bacteria 6253
401 Ga0395905_0045023 3300037471 Bacteria 4139
402 Ga0395905_0463096 3300037471 Bacteria 1166
403 Ga0395901_0061368 3300038443 Bacteria 3911
404 Ga0395901_0099473 3300038443 Bacteria 3049
405 Ga0395901_0191808 3300038443 Bacteria 2143
406 Ga0395901_0306610 3300038443 Bacteria 1645
407 Ga0395901_0387156 3300038443 Bacteria 1438
408 Ga0436365_1241421 3300039437 Bacteria 833
409 Ga0436361_0206236 3300039447 Bacteria 37288
410 Ga0439436_0033022 3300041404 Bacteria 1499
411 Ga0439436_0048747 3300041404 Bacteria 1200
412 Ga0439438_035333 3300041405 Bacteria 1314
413 Ga0439439_0004892 3300041406 Bacteria 3038
414 Ga0439466_0017020 3300041411 Bacteria 2620
415 Ga0439466_0031968 3300041411 Bacteria 1797
416 Ga0439465_0004122 3300041413 Bacteria 4728
417 Ga0451793_0841222 3300041452 Bacteria 903
418 Ga0451797_1279811 3300041453 Bacteria 1398
419 Ga0451798_0376783 3300041458 Bacteria 1756
420 Ga0451807_0205605 3300041486 Bacteria 1067
421 Ga0451849_1538263 3300041505 Bacteria 1148
422 Ga0451853_2214512 3300041512 Bacteria 1745
423 Ga0439431_0004094 3300041997 Bacteria 3206
424 Ga0439433_0011737 3300041999 Bacteria 1920
425 Ga0439433_0012763 3300041999 Bacteria 1843
426 Ga0439442_001658 3300042002 Bacteria 4363
427 Ga0439445_0040432 3300042004 Bacteria 1237
428 Ga0439445_0043154 3300042004 Bacteria 1203
429 Ga0439432_001627 3300042006 Bacteria 8402
430 Ga0439432_040723 3300042006 Bacteria 1473
431 Ga0439432_054420 3300042006 Bacteria 1243
432 Ga0439449_0000571 3300042007 Bacteria 13827
433 Ga0439449_0010193 3300042007 Bacteria 3551
434 Ga0439449_0027811 3300042007 Bacteria 2109
435 Ga0439452_000889 3300042010 Bacteria 13717
436 Ga0439452_004162 3300042010 Bacteria 4909
437 Ga0439457_021025 3300042014 Bacteria 1447
438 Ga0439457_026479 3300042014 Bacteria 1284
439 Ga0439462_0000395 3300042015 Bacteria 8398
440 Ga0439462_0003003 3300042015 Bacteria 4004
441 Ga0439462_0033542 3300042015 Bacteria 1361
442 Ga0450911_001876 3300042115 Bacteria 4442
443 Ga0450923_000153 3300042125 Bacteria 6176
444 Ga0450923_004312 3300042125 Bacteria 2228
445 Ga0450888_000733 3300042126 Bacteria 3138
446 Ga0450896_009789 3300042133 Bacteria 1339
447 Ga0450898_009975 3300042134 Bacteria 1530
448 Ga0450898_027951 3300042134 Bacteria 1023
449 Ga0450906_003909 3300042145 Bacteria 3157
450 Ga0450907_009943 3300042146 Bacteria 1577
451 Ga0450910_003552 3300042147 Bacteria 2072
452 Ga0450909_006945 3300042185 Bacteria 1633
453 Ga0450909_008427 3300042185 Bacteria 1500
454 Ga0439464_0020302 3300042439 Bacteria 1819
455 Ga0450918_002160 3300042531 Bacteria 3759
456 Ga0450893_0000734 3300042532 Bacteria 4789
457 Ga0450893_0001087 3300042532 Bacteria 4086
458 Ga0450893_0028823 3300042532 Bacteria 983
459 Ga0451577_0000235 3300042876 Bacteria 109693
460 Ga0451577_0033005 3300042876 Bacteria 4665
461 Ga0466969_0056259 3300044656 Bacteria 1921
462 Ga0466969_0066543 3300044656 Bacteria 1739
463 Ga0453683_0000588 3300044673 Bacteria 40294
464 Ga0453683_0002178 3300044673 Bacteria 15579
465 Ga0466966_0005481 3300044684 Bacteria 8341
466 Ga0453684_0000906 3300044712 Bacteria 98768
467 Ga0453684_0048485 3300044712 Bacteria 5615
468 Ga0453684_0421008 3300044712 Bacteria 1492
469 Ga0466968_0043761 3300044735 Bacteria 1896
470 Ga0466970_0073416 3300044765 Bacteria 1841
471 Ga0466960_0133422 3300044901 Bacteria 1313
472 Ga0466959_0120105 3300045049 Bacteria 1869
473 Ga0451576_0016371 3300045051 Bacteria 8185
474 Ga0451576_0209915 3300045051 Bacteria 2033
475 Ga0466958_0281017 3300045836 Bacteria 1067
476 Ga0495627_009827 3300046453 Bacteria 3504
477 Ga0495603_0027022 3300046455 Bacteria 3465
478 Ga0495590_0038292 3300046457 Bacteria 1672
479 Ga0495638_0083365 3300046460 Bacteria 1937
480 Ga0495651_0170788 3300046462 Bacteria 1549
481 Ga0495580_0038734 3300046472 Bacteria 3413
482 Ga0495582_0076600 3300046473 Bacteria 1854
483 Ga0495639_0073112 3300046475 Bacteria 1586
484 Ga0495607_0109887 3300046501 Bacteria 1463
485 Ga0495618_0328101 3300046514 Bacteria 947
486 Ga0495620_0024857 3300046515 Bacteria 2843
487 Ga0495628_0112817 3300046516 Bacteria 2090
488 Ga0495630_0139490 3300046517 Bacteria 1843
489 Ga0495632_0051926 3300046519 Bacteria 2017
490 Ga0495637_0008818 3300046520 Bacteria 4938
491 Ga0495643_0076295 3300046522 Bacteria 1753
492 Ga0495644_0010443 3300046523 Bacteria 3578
493 Ga0495654_0023367 3300046530 Bacteria 3202
494 Ga0495654_0070369 3300046530 Bacteria 1659
495 Ga0495665_0068407 3300046531 Bacteria 1873
496 Ga0495598_0000201 3300046537 Bacteria 10515
497 Ga0495609_0067799 3300046538 Bacteria 1571
498 Ga0495621_0110344 3300046539 Bacteria 1054
499 Ga0495621_0111200 3300046539 Bacteria 1051
500 Ga0495597_0000271 3300046542 Bacteria 47044
501 Ga0495597_0014491 3300046542 Bacteria 3753
502 Ga0495633_0103415 3300046558 Bacteria 1322
503 Ga0495633_0130209 3300046558 Bacteria 1164
504 Ga0495656_0000586 3300046615 Bacteria 11799
505 Ga0495634_0085323 3300046642 Bacteria 2058
506 Ga0495611_0045987 3300046648 Bacteria 1956
507 Ga0495625_0000045 3300046660 Bacteria 202475
508 Ga0495625_0000379 3300046660 Bacteria 67828
509 Ga0495659_0033534 3300046664 Bacteria 1803
510 Ga0495588_0043933 3300046674 Bacteria 2287
511 Ga0495588_0045119 3300046674 Bacteria 2259
512 Ga0495647_0010122 3300046681 Bacteria 3207
513 Ga0495658_0092193 3300046683 Bacteria 1795
514 Ga0495669_0014120 3300046684 Bacteria 3414
515 Ga0495624_0027928 3300046690 Bacteria 3689
516 Ga0495670_0082233 3300046691 Bacteria 1642
517 Ga0495671_0013910 3300046692 Bacteria 4341
518 Ga0495671_0026847 3300046692 Bacteria 2980
519 Ga0495671_0090897 3300046692 Bacteria 1494
520 Ga0495649_0000010 3300046694 Bacteria 430552
521 Ga0495581_0121427 3300047315 Bacteria 1520
522 Ga0495676_0002862 3300047321 Bacteria 15561
523 Ga0495687_000523 3300047443 Bacteria 46029
524 Ga0495677_0032346 3300047445 Bacteria 1905
525 Ga0495681_0065094 3300047470 Bacteria 1668
526 Ga0495593_0005402 3300047673 Bacteria 7552
527 Ga0495614_0004291 3300048089 Bacteria 6423
528 Ga0495615_0027805 3300048090 Bacteria 1330
529 Ga0495626_0080112 3300048091 Bacteria 1452
530 Ga0496100_0009492 3300048903 Bacteria 5467
531 Ga0496100_0054743 3300048903 Bacteria 2603
532 Ga0496100_0305621 3300048903 Bacteria 1191
533 Ga0496101_0030606 3300048904 Bacteria 3776
534 Ga0496101_0063417 3300048904 Bacteria 2690
535 Ga0496101_0082018 3300048904 Bacteria 2386
536 Ga0496102_0149258 3300048905 Bacteria 2195
537 Ga0496103_0004812 3300048906 Bacteria 8157
538 Ga0496103_0041716 3300048906 Bacteria 2821
539 Ga0496104_0013702 3300048907 Bacteria 7310
540 Ga0496104_0170425 3300048907 Bacteria 2087
541 Ga0496104_0257044 3300048907 Bacteria 1659
542 Ga0496104_0623610 3300048907 Unclassified 988
543 Ga0496105_0035506 3300048908 Bacteria 4102
544 Ga0496105_0233350 3300048908 Bacteria 1494
545 Ga0496106_0006246 3300048909 Bacteria 8818
546 Ga0496106_0029989 3300048909 Bacteria 4055
547 Ga0496106_0124152 3300048909 Bacteria 2020
548 Ga0496107_0021262 3300048910 Bacteria 4586
549 Ga0496107_0072969 3300048910 Bacteria 2496
550 Ga0496108_0024365 3300048911 Bacteria 4981
551 Ga0496109_0001638 3300048912 Bacteria 18700
552 Ga0496109_0084610 3300048912 Bacteria 2926
553 Ga0496109_0386946 3300048912 Bacteria 1321
554 Ga0496110_0049590 3300048913 Bacteria 3683
555 Ga0496110_0204062 3300048913 Bacteria 1796
556 Ga0496111_0005028 3300048914 Bacteria 8410
557 Ga0496111_0068482 3300048914 Bacteria 2579
558 Ga0496111_0093096 3300048914 Bacteria 2209
559 Ga0496112_0000852 3300048915 Bacteria 21764
560 Ga0496112_0127295 3300048915 Bacteria 2517
561 Ga0496113_0000175 3300048916 Bacteria 28436
562 Ga0496113_0005782 3300048916 Bacteria 7753
563 Ga0496114_0012990 3300048917 Bacteria 6674
564 Ga0496115_0071168 3300048918 Bacteria 2820
565 Ga0496115_0078284 3300048918 Bacteria 2689
566 Ga0496116_0048461 3300048919 Bacteria 2851
567 Ga0496116_0073305 3300048919 Bacteria 2159
568 Ga0496117_0024067 3300048920 Bacteria 4829
569 Ga0496117_0028409 3300048920 Bacteria 4332
570 Ga0496117_0060609 3300048920 Bacteria 2606
571 Ga0496118_0013925 3300048921 Bacteria 7563
572 Ga0496121_0051436 3300048924 Bacteria 3469
573 Ga0496121_0095038 3300048924 Bacteria 2317
574 Ga0496122_0227542 3300048925 Bacteria 1064
575 Ga0496124_0021946 3300048927 Bacteria 5872
576 Ga0496124_0150891 3300048927 Bacteria 1823
577 Ga0496124_0326387 3300048927 Bacteria 1096
578 Ga0496125_0010440 3300048928 Bacteria 9394
579 Ga0496125_0095622 3300048928 Bacteria 2209
580 Ga0496125_0131223 3300048928 Bacteria 1763
581 Ga0496126_0334829 3300048929 Bacteria 1241
582 Ga0501292_009051 3300049515 Bacteria 1471
583 Ga0501031_0001052 3300049568 Bacteria 16740
584 Ga0501034_0231344 3300049571 Bacteria 1797
585 Ga0501036_0565521 3300049572 Bacteria 944
586 Ga0501038_0315197 3300049574 Bacteria 1225
587 Ga0501038_0354577 3300049574 Bacteria 1142
588 Ga0501047_0117437 3300049581 Bacteria 2542
589 Ga0501072_0142991 3300049588 Bacteria 1908
590 Ga0501223_004131 3300049663 Bacteria 3128
591 Ga0501249_004824 3300049679 Bacteria 2745
592 Ga0501253_012557 3300049683 Bacteria 1329
593 Ga0501221_022229 3300049704 Bacteria 1255
594 Ga0501225_0003847 3300049705 Bacteria 4505
595 Ga0501081_0145622 3300049743 Bacteria 1700
596 Ga0501262_003565 3300049759 Bacteria 1788
597 Ga0501265_004538 3300049762 Bacteria 1584
598 nmdc:mga03683_1072_c1 3300050489 Bacteria 8008
599 nmdc:mga03683_3450_c2 3300050489 Bacteria 3482
600 nmdc:mga03683_77218_c1 3300050489 Bacteria 1433
601 nmdc:mga03n38_232134_c1 3300050490 Bacteria 967
602 nmdc:mga03n38_32650_c1 3300050490 Bacteria 2208
603 nmdc:mga0yw44_4223_c1 3300050492 Bacteria 6542
604 nmdc:mga0yw44_460128_c1 3300050492 Bacteria 862
605 nmdc:mga0yw44_67569_c1 3300050492 Bacteria 2210
606 nmdc:mga0yw44_799_c1 3300050492 Bacteria 11724
607 nmdc:mga0k408_20964_c1 3300050493 Bacteria 3325
608 nmdc:mga0k408_272923_c1 3300050493 Bacteria 1010
609 nmdc:mga0k408_55334_c1 3300050493 Bacteria 2301
610 nmdc:mga0k408_67935_c1 3300050493 Bacteria 2078
611 nmdc:mga06z11_207622_c1 3300050494 Bacteria 1140
612 nmdc:mga04h51_68198_c1 3300050495 Bacteria 1235
613 nmdc:mga07m45_21486_c1 3300050496 Bacteria 3515
614 nmdc:mga07m45_25573_c1 3300050496 Bacteria 3239
615 nmdc:mga07m45_83_c1 3300050496 Bacteria 35468
616 nmdc:mga0qj67_417234_c1 3300050509 Bacteria 1082
617 nmdc:mga08y16_318649_c1 3300050511 Bacteria 1601
618 nmdc:mga08y16_65578_c1 3300050511 Bacteria 3790
619 Ga0495601_0042195 3300053077 Bacteria 2861
620 Ga0500610_0021582 3300053079 Bacteria 3162
621 Ga0495655_0001637 3300053083 Bacteria 3461
622 Ga0495619_0019305 3300053085 Bacteria 4332
623 Ga0495619_0262192 3300053085 Bacteria 1197
624 Ga0500651_0000328 3300053093 Bacteria 26797
625 Ga0500593_000328 3300053117 Bacteria 19163
626 Ga0500593_012616 3300053117 Bacteria 3588
627 Ga0500607_004248 3300053121 Bacteria 9969
628 Ga0500628_002450 3300053129 Bacteria 3068
629 Ga0500658_0000117 3300053134 Bacteria 37704
630 Ga0500658_0000393 3300053134 Bacteria 19079
631 Ga0500568_0009858 3300053139 Bacteria 4513
632 Ga0500574_024317 3300053141 Bacteria 1567
633 Ga0500616_0055110 3300053153 Bacteria 2080
634 Ga0500627_0017547 3300053158 Bacteria 2814
635 Ga0500634_0072388 3300053161 Bacteria 1799
636 Ga0500645_001273 3300053730 Bacteria 13201
637 Ga0530510_0049096 3300061734 Bacteria 3050
638 Ga0530510_0195965 3300061734 Bacteria 1500
639 2511246025 2511231002 Bacteria 5042903
640 2513230664 2513020051 Bacteria 6053213
641 2548501750 2547132374 Bacteria 5530232
642 2599626343 2599185214 Bacteria 8209958
643 2599676333 2599185226 Bacteria 8233575
644 2599682045 2599185227 Bacteria 8246414
645 2599695695 2599185229 Bacteria 8216126
646 2643864127 2643221570 Bacteria 5103772
647 2643992427 2643221596 Bacteria 5006805
648 2644072810 2643221611 Bacteria 6820941
649 2644161707 2643221628 Bacteria 5745828
650 2644292170 2643221652 Bacteria 5140275
651 2644328517 2643221658 Bacteria 6064537
652 2644399754 2643221672 Bacteria 6322190
653 2644466884 2643221683 Bacteria 5749203
654 2644646523 2643221717 Bacteria 5676132
655 2728754080 2728368998 Bacteria 8720350
656 2738721315 2738541277 Bacteria 7458140
657 2738880658 2738541307 Bacteria 8606193
658 2739245747 2738543012 Bacteria 7115078
659 2739249577 2738543013 Bacteria 5618633
660 2739280984 2738543019 Bacteria 7459457
661 2816470349 2816332133 Bacteria 7249298
662 2819601622 2818991446 Bacteria 7757362
663 2831269233 2831265667 Bacteria 7184833
664 2838059210 2838054893 Bacteria 7451788
665 2842680331 2842677519 Bacteria 5615038
666 2881105360 2881101125 Bacteria 4590519
667 2885192988 2885192300 Bacteria 5882526
668 2885203052 2885198086 Bacteria 7212419
669 2885216551 2885211737 Bacteria 7212420
670 2899930685 2899924645 Bacteria 7487985
671 2904452591 2904449895 Bacteria 6927402
672 2904460810 2904456579 Bacteria 6819253
673 2904545310 2904541872 Bacteria 8915136
674 2919463777 2919462493 Bacteria 5817112
675 2928040993 2928037797 Bacteria 7273642
676 2928047835 2928044640 Bacteria 7271509
677 2928055727 2928051484 Bacteria 7773759
678 2928069826 2928064002 Bacteria 7419480
679 2928075313 2928070936 Bacteria 8062541
680 2928088530 2928084124 Bacteria 7159212
681 2929165502 2929160207 Bacteria 9075316
682 2929522543 2929520902 Bacteria 6765052
683 2939636653 2939631187 Bacteria 6118131
684 2945909828 2945909444 Bacteria 7065066
685 2945945906 2945945610 Bacteria 5951079
686 2945975522 2945972063 Bacteria 6086495
687 2945988179 2945984333 Bacteria 7358892
688 2954769035 2954767861 Bacteria 5535784
689 Ga0395905_0032508
690 JGI24739J22299_10034117
691 JGI25155J39150_1000009
692 JGI25156J39149_1000009
693 JGI25154J39366_1000024
694 JGI25157J39369_1000007
695 JGI25152J39213_1010759
696 JGI25150J39212_1005464
697 JGI25159J45721_1000286
698 JGI25151J46595_10010871
699 JGI25151J46595_10013564
700 JGI25151J46595_10028708
701 JGI25153J46596_10026233
702 JGI25153J46596_10036612
703 rootH1_10010835
704 rootH2_10131427
705 rootH1_10398388
706 JGI25160J50197_1000242
707 JGI25161J50226_1000009
708 Ga0006562J51391_1032156
709 Ga0006562J51391_1050707
710 Ga0055535_1000422
711 Ga0055542_1000074
712 Ga0055526_1000764
713 Ga0055526_1002603
714 Ga0055537_1000235
715 Ga0055537_1001179
716 Ga0055537_1004150
717 Ga0055537_1005789
718 Ga0055537_1008729
719 Ga0055524_1000143
720 Ga0055536_1001550
721 Ga0055536_1002402
722 Ga0055534_1000612
723 Ga0055534_1001150
724 Ga0055534_1007325
725 Ga0055534_1009176
726 Ga0055534_1009747
727 Ga0055528_1001546
728 Ga0055528_1003188
729 Ga0055528_1007187
730 Ga0055528_1012716
731 Ga0055528_1022021
732 Ga0055530_10000474
733 Ga0055530_10001693
734 Ga0055530_10012948
735 Ga0055530_10053448
736 Ga0055540_1000027
737 Ga0055540_1001360
738 Ga0055540_1004336
739 Ga0055531_10000465
740 Ga0055531_10001603
741 Ga0055531_10001892
742 Ga0055543_1001141
743 Ga0055543_1001635
744 Ga0065165_1004502
745 Ga0065165_1005558
746 Ga0065165_1006879
747 Ga0065714_10105539
748 Ga0070658_10034550
749 Ga0070658_10108697
750 Ga0070683_100056060
751 Ga0070666_10106400
752 Ga0070680_100136961
753 Ga0068868_100056705
754 Ga0068868_100114392
755 Ga0070660_100029168
756 Ga0070689_100005913
757 Ga0070673_100331359
758 Ga0070659_100293976
759 Ga0070667_100017811
760 Ga0070667_100629041
761 Ga0070663_100107872
762 Ga0070678_100210272
763 Ga0070662_100009652
764 Ga0070662_100309717
765 Ga0068867_100030840
766 Ga0070707_100184730
767 Ga0070679_100206942
768 Ga0068853_100059027
769 Ga0068853_100074017
770 Ga0068853_100255784
771 Ga0070665_100011220
772 Ga0068855_100605676
773 Ga0070664_100006223
774 Ga0070664_100053777
775 Ga0070664_100121530
776 Ga0068857_100042748
777 Ga0068854_100155187
778 Ga0068852_100018914
779 Ga0068852_100411181
780 Ga0068864_100093567
781 Ga0068864_100161123
782 Ga0068864_100452994
783 Ga0068866_10263672
784 Ga0068866_10267595
785 Ga0068861_100043266
786 Ga0068851_10004316
787 Ga0068870_10019601
788 Ga0068863_100181602
789 Ga0068862_100120510
790 Ga0075365_10007399
791 Ga0075365_10041110
792 Ga0075365_10046436
793 Ga0075363_100054659
794 Ga0075363_100056327
795 Ga0075363_100065449
796 Ga0075363_100112523
797 Ga0075363_100150362
798 Ga0075363_100165829
799 Ga0075432_10010858
800 Ga0075362_10029242
801 Ga0075362_10071658
802 Ga0075362_10099937
803 Ga0075362_10119556
804 Ga0075362_10184126
805 Ga0075367_10140358
806 Ga0075366_10002402
807 Ga0075366_10010869
808 Ga0075366_10061274
809 Ga0075366_10160694
810 Ga0097621_100014841
811 Ga0075370_10000174
812 Ga0075370_10009118
813 Ga0075370_10024397
814 Ga0075370_10063897
815 Ga0075370_10250572
816 Ga0068871_100820359
817 Ga0075430_100050168
818 Ga0079104_1022241
819 Ga0079104_1042794
820 Ga0099826_10003378
821 Ga0105244_10001684
822 Ga0105240_10075554
823 Ga0111539_10043864
824 Ga0105245_10103501
825 Ga0105245_10112726
826 Ga0105243_10000651
827 Ga0105243_10022415
828 Ga0105241_10035536
829 Ga0105241_10056041
830 Ga0105241_10660247
831 Ga0105248_10079427
832 Ga0105237_10010332
833 Ga0105237_10195666
834 Ga0105237_10339405
835 Ga0105238_10061871
836 Ga0105238_10394048
837 Ga0105249_10086461
838 Ga0105239_10052265
839 Ga0105239_10422318
840 Ga0105246_10244001
841 Ga0157326_1002040
842 Ga0157373_10097251
843 Ga0157373_10101670
844 Ga0157371_10011999
845 Ga0157370_10010090
846 Ga0157369_10104078
847 Ga0157378_10113331
848 Ga0157378_10214115
849 Ga0163162_10004457
850 Ga0163162_10141172
851 Ga0163162_10290805
852 Ga0163162_10603683
853 Ga0163162_10701174
854 Ga0163163_10032774
855 Ga0163163_10151219
856 Ga0157380_10102885
857 Ga0182008_10002904
858 Ga0182008_10003704
859 Ga0182008_10049983
860 Ga0157379_10030520
861 Ga0157376_10001487
862 Ga0157376_10315775
863 Ga0157376_10458427
864 Ga0182006_1001051
865 Ga0182007_10001491
866 Ga0182007_10006789
867 Ga0183362_10005
868 Ga0163161_10010507
869 Ga0163161_10080406
870 Ga0163161_10100266
871 Ga0209435_100051
872 Ga0209672_100519
873 Ga0209147_100419
874 Ga0209258_100176
875 Ga0207425_1000873
876 Ga0207425_1001688
877 Ga0207425_1001776
878 Ga0209646_1000029
879 Ga0209026_1000016
880 Ga0209148_1000033
881 Ga0209759_1000016
882 Ga0209129_1000270
883 Ga0209129_1003689
884 Ga0209129_1008653
885 Ga0209129_1008732
886 Ga0209129_1010651
887 Ga0209565_1000020
888 Ga0209565_1000122
889 Ga0209565_1000373
890 Ga0209565_1001818
891 Ga0209565_1003152
892 Ga0209673_1000209
893 Ga0209673_1000302
894 Ga0209673_1001386
895 Ga0209673_1003803
896 Ga0209130_1000014
897 Ga0209130_1000335
898 Ga0209130_1000487
899 Ga0209130_1000495
900 Ga0209130_1001175
901 Ga0209130_1007904
902 Ga0209130_1013513
903 Ga0209675_1000014
904 Ga0209675_1000098
905 Ga0209675_1001308
906 Ga0209675_1003982
907 Ga0209675_1005447
908 Ga0209675_1014889
909 Ga0209676_1000013
910 Ga0209676_1000048
911 Ga0209676_1000124
912 Ga0209676_1000604
913 Ga0209676_1003874
914 Ga0209676_1006692
915 Ga0209025_1000324
916 Ga0209025_1000597
917 Ga0209025_1000733
918 Ga0209025_1004202
919 Ga0209025_1005897
920 Ga0209025_1005974
921 Ga0209025_1010658
922 Ga0209025_1016839
923 Ga0209564_1000423
924 Ga0209564_1001169
925 Ga0209564_1001202
926 Ga0209564_1003808
927 Ga0209564_1004130
928 Ga0209758_1000833
929 Ga0209758_1003579
930 Ga0209758_1025763
931 Ga0209050_1000008
932 Ga0209050_1000012
933 Ga0209050_1001045
934 Ga0209050_1002039
935 Ga0209050_1006385
936 Ga0209256_1000039
937 Ga0209256_1000095
938 Ga0209256_1000527
939 Ga0207426_1000161
940 Ga0207426_1000224
941 Ga0207426_1000955
942 Ga0207426_1001771
943 Ga0209051_1000005
944 Ga0209051_1000019
945 Ga0209051_1000099
946 Ga0209051_1000117
947 Ga0209051_1000207
948 Ga0209051_1000833
949 Ga0209051_1011109
950 Ga0209051_1078175
951 Ga0209257_1000024
952 Ga0209257_1000031
953 Ga0209257_1000161
954 Ga0209257_1000258
955 Ga0209257_1004843
956 Ga0209257_1009295
957 Ga0209257_1011333
958 Ga0209257_1061272
959 Ga0207656_10007159
960 Ga0207656_10036545
961 Ga0207655_1001510
962 Ga0207655_1079886
963 Ga0207680_10272860
964 Ga0207645_10005156
965 Ga0207645_10008002
966 Ga0207695_10133853
967 Ga0207657_10026290
968 Ga0207657_10041810
969 Ga0207652_10178927
970 Ga0207694_10319898
971 Ga0207650_10001983
972 Ga0207650_10253994
973 Ga0207687_10034205
974 Ga0207687_10046561
975 Ga0207644_10030857
976 Ga0207706_10001771
977 Ga0207706_10008031
978 Ga0207706_10142747
979 Ga0207709_10000313
980 Ga0207709_10000669
981 Ga0207670_10043362
982 Ga0207669_10422166
983 Ga0207691_10003250
984 Ga0207691_10242744
985 Ga0207711_10046284
986 Ga0207689_10012071
987 Ga0207689_10161431
988 Ga0207679_10010834
989 Ga0207667_10898832
990 Ga0207640_10033788
991 Ga0207640_10344330
992 Ga0207658_10089906
993 Ga0207677_10050142
994 Ga0207677_10068824
995 Ga0207639_10003657
996 Ga0207678_10002574
997 Ga0207708_10000993
998 Ga0207702_10144336
999 Ga0207702_10320911
1000 Ga0207641_10253602
1001 Ga0207648_10000840
1002 Ga0207648_10012123
1003 Ga0207648_10238338
1004 Ga0207674_10033584
1005 Ga0207674_10243751
1006 Ga0207683_10004959
1007 Ga0209281_1018111
1008 Ga0209281_1029678
1009 Ga0209973_1002078
1010 Ga0209282_1003178
1011 Ga0209971_1005374
1012 Ga0209813_10078738
1013 Ga0209974_10015870
1014 Ga0207428_10098286
1015 Ga0268266_10021473
1016 Ga0268265_10247966
1017 Ga0268264_10090835
1018 Ga0307515_10000040
1019 Ga0307515_10000458
1020 Ga0307515_10106766
1021 Ga0307515_10147541
1022 Ga0307512_10174892
1023 Ga0316177_1103696
1024 Ga0314311_1049345
1025 Ga0316178_1053423
1026 Ga0316183_1023591
1027 Ga0316183_1194403
1028 Ga0316181_1061609
1029 Ga0316182_1044621
1030 Ga0265330_10054816
1031 Ga0265332_10003751
1032 Ga0265331_10060652
1033 Ga0265327_10119761
1034 Ga0265327_10140962
1035 Ga0307513_10000194
1036 Ga0307513_10001393
1037 Ga0307513_10154016
1038 Ga0307408_100000171
1039 Ga0307408_100007277
1040 Ga0307408_100076061
1041 Ga0307514_10000828
1042 Ga0307514_10026727
1043 Ga0316579_10000177
1044 Ga0265314_10020869
1045 Ga0265314_10036600
1046 Ga0265342_10022315
1047 Ga0265342_10047726
1048 Ga0316576_10018905
1049 Ga0316578_10028686
1050 Ga0307516_10006663
1051 Ga0307405_10028542
1052 Ga0307405_10139849
1053 Ga0316577_10001607
1054 Ga0307406_10001400
1055 Ga0307406_10007237
1056 Ga0307406_10188084
1057 Ga0307412_10084078
1058 Ga0307412_10214401
1059 Ga0307412_10252776
1060 Ga0307412_10490751
1061 Ga0307412_10523127
1062 Ga0307416_100222755
1063 Ga0307416_100494104
1064 Ga0307416_100506143
1065 Ga0307411_10138374
1066 Ga0316585_10021205
1067 Ga0316580_10000077
1068 Ga0316592_1019927
1069 Ga0373944_0007063
1070 Ga0373954_0144809
1071 Ga0373946_0054221
1072 Ga0316574_0000453
1073 Ga0373935_0027835
1074 Ga0373927_0049634
1075 Ga0373947_0127411
1076 Ga0316582_0002708
1077 Ga0316584_0061444
1078 Ga0395899_0086470
1079 Ga0395900_0052621
1080 Ga0395900_0266776
1081 Ga0395898_0004483
1082 Ga0395898_0019317
1083 Ga0395898_0150582
1084 Ga0395898_0330291
1085 Ga0395905_0000132
1086 Ga0395905_0000773
1087 Ga0395905_0020265
1088 Ga0395905_0020548
1089 Ga0395905_0045023
1090 Ga0395905_0463096
1091 Ga0395901_0061368
1092 Ga0395901_0099473
1093 Ga0395901_0191808
1094 Ga0395901_0306610
1095 Ga0395901_0387156
1096 Ga0436365_1241421
1097 Ga0436361_0206236
1098 Ga0439436_0033022
1099 Ga0439436_0048747
1100 Ga0439438_035333
1101 Ga0439439_0004892
1102 Ga0439466_0017020
1103 Ga0439466_0031968
1104 Ga0439465_0004122
1105 Ga0451793_0841222
1106 Ga0451797_1279811
1107 Ga0451798_0376783
1108 Ga0451807_0205605
1109 Ga0451849_1538263
1110 Ga0451853_2214512
1111 Ga0439431_0004094
1112 Ga0439433_0011737
1113 Ga0439433_0012763
1114 Ga0439442_001658
1115 Ga0439445_0040432
1116 Ga0439445_0043154
1117 Ga0439432_001627
1118 Ga0439432_040723
1119 Ga0439432_054420
1120 Ga0439449_0000571
1121 Ga0439449_0010193
1122 Ga0439449_0027811
1123 Ga0439452_000889
1124 Ga0439452_004162
1125 Ga0439457_021025
1126 Ga0439457_026479
1127 Ga0439462_0000395
1128 Ga0439462_0003003
1129 Ga0439462_0033542
1130 Ga0450911_001876
1131 Ga0450923_000153
1132 Ga0450923_004312
1133 Ga0450888_000733
1134 Ga0450896_009789
1135 Ga0450898_009975
1136 Ga0450898_027951
1137 Ga0450906_003909
1138 Ga0450907_009943
1139 Ga0450910_003552
1140 Ga0450909_006945
1141 Ga0450909_008427
1142 Ga0439464_0020302
1143 Ga0450918_002160
1144 Ga0450893_0000734
1145 Ga0450893_0001087
1146 Ga0450893_0028823
1147 Ga0451577_0000235
1148 Ga0451577_0033005
1149 Ga0466969_0056259
1150 Ga0466969_0066543
1151 Ga0453683_0000588
1152 Ga0453683_0002178
1153 Ga0466966_0005481
1154 Ga0453684_0000906
1155 Ga0453684_0048485
1156 Ga0453684_0421008
1157 Ga0466968_0043761
1158 Ga0466970_0073416
1159 Ga0466960_0133422
1160 Ga0466959_0120105
1161 Ga0451576_0016371
1162 Ga0451576_0209915
1163 Ga0466958_0281017
1164 Ga0495627_009827
1165 Ga0495603_0027022
1166 Ga0495590_0038292
1167 Ga0495638_0083365
1168 Ga0495651_0170788
1169 Ga0495580_0038734
1170 Ga0495582_0076600
1171 Ga0495639_0073112
1172 Ga0495607_0109887
1173 Ga0495618_0328101
1174 Ga0495620_0024857
1175 Ga0495628_0112817
1176 Ga0495630_0139490
1177 Ga0495632_0051926
1178 Ga0495637_0008818
1179 Ga0495643_0076295
1180 Ga0495644_0010443
1181 Ga0495654_0023367
1182 Ga0495654_0070369
1183 Ga0495665_0068407
1184 Ga0495598_0000201
1185 Ga0495609_0067799
1186 Ga0495621_0110344
1187 Ga0495621_0111200
1188 Ga0495597_0000271
1189 Ga0495597_0014491
1190 Ga0495633_0103415
1191 Ga0495633_0130209
1192 Ga0495656_0000586
1193 Ga0495634_0085323
1194 Ga0495611_0045987
1195 Ga0495625_0000045
1196 Ga0495625_0000379
1197 Ga0495659_0033534
1198 Ga0495588_0043933
1199 Ga0495588_0045119
1200 Ga0495647_0010122
1201 Ga0495658_0092193
1202 Ga0495669_0014120
1203 Ga0495624_0027928
1204 Ga0495670_0082233
1205 Ga0495671_0013910
1206 Ga0495671_0026847
1207 Ga0495671_0090897
1208 Ga0495649_0000010
1209 Ga0495581_0121427
1210 Ga0495676_0002862
1211 Ga0495687_000523
1212 Ga0495677_0032346
1213 Ga0495681_0065094
1214 Ga0495593_0005402
1215 Ga0495614_0004291
1216 Ga0495615_0027805
1217 Ga0495626_0080112
1218 Ga0496100_0009492
1219 Ga0496100_0054743
1220 Ga0496100_0305621
1221 Ga0496101_0030606
1222 Ga0496101_0063417
1223 Ga0496101_0082018
1224 Ga0496102_0149258
1225 Ga0496103_0004812
1226 Ga0496103_0041716
1227 Ga0496104_0013702
1228 Ga0496104_0170425
1229 Ga0496104_0257044
1230 Ga0496104_0623610
1231 Ga0496105_0035506
1232 Ga0496105_0233350
1233 Ga0496106_0006246
1234 Ga0496106_0029989
1235 Ga0496106_0124152
1236 Ga0496107_0021262
1237 Ga0496107_0072969
1238 Ga0496108_0024365
1239 Ga0496109_0001638
1240 Ga0496109_0084610
1241 Ga0496109_0386946
1242 Ga0496110_0049590
1243 Ga0496110_0204062
1244 Ga0496111_0005028
1245 Ga0496111_0068482
1246 Ga0496111_0093096
1247 Ga0496112_0000852
1248 Ga0496112_0127295
1249 Ga0496113_0000175
1250 Ga0496113_0005782
1251 Ga0496114_0012990
1252 Ga0496115_0071168
1253 Ga0496115_0078284
1254 Ga0496116_0048461
1255 Ga0496116_0073305
1256 Ga0496117_0024067
1257 Ga0496117_0028409
1258 Ga0496117_0060609
1259 Ga0496118_0013925
1260 Ga0496121_0051436
1261 Ga0496121_0095038
1262 Ga0496122_0227542
1263 Ga0496124_0021946
1264 Ga0496124_0150891
1265 Ga0496124_0326387
1266 Ga0496125_0010440
1267 Ga0496125_0095622
1268 Ga0496125_0131223
1269 Ga0496126_0334829
1270 Ga0501292_009051
1271 Ga0501031_0001052
1272 Ga0501034_0231344
1273 Ga0501036_0565521
1274 Ga0501038_0315197
1275 Ga0501038_0354577
1276 Ga0501047_0117437
1277 Ga0501072_0142991
1278 Ga0501223_004131
1279 Ga0501249_004824
1280 Ga0501253_012557
1281 Ga0501221_022229
1282 Ga0501225_0003847
1283 Ga0501081_0145622
1284 Ga0501262_003565
1285 Ga0501265_004538
1286 nmdc:mga03683_1072_c1
1287 nmdc:mga03683_3450_c2
1288 nmdc:mga03683_77218_c1
1289 nmdc:mga03n38_232134_c1
1290 nmdc:mga03n38_32650_c1
1291 nmdc:mga0yw44_4223_c1
1292 nmdc:mga0yw44_460128_c1
1293 nmdc:mga0yw44_67569_c1
1294 nmdc:mga0yw44_799_c1
1295 nmdc:mga0k408_20964_c1
1296 nmdc:mga0k408_272923_c1
1297 nmdc:mga0k408_55334_c1
1298 nmdc:mga0k408_67935_c1
1299 nmdc:mga06z11_207622_c1
1300 nmdc:mga04h51_68198_c1
1301 nmdc:mga07m45_21486_c1
1302 nmdc:mga07m45_25573_c1
1303 nmdc:mga07m45_83_c1
1304 nmdc:mga0qj67_417234_c1
1305 nmdc:mga08y16_318649_c1
1306 nmdc:mga08y16_65578_c1
1307 Ga0495601_0042195
1308 Ga0500610_0021582
1309 Ga0495655_0001637
1310 Ga0495619_0019305
1311 Ga0495619_0262192
1312 Ga0500651_0000328
1313 Ga0500593_000328
1314 Ga0500593_012616
1315 Ga0500607_004248
1316 Ga0500628_002450
1317 Ga0500658_0000117
1318 Ga0500658_0000393
1319 Ga0500568_0009858
1320 Ga0500574_024317
1321 Ga0500616_0055110
1322 Ga0500627_0017547
1323 Ga0500634_0072388
1324 Ga0500645_001273
1325 Ga0530510_0049096
1326 Ga0530510_0195965
1327 2511246025
1328 2513230664
1329 2548501750
1330 2599626343
1331 2599676333
1332 2599682045
1333 2599695695
1334 2643864127
1335 2643992427
1336 2644072810
1337 2644161707
1338 2644292170
1339 2644328517
1340 2644399754
1341 2644466884
1342 2644646523
1343 2728754080
1344 2738721315
1345 2738880658
1346 2739245747
1347 2739249577
1348 2739280984
1349 2816470349
1350 2819601622
1351 2831269233
1352 2838059210
1353 2842680331
1354 2881105360
1355 2885192988
1356 2885203052
1357 2885216551
1358 2899930685
1359 2904452591
1360 2904460810
1361 2904545310
1362 2919463777
1363 2928040993
1364 2928047835
1365 2928055727
1366 2928069826
1367 2928075313
1368 2928088530
1369 2929165502
1370 2929522543
1371 2939636653
1372 2945909828
1373 2945945906
1374 2945975522
1375 2945988179
1376 2954769035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

50

298

0.97

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

55

290

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hin-assembly1.cif.gz_A crystal structure of putative enoyl-coa hydratase from rhodopseudomonas palustris cga009 0.9463 5 254
4izd-assembly1.cif.gz_B crystal structure of dmdd e121a in complex with mmpa-coa 0.9347 2 251
4izb-assembly1.cif.gz_B crystal structure of dmdd, a crotonase superfamily enzyme that catalyzes the hydration and hydrolysis of methylthioacryloyl-coa 0.9345 2 242
5z7r-assembly1.cif.gz_A crystal structure of crotonase from clostridium acetobutylicum 0.9336 1 251
3myb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase mycobacterium smegmatis 0.9287 3 253
ID Description Score Start End Superfamily
3hinB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9609 5 199 3.90.226.10
4izcA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9405 2 199 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9379 1 199 3.90.226.10
3hinB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9284 5 199 3.90.226.10
af_B7F9R1_37_234_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9267 13 198 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A372ENQ7-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9769 1 257 GO:0004300
GO:0006635
AF-A0A371B8H6-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9758 1 257 GO:0004300
GO:0006635
AF-A0A640JNW7-F1-model_v4 deleted 0.9757 1 257
AF-A0A2N4SPL2-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9755 1 257 GO:0004300
GO:0006635
AF-A0A260THM0-F1-model_v4 deleted 0.9755 3 257

Map