F475342

General Info

Members Datasets Scaffolds Average Seq Length
688 372 1376 213

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0035320|Ga0495590_0035320_397_1149
Length 250
Sequence VSAAAAIQRRARGACSELSHRIHRIDITLTNAKGWNIMDRFLEALRVQRWDDHRYYHHSRINQSLHLLSAISFLFAYVMMFTDPALAALAGWLVAMTSRQIGHFFFEPKDYDVVNQASHEYKEEIKVGYNLQRKVVLMTIWALSPLPLYFDPTLFGIFTPHTGSLEFVRHVGLIWLVVGLGGLLFRTIQLFFTKDVQTGLVWATKILTDPFHDIKLYHKAPLYLMRGELIDPRLHADWIDEDAEEAPRAG

Samples

Sample ID Description Type Environment
1 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
91 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
177 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
178 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
179 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
244 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
343 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
344 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
347 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
348 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
349 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
350 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
351 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
352 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
353 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
354 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
355 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
356 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
357 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
358 2906610324
359 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
360 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
361 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
362 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
363 2922425934
364 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
365 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
366 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
367 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
368 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
369 641522639 Methylobacterium sp. 4-46 Isolate Nodule
370 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
371 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
372 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 0
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.69
Nodule 3.78
Rhizoplane 7.56
Rhizosphere 75.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495590_0035320 3300046457 Bacteria 1746
2 JGI24738J21930_10013519 3300002075 Bacteria 1763
3 JGI24742J22300_10002527 3300002244 Bacteria 2919
4 JGI24751J29686_10012785 3300002459 Bacteria 1732
5 JGI25406J46586_10083757 3300003203 Bacteria 973
6 Ga0065707_10082160 3300005295 Bacteria 20515
7 Ga0065707_10086978 3300005295 Bacteria 5211
8 Ga0065707_10243856 3300005295 Bacteria 1147
9 Ga0070683_100005456 3300005329 Bacteria 10626
10 Ga0070683_100325727 3300005329 Bacteria 1463
11 Ga0070690_100050904 3300005330 Bacteria 2642
12 Ga0070670_100029346 3300005331 Bacteria 4734
13 Ga0070670_100059809 3300005331 Bacteria 3271
14 Ga0070670_100341469 3300005331 Bacteria 1314
15 Ga0070666_10007822 3300005335 Bacteria 6601
16 Ga0070666_10014598 3300005335 Bacteria 5001
17 Ga0070666_10135376 3300005335 Bacteria 1714
18 Ga0068868_100212153 3300005338 Bacteria 1618
19 Ga0070660_100101243 3300005339 Bacteria 2283
20 Ga0070689_100019528 3300005340 Bacteria 5012
21 Ga0070689_100070646 3300005340 Bacteria 2726
22 Ga0070689_100209815 3300005340 Bacteria 1594
23 Ga0070687_100001575 3300005343 Bacteria 8111
24 Ga0070668_100008384 3300005347 Bacteria 7675
25 Ga0070668_100599329 3300005347 Bacteria 964
26 Ga0070668_100904596 3300005347 Bacteria 789
27 Ga0070669_100001489 3300005353 Bacteria 16923
28 Ga0070669_100205900 3300005353 Bacteria 1550
29 Ga0070675_100291323 3300005354 Bacteria 1437
30 Ga0070671_100001709 3300005355 Bacteria 16660
31 Ga0070671_100054688 3300005355 Bacteria 3319
32 Ga0070671_100722399 3300005355 Bacteria 865
33 Ga0070674_100355375 3300005356 Bacteria 1185
34 Ga0070688_100470697 3300005365 Bacteria 943
35 Ga0070667_100019202 3300005367 Bacteria 5668
36 Ga0070667_100024186 3300005367 Bacteria 5045
37 Ga0070667_100104363 3300005367 Bacteria 2452
38 Ga0070703_10021001 3300005406 Bacteria 1905
39 Ga0070709_10008191 3300005434 Bacteria 5739
40 Ga0070709_10142422 3300005434 Bacteria 1648
41 Ga0070714_100027888 3300005435 Bacteria 4679
42 Ga0070714_100102705 3300005435 Bacteria 2521
43 Ga0070713_100003459 3300005436 Bacteria 10428
44 Ga0070713_100069688 3300005436 Bacteria 2966
45 Ga0070713_100444985 3300005436 Bacteria 1216
46 Ga0070713_100513604 3300005436 Bacteria 1132
47 Ga0070710_10015742 3300005437 Bacteria 3834
48 Ga0070710_10069799 3300005437 Bacteria 2022
49 Ga0070701_10001746 3300005438 Bacteria 8180
50 Ga0070711_100042369 3300005439 Bacteria 3077
51 Ga0070711_100049397 3300005439 Bacteria 2881
52 Ga0070705_100303501 3300005440 Bacteria 1145
53 Ga0070700_100191742 3300005441 Bacteria 1429
54 Ga0070708_100028912 3300005445 Bacteria 4774
55 Ga0070708_100049539 3300005445 Bacteria 3716
56 Ga0070663_100040341 3300005455 Bacteria 3267
57 Ga0070678_100124732 3300005456 Bacteria 2036
58 Ga0070662_100203744 3300005457 Bacteria 1571
59 Ga0070662_100635597 3300005457 Bacteria 900
60 Ga0070681_10087284 3300005458 Bacteria 3073
61 Ga0070685_10009109 3300005466 Bacteria 5121
62 Ga0070706_100110008 3300005467 Bacteria 2564
63 Ga0070706_100819125 3300005467 Bacteria 861
64 Ga0070707_100237479 3300005468 Bacteria 1774
65 Ga0070699_100000717 3300005518 Bacteria 30798
66 Ga0070699_100036672 3300005518 Bacteria 4241
67 Ga0070679_100011913 3300005530 Bacteria 8300
68 Ga0070684_100094649 3300005535 Bacteria 2661
69 Ga0070684_100234321 3300005535 Bacteria 1677
70 Ga0070697_100156271 3300005536 Bacteria 1925
71 Ga0070697_100250049 3300005536 Bacteria 1516
72 Ga0070697_100677961 3300005536 Bacteria 909
73 Ga0068853_100084749 3300005539 Bacteria 2777
74 Ga0068853_100576132 3300005539 Bacteria 1068
75 Ga0070672_100002423 3300005543 Bacteria 11819
76 Ga0070672_100288078 3300005543 Bacteria 1390
77 Ga0070686_100015395 3300005544 Bacteria 4430
78 Ga0070686_100051639 3300005544 Bacteria 2618
79 Ga0070696_100432946 3300005546 Bacteria 1035
80 Ga0070665_100000878 3300005548 Bacteria 38691
81 Ga0070665_100179628 3300005548 Bacteria 2117
82 Ga0070665_100296757 3300005548 Bacteria 1619
83 Ga0070665_100486803 3300005548 Bacteria 1244
84 Ga0070665_100552463 3300005548 Bacteria 1164
85 Ga0070665_100628769 3300005548 Bacteria 1086
86 Ga0070704_100099533 3300005549 Bacteria 2187
87 Ga0068855_100158370 3300005563 Bacteria 2571
88 Ga0068855_100161916 3300005563 Bacteria 2539
89 Ga0068855_100165476 3300005563 Bacteria 2507
90 Ga0068855_100284905 3300005563 Bacteria 1833
91 Ga0070664_100029016 3300005564 Bacteria 4609
92 Ga0070664_100180645 3300005564 Bacteria 1875
93 Ga0068857_100071066 3300005577 Bacteria 3101
94 Ga0068854_100094741 3300005578 Bacteria 2227
95 Ga0068856_100024659 3300005614 Bacteria 5856
96 Ga0068856_100201123 3300005614 Bacteria 2007
97 Ga0068859_100059542 3300005617 Bacteria 3847
98 Ga0068864_100017927 3300005618 Bacteria 5906
99 Ga0068864_100146926 3300005618 Bacteria 2132
100 Ga0068864_100722170 3300005618 Bacteria 975
101 Ga0068866_10249146 3300005718 Bacteria 1086
102 Ga0068861_100020438 3300005719 Bacteria 4743
103 Ga0068861_100123913 3300005719 Bacteria 2088
104 Ga0068861_100493072 3300005719 Bacteria 1106
105 Ga0068851_10059535 3300005834 Bacteria 1954
106 Ga0068851_10235888 3300005834 Bacteria 1033
107 Ga0068870_10013821 3300005840 Bacteria 3801
108 Ga0068863_100005190 3300005841 Bacteria 12849
109 Ga0068858_100098872 3300005842 Bacteria 2720
110 Ga0068858_100190548 3300005842 Bacteria 1938
111 Ga0068860_100008518 3300005843 Bacteria 10217
112 Ga0068860_100034327 3300005843 Bacteria 4864
113 Ga0068860_100396868 3300005843 Bacteria 1364
114 Ga0068862_100038784 3300005844 Bacteria 4042
115 Ga0081455_10004816 3300005937 Bacteria 14997
116 Ga0081455_10016316 3300005937 Bacteria 7176
117 Ga0081455_10047841 3300005937 Bacteria 3700
118 Ga0081538_10119520 3300005981 Bacteria 1270
119 Ga0081540_1006146 3300005983 Bacteria 8814
120 Ga0081540_1026123 3300005983 Bacteria 3341
121 Ga0081540_1027834 3300005983 Bacteria 3191
122 Ga0081540_1044506 3300005983 Bacteria 2265
123 Ga0081540_1093159 3300005983 Bacteria 1320
124 Ga0081539_10003518 3300005985 Bacteria 19096
125 Ga0081539_10036773 3300005985 Bacteria 2924
126 Ga0070717_10048895 3300006028 Bacteria 3470
127 Ga0070717_10400721 3300006028 Bacteria 1233
128 Ga0070717_10690714 3300006028 Bacteria 927
129 Ga0075365_10020959 3300006038 Bacteria 4067
130 Ga0075365_10027361 3300006038 Bacteria 3628
131 Ga0075365_10110049 3300006038 Bacteria 1893
132 Ga0075368_10040532 3300006042 Bacteria 1829
133 Ga0075368_10096447 3300006042 Bacteria 1212
134 Ga0075363_100317717 3300006048 Bacteria 906
135 Ga0075364_10049166 3300006051 Bacteria 2750
136 Ga0075364_10139548 3300006051 Bacteria 1629
137 Ga0075364_10318966 3300006051 Bacteria 1058
138 Ga0070715_10352543 3300006163 Bacteria 804
139 Ga0070716_100161921 3300006173 Bacteria 1451
140 Ga0070716_100234783 3300006173 Bacteria 1240
141 Ga0070712_100001343 3300006175 Bacteria 14919
142 Ga0070712_100014615 3300006175 Bacteria 5038
143 Ga0070712_100165235 3300006175 Bacteria 1712
144 Ga0070712_100196549 3300006175 Bacteria 1581
145 Ga0070712_100245625 3300006175 Bacteria 1428
146 Ga0070712_100259710 3300006175 Bacteria 1391
147 Ga0070712_100308161 3300006175 Bacteria 1284
148 Ga0075362_10209003 3300006177 Bacteria 952
149 Ga0075369_10065649 3300006186 Bacteria 1591
150 Ga0075366_10006588 3300006195 Bacteria 6373
151 Ga0097621_100008043 3300006237 Bacteria 7571
152 Ga0097621_100384174 3300006237 Bacteria 1255
153 Ga0075370_10025723 3300006353 Bacteria 3256
154 Ga0075370_10350461 3300006353 Bacteria 882
155 Ga0068871_100317150 3300006358 Bacteria 1372
156 Ga0075428_100009253 3300006844 Bacteria 10926
157 Ga0075428_100028270 3300006844 Bacteria 6201
158 Ga0075428_100028529 3300006844 Bacteria 6175
159 Ga0075428_100825653 3300006844 Bacteria 985
160 Ga0075430_100012173 3300006846 Bacteria 7324
161 Ga0075430_100062697 3300006846 Bacteria 3122
162 Ga0075430_100157895 3300006846 Bacteria 1888
163 Ga0075431_100001953 3300006847 Bacteria 19671
164 Ga0075431_100026428 3300006847 Bacteria 5955
165 Ga0075431_100780565 3300006847 Bacteria 929
166 Ga0075434_100041554 3300006871 Bacteria 4555
167 Ga0075434_100126898 3300006871 Bacteria 2568
168 Ga0075434_100203965 3300006871 Bacteria 1998
169 Ga0075434_100230744 3300006871 Bacteria 1870
170 Ga0075429_100189038 3300006880 Bacteria 1805
171 Ga0075429_100255844 3300006880 Bacteria 1533
172 Ga0068865_100100265 3300006881 Bacteria 2119
173 Ga0075436_100053515 3300006914 Bacteria 2787
174 Ga0075436_100466644 3300006914 Bacteria 921
175 Ga0075436_100513875 3300006914 Bacteria 877
176 Ga0097620_100059542 3300006931 Bacteria 3847
177 Ga0099824_1005291 3300006942 Bacteria 18236
178 Ga0099822_1009136 3300006943 Bacteria 12548
179 Ga0075435_100411046 3300007076 Bacteria 1165
180 Ga0099794_10088432 3300007265 Bacteria 1535
181 Ga0099794_10104583 3300007265 Bacteria 1415
182 Ga0099795_10030859 3300007788 Bacteria 1842
183 Ga0099795_10066638 3300007788 Bacteria 1349
184 Ga0099795_10092521 3300007788 Bacteria 1174
185 Ga0105251_10001607 3300009011 Bacteria 19211
186 Ga0105251_10081356 3300009011 Bacteria 1496
187 Ga0105240_10463334 3300009093 Bacteria 1416
188 Ga0105240_10601656 3300009093 Bacteria 1210
189 Ga0105240_10729270 3300009093 Bacteria 1079
190 Ga0111539_10000738 3300009094 Bacteria 42458
191 Ga0111539_10011258 3300009094 Bacteria 11240
192 Ga0111539_10320595 3300009094 Bacteria 1803
193 Ga0111539_10370171 3300009094 Bacteria 1668
194 Ga0111539_10644208 3300009094 Bacteria 1234
195 Ga0105245_10056795 3300009098 Bacteria 3519
196 Ga0105245_10620426 3300009098 Bacteria 1109
197 Ga0105247_10154430 3300009101 Bacteria 1515
198 Ga0105247_10160061 3300009101 Bacteria 1490
199 Ga0105247_10282670 3300009101 Bacteria 1145
200 Ga0114129_10000066 3300009147 Bacteria 93802
201 Ga0114129_10001660 3300009147 Bacteria 30291
202 Ga0114129_10006951 3300009147 Bacteria 16099
203 Ga0114129_10079963 3300009147 Bacteria 4545
204 Ga0105242_10333190 3300009176 Bacteria 1396
205 Ga0105242_10744350 3300009176 Bacteria 964
206 Ga0105248_10003673 3300009177 Bacteria 16996
207 Ga0105248_10054219 3300009177 Bacteria 4496
208 Ga0105248_11075705 3300009177 Bacteria 909
209 Ga0105238_10016713 3300009551 Bacteria 7435
210 Ga0105238_10063079 3300009551 Bacteria 3706
211 Ga0105238_10128894 3300009551 Bacteria 2508
212 Ga0105238_10278341 3300009551 Bacteria 1654
213 Ga0105238_11395569 3300009551 Bacteria 728
214 Ga0105249_10014702 3300009553 Bacteria 6919
215 Ga0105249_10242254 3300009553 Bacteria 1783
216 Ga0099796_10052025 3300010159 Bacteria 1425
217 Ga0105239_10083591 3300010375 Bacteria 3516
218 Ga0105239_10417386 3300010375 Bacteria 1520
219 Ga0105239_10521684 3300010375 Bacteria 1351
220 Ga0105246_10002911 3300011119 Bacteria 10360
221 Ga0157370_10019448 3300013104 Bacteria 6812
222 Ga0157374_10021511 3300013296 Bacteria 5742
223 Ga0157374_10023190 3300013296 Bacteria 5545
224 Ga0157374_11152836 3300013296 Bacteria 796
225 Ga0157378_10731701 3300013297 Bacteria 1011
226 Ga0163162_10254662 3300013306 Bacteria 1887
227 Ga0163162_10340694 3300013306 Bacteria 1632
228 Ga0163162_10441334 3300013306 Bacteria 1434
229 Ga0163162_10491180 3300013306 Bacteria 1359
230 Ga0163162_10735479 3300013306 Bacteria 1106
231 Ga0157372_10510489 3300013307 Bacteria 1402
232 Ga0157375_10004170 3300013308 Bacteria 12545
233 Ga0163163_10054759 3300014325 Bacteria 3942
234 Ga0163163_10060794 3300014325 Bacteria 3742
235 Ga0163163_10130068 3300014325 Bacteria 2557
236 Ga0157380_10914808 3300014326 Bacteria 904
237 Ga0157377_10008253 3300014745 Bacteria 5071
238 Ga0157379_10000337 3300014968 Bacteria 37644
239 Ga0157379_10201161 3300014968 Bacteria 1801
240 Ga0157379_10472790 3300014968 Bacteria 1159
241 Ga0157376_10253271 3300014969 Bacteria 1646
242 Ga0163161_10176237 3300017792 Bacteria 1637
243 Ga0213872_10047326 3300021361 Bacteria 1956
244 Ga0213876_10255639 3300021384 Bacteria 931
245 Ga0213875_10000003 3300021388 Bacteria 719367
246 Ga0213875_10014516 3300021388 Bacteria 3842
247 Ga0209233_1001106 3300025261 Bacteria 11025
248 Ga0207697_10065121 3300025315 Bacteria 1520
249 Ga0207696_1000069 3300025711 Bacteria 227744
250 Ga0207713_1024593 3300025735 Bacteria 2804
251 Ga0207692_10012729 3300025898 Bacteria 3622
252 Ga0207692_10056398 3300025898 Bacteria 2015
253 Ga0207642_10024956 3300025899 Bacteria 2411
254 Ga0207642_10259968 3300025899 Bacteria 989
255 Ga0207710_10002725 3300025900 Bacteria 8091
256 Ga0207710_10068985 3300025900 Bacteria 1618
257 Ga0207688_10002899 3300025901 Bacteria 9323
258 Ga0207680_10143822 3300025903 Bacteria 1583
259 Ga0207647_10264749 3300025904 Bacteria 984
260 Ga0207685_10044480 3300025905 Bacteria 1679
261 Ga0207685_10179596 3300025905 Bacteria 980
262 Ga0207699_10002630 3300025906 Bacteria 8485
263 Ga0207699_10061074 3300025906 Bacteria 2266
264 Ga0207645_10078327 3300025907 Bacteria 2118
265 Ga0207643_10010894 3300025908 Bacteria 4904
266 Ga0207684_10060869 3300025910 Bacteria 3207
267 Ga0207684_10300491 3300025910 Bacteria 1384
268 Ga0207684_10371854 3300025910 Bacteria 1230
269 Ga0207707_10209679 3300025912 Bacteria 1697
270 Ga0207695_10254109 3300025913 Bacteria 1656
271 Ga0207695_10400739 3300025913 Bacteria 1256
272 Ga0207693_10003110 3300025915 Bacteria 14279
273 Ga0207693_10003660 3300025915 Bacteria 13116
274 Ga0207693_10009510 3300025915 Bacteria 7919
275 Ga0207693_10010641 3300025915 Bacteria 7464
276 Ga0207693_10069552 3300025915 Bacteria 2755
277 Ga0207693_10118075 3300025915 Bacteria 2083
278 Ga0207693_10179919 3300025915 Bacteria 1664
279 Ga0207693_10325227 3300025915 Bacteria 1204
280 Ga0207663_10024028 3300025916 Bacteria 3506
281 Ga0207663_10039429 3300025916 Bacteria 2862
282 Ga0207663_10839291 3300025916 Bacteria 733
283 Ga0207662_10012930 3300025918 Bacteria 4659
284 Ga0207662_10133272 3300025918 Bacteria 1568
285 Ga0207662_10227613 3300025918 Bacteria 1216
286 Ga0207657_10023776 3300025919 Bacteria 5698
287 Ga0207652_10236858 3300025921 Bacteria 1645
288 Ga0207681_10004621 3300025923 Bacteria 8464
289 Ga0207681_10396750 3300025923 Bacteria 1113
290 Ga0207694_10080844 3300025924 Bacteria 2551
291 Ga0207694_10228986 3300025924 Bacteria 1517
292 Ga0207694_10796247 3300025924 Bacteria 798
293 Ga0207650_10566048 3300025925 Bacteria 953
294 Ga0207659_10177489 3300025926 Bacteria 1685
295 Ga0207700_10007283 3300025928 Bacteria 6751
296 Ga0207700_10014254 3300025928 Bacteria 5202
297 Ga0207700_10066662 3300025928 Bacteria 2752
298 Ga0207700_10082668 3300025928 Bacteria 2511
299 Ga0207700_10361957 3300025928 Bacteria 1265
300 Ga0207700_10374834 3300025928 Bacteria 1243
301 Ga0207664_10015284 3300025929 Bacteria 5565
302 Ga0207664_10261761 3300025929 Bacteria 1513
303 Ga0207644_10000766 3300025931 Bacteria 20334
304 Ga0207644_10366151 3300025931 Bacteria 1173
305 Ga0207706_10006548 3300025933 Bacteria 10789
306 Ga0207686_10052111 3300025934 Bacteria 2552
307 Ga0207686_10622156 3300025934 Bacteria 852
308 Ga0207670_10117060 3300025936 Bacteria 1930
309 Ga0207669_10103541 3300025937 Bacteria 1888
310 Ga0207704_10012670 3300025938 Bacteria 4189
311 Ga0207704_10275206 3300025938 Bacteria 1277
312 Ga0207704_10552667 3300025938 Bacteria 936
313 Ga0207665_10009844 3300025939 Bacteria 6274
314 Ga0207665_10090679 3300025939 Bacteria 2119
315 Ga0207665_10164180 3300025939 Bacteria 1600
316 Ga0207691_10003357 3300025940 Bacteria 15574
317 Ga0207691_10357093 3300025940 Bacteria 1250
318 Ga0207691_10539881 3300025940 Bacteria 989
319 Ga0207711_10021216 3300025941 Bacteria 5425
320 Ga0207711_10028224 3300025941 Bacteria 4721
321 Ga0207711_10055922 3300025941 Bacteria 3389
322 Ga0207689_10006940 3300025942 Bacteria 9955
323 Ga0207661_10075743 3300025944 Bacteria 2762
324 Ga0207667_10235367 3300025949 Bacteria 1875
325 Ga0207667_10263950 3300025949 Bacteria 1761
326 Ga0207651_10049729 3300025960 Bacteria 2842
327 Ga0207668_10003508 3300025972 Bacteria 9212
328 Ga0207658_10121106 3300025986 Bacteria 2086
329 Ga0207677_10108897 3300026023 Bacteria 2058
330 Ga0207677_10190094 3300026023 Bacteria 1623
331 Ga0207703_10393635 3300026035 Bacteria 1284
332 Ga0207703_10496398 3300026035 Bacteria 1145
333 Ga0207678_10020239 3300026067 Bacteria 5841
334 Ga0207708_10020532 3300026075 Bacteria 4982
335 Ga0207702_10680116 3300026078 Bacteria 1013
336 Ga0207641_10002368 3300026088 Bacteria 17394
337 Ga0207641_10168052 3300026088 Bacteria 1999
338 Ga0207648_10009789 3300026089 Bacteria 9159
339 Ga0207674_10016631 3300026116 Bacteria 8043
340 Ga0207675_100027113 3300026118 Bacteria 5335
341 Ga0207675_100035708 3300026118 Bacteria 4636
342 Ga0207675_100297291 3300026118 Bacteria 1572
343 Ga0207683_10004116 3300026121 Bacteria 12575
344 Ga0207683_10377477 3300026121 Bacteria 1303
345 Ga0209589_1000169 3300027357 Bacteria 74106
346 Ga0209489_100493 3300027361 Bacteria 74106
347 Ga0209700_100497 3300027363 Bacteria 74106
348 Ga0209179_1016447 3300027512 Bacteria 1388
349 Ga0209179_1042443 3300027512 Bacteria 961
350 Ga0209588_1081018 3300027671 Bacteria 1048
351 Ga0207428_10009685 3300027907 Bacteria 8632
352 Ga0207428_10038770 3300027907 Bacteria 3871
353 Ga0207428_10264532 3300027907 Bacteria 1280
354 Ga0268266_10001045 3300028379 Bacteria 34723
355 Ga0268266_10439028 3300028379 Bacteria 1239
356 Ga0268265_10248672 3300028380 Bacteria 1573
357 Ga0268264_10027604 3300028381 Bacteria 4640
358 Ga0268264_10431014 3300028381 Bacteria 1273
359 Ga0268264_11071567 3300028381 Bacteria 814
360 Ga0265337_1033729 3300028556 Bacteria 1509
361 Ga0265318_10002991 3300028577 Bacteria 8732
362 Ga0265338_10040511 3300028800 Bacteria 4375
363 Ga0265332_10004192 3300031238 Bacteria 6824
364 Ga0265328_10002177 3300031239 Bacteria 8837
365 Ga0265329_10004078 3300031242 Bacteria 6203
366 Ga0265340_10018198 3300031247 Bacteria 3626
367 Ga0265339_10000560 3300031249 Bacteria 29070
368 Ga0265339_10089663 3300031249 Bacteria 1614
369 Ga0265331_10007385 3300031250 Bacteria 6363
370 Ga0265331_10088808 3300031250 Bacteria 1430
371 Ga0265316_10010754 3300031344 Bacteria 8313
372 Ga0265316_10450598 3300031344 Bacteria 923
373 Ga0307513_10318621 3300031456 Bacteria 1314
374 Ga0265313_10056460 3300031595 Bacteria 1857
375 Ga0265313_10113189 3300031595 Bacteria 1191
376 Ga0265314_10021351 3300031711 Bacteria 4979
377 Ga0265342_10024786 3300031712 Bacteria 3782
378 Ga0265342_10221330 3300031712 Bacteria 1020
379 Ga0307516_10001689 3300031730 Bacteria 30398
380 Ga0307412_10687239 3300031911 Bacteria 877
381 Ga0315911_1000010 3300033442 Bacteria 322197
382 Ga0373959_0033404 3300034820 Bacteria 1050
383 Ga0373923_0060006 3300035111 Bacteria 1614
384 Ga0373923_0080451 3300035111 Bacteria 1413
385 Ga0373923_0179373 3300035111 Bacteria 973
386 Ga0373936_0069859 3300035113 Bacteria 1446
387 Ga0373936_0226874 3300035113 Bacteria 830
388 Ga0373939_0084490 3300035114 Bacteria 1061
389 Ga0373953_0009911 3300035117 Bacteria 3300
390 Ga0373953_0076702 3300035117 Bacteria 1385
391 Ga0373954_0083020 3300035118 Bacteria 1533
392 Ga0373943_0006818 3300035170 Bacteria 5124
393 Ga0373943_0260670 3300035170 Bacteria 976
394 Ga0373946_0027806 3300035171 Bacteria 2240
395 Ga0373946_0041774 3300035171 Bacteria 1882
396 Ga0373946_0046375 3300035171 Bacteria 1801
397 Ga0373946_0216268 3300035171 Bacteria 924
398 Ga0373955_0131500 3300035172 Bacteria 1461
399 Ga0373961_0036898 3300035241 Bacteria 1394
400 Ga0373961_0054874 3300035241 Bacteria 1192
401 Ga0373924_0016771 3300035410 Bacteria 2801
402 Ga0373931_0003811 3300035691 Bacteria 6813
403 Ga0373931_0041850 3300035691 Bacteria 2408
404 Ga0373935_0111923 3300035692 Bacteria 1813
405 Ga0373927_0001542 3300035695 Bacteria 17306
406 Ga0373927_0023442 3300035695 Bacteria 4042
407 Ga0373927_0262302 3300035695 Bacteria 1136
408 Ga0373933_0000241 3300035724 Bacteria 35958
409 Ga0373933_0038660 3300035724 Bacteria 2804
410 Ga0373933_0088942 3300035724 Bacteria 1903
411 Ga0373947_0055198 3300035725 Bacteria 2398
412 Ga0373947_0337935 3300035725 Bacteria 1009
413 Ga0373937_0000443 3300036401 Bacteria 38365
414 Ga0373937_0004815 3300036401 Bacteria 11472
415 Ga0373937_0029738 3300036401 Bacteria 4949
416 Ga0373937_0094017 3300036401 Bacteria 2780
417 Ga0373925_0135223 3300037068 Bacteria 1926
418 Ga0395900_0306356 3300037418 Bacteria 1573
419 Ga0395905_0189760 3300037471 Bacteria 1928
420 Ga0436364_0010210 3300037853 Bacteria 5361
421 Ga0436364_0645586 3300037853 Bacteria 957
422 Ga0436364_0693200 3300037853 Bacteria 3616
423 Ga0436364_0858723 3300037853 Bacteria 883
424 Ga0436364_0875435 3300037853 Bacteria 49936
425 Ga0395901_0145072 3300038443 Bacteria 2495
426 Ga0436365_0464318 3300039437 Bacteria 4661
427 Ga0436365_0650883 3300039437 Bacteria 1467
428 Ga0436365_1522619 3300039437 Bacteria 2033
429 Ga0436365_1878830 3300039437 Bacteria 1402
430 Ga0436360_0364414 3300039438 Bacteria 19147
431 Ga0436360_0651179 3300039438 Bacteria 810
432 Ga0436361_0210879 3300039447 Bacteria 17162
433 Ga0436361_0213695 3300039447 Bacteria 9267
434 Ga0436363_1328344 3300039450 Bacteria 1394
435 Ga0436363_1586335 3300039450 Bacteria 1078
436 Ga0439453_0002403 3300041408 Bacteria 2581
437 Ga0451853_0208434 3300041512 Bacteria 1846
438 Ga0451853_0775028 3300041512 Bacteria 1814
439 Ga0451853_2874200 3300041512 Bacteria 2182
440 Ga0439445_0078464 3300042004 Bacteria 921
441 Ga0439435_0071635 3300042436 Bacteria 1027
442 Ga0439464_0089113 3300042439 Bacteria 928
443 Ga0439464_0153295 3300042439 Bacteria 722
444 Ga0466969_0133123 3300044656 Bacteria 1152
445 Ga0495603_0003868 3300046455 Bacteria 8914
446 Ga0495603_0271087 3300046455 Bacteria 976
447 Ga0495629_0092226 3300046459 Bacteria 2114
448 Ga0495638_0001008 3300046460 Bacteria 28102
449 Ga0495638_0143486 3300046460 Bacteria 1391
450 Ga0495653_0012660 3300046463 Bacteria 6890
451 Ga0495650_0039296 3300046471 Bacteria 2043
452 Ga0495580_0462668 3300046472 Bacteria 850
453 Ga0495639_0030518 3300046475 Bacteria 2396
454 Ga0495662_0003605 3300046476 Bacteria 7810
455 Ga0495664_0000470 3300046477 Bacteria 19968
456 Ga0495583_0000030 3300046506 Bacteria 254970
457 Ga0495616_0185918 3300046513 Bacteria 921
458 Ga0495618_0002529 3300046514 Bacteria 11712
459 Ga0495618_0045054 3300046514 Bacteria 2782
460 Ga0495628_0266660 3300046516 Bacteria 1275
461 Ga0495630_0012167 3300046517 Bacteria 6241
462 Ga0495630_0131397 3300046517 Bacteria 1901
463 Ga0495663_0105543 3300046525 Bacteria 932
464 Ga0495652_0040999 3300046529 Bacteria 3999
465 Ga0495665_0170716 3300046531 Bacteria 1132
466 Ga0495640_0063900 3300046533 Bacteria 2490
467 Ga0495587_0022150 3300046536 Bacteria 3914
468 Ga0495598_0001623 3300046537 Bacteria 4507
469 Ga0495598_0037712 3300046537 Bacteria 1395
470 Ga0495597_0189544 3300046542 Bacteria 828
471 Ga0495645_0024307 3300046543 Bacteria 4395
472 Ga0495645_0278167 3300046543 Bacteria 1102
473 Ga0495622_0069274 3300046557 Bacteria 1629
474 Ga0495667_0029980 3300046559 Bacteria 3658
475 Ga0495667_0200899 3300046559 Bacteria 1276
476 Ga0495656_0090592 3300046615 Bacteria 1398
477 Ga0495634_0004229 3300046642 Bacteria 11333
478 Ga0495634_0017525 3300046642 Bacteria 5107
479 Ga0495625_0005241 3300046660 Bacteria 11930
480 Ga0495635_0000867 3300046663 Bacteria 19857
481 Ga0495659_0094622 3300046664 Bacteria 1151
482 Ga0495661_0045282 3300046665 Bacteria 2692
483 Ga0495588_0277551 3300046674 Bacteria 883
484 Ga0495599_0039406 3300046678 Bacteria 2969
485 Ga0495623_0097719 3300046679 Bacteria 1793
486 Ga0495646_0083260 3300046680 Bacteria 1860
487 Ga0495647_0243790 3300046681 Bacteria 799
488 Ga0495613_0076922 3300046689 Bacteria 2428
489 Ga0495670_0007381 3300046691 Bacteria 5404
490 Ga0495670_0255100 3300046691 Bacteria 935
491 Ga0495649_0104271 3300046694 Bacteria 1506
492 Ga0495600_0339950 3300046809 Bacteria 941
493 Ga0495581_0051698 3300047315 Bacteria 2373
494 Ga0495604_0155548 3300047317 Bacteria 1620
495 Ga0495604_0256999 3300047317 Bacteria 1189
496 Ga0495674_0014795 3300047319 Bacteria 7299
497 Ga0495672_0024237 3300047320 Bacteria 3913
498 Ga0495672_0070699 3300047320 Bacteria 1977
499 Ga0495676_0027638 3300047321 Bacteria 4861
500 Ga0495675_0038586 3300047444 Bacteria 3041
501 Ga0495684_0042111 3300047471 Bacteria 3498
502 Ga0495684_0091366 3300047471 Bacteria 2306
503 Ga0495684_0175165 3300047471 Bacteria 1593
504 Ga0495686_0000811 3300047472 Bacteria 40468
505 Ga0495686_0007753 3300047472 Bacteria 7997
506 Ga0495593_0051386 3300047673 Bacteria 2181
507 Ga0495593_0085345 3300047673 Bacteria 1629
508 Ga0495602_0402147 3300048088 Bacteria 976
509 Ga0496100_0000732 3300048903 Bacteria 15681
510 Ga0496100_0292383 3300048903 Bacteria 1217
511 Ga0496101_0043904 3300048904 Bacteria 3196
512 Ga0496101_0366390 3300048904 Bacteria 1133
513 Ga0496102_0012404 3300048905 Bacteria 7374
514 Ga0496102_0014870 3300048905 Bacteria 6770
515 Ga0496102_0062343 3300048905 Bacteria 3414
516 Ga0496102_0235571 3300048905 Bacteria 1726
517 Ga0496103_0033054 3300048906 Bacteria 3159
518 Ga0496104_0000206 3300048907 Bacteria 52627
519 Ga0496104_0005540 3300048907 Bacteria 11059
520 Ga0496104_0021277 3300048907 Bacteria 5952
521 Ga0496104_0076846 3300048907 Bacteria 3180
522 Ga0496105_0016883 3300048908 Bacteria 5840
523 Ga0496106_0014703 3300048909 Bacteria 5785
524 Ga0496106_0101315 3300048909 Bacteria 2234
525 Ga0496107_0006176 3300048910 Bacteria 8229
526 Ga0496107_0222909 3300048910 Bacteria 1403
527 Ga0496107_0285951 3300048910 Bacteria 1227
528 Ga0496108_0000822 3300048911 Bacteria 24137
529 Ga0496108_0043926 3300048911 Bacteria 3732
530 Ga0496108_0293393 3300048911 Bacteria 1416
531 Ga0496108_0795824 3300048911 Bacteria 816
532 Ga0496109_0001115 3300048912 Bacteria 22294
533 Ga0496109_0045438 3300048912 Bacteria 3986
534 Ga0496109_0875009 3300048912 Bacteria 836
535 Ga0496110_0021839 3300048913 Bacteria 5427
536 Ga0496110_0026250 3300048913 Bacteria 4982
537 Ga0496110_0032798 3300048913 Bacteria 4489
538 Ga0496110_0150019 3300048913 Bacteria 2110
539 Ga0496110_0196993 3300048913 Bacteria 1829
540 Ga0496110_0438800 3300048913 Bacteria 1190
541 Ga0496111_0003041 3300048914 Bacteria 10287
542 Ga0496111_0035832 3300048914 Bacteria 3547
543 Ga0496111_0138244 3300048914 Bacteria 1805
544 Ga0496112_0001495 3300048915 Bacteria 18003
545 Ga0496112_0004396 3300048915 Bacteria 11925
546 Ga0496112_0018494 3300048915 Bacteria 6561
547 Ga0496112_0664350 3300048915 Bacteria 971
548 Ga0496113_0003524 3300048916 Bacteria 9393
549 Ga0496113_0041380 3300048916 Bacteria 3400
550 Ga0496113_0499072 3300048916 Bacteria 977
551 Ga0496114_0015030 3300048917 Bacteria 6223
552 Ga0496114_0020954 3300048917 Bacteria 5310
553 Ga0496115_0010899 3300048918 Bacteria 6805
554 Ga0496115_0020878 3300048918 Bacteria 5055
555 Ga0496115_0061380 3300048918 Bacteria 3030
556 Ga0496115_0067660 3300048918 Bacteria 2889
557 Ga0496115_0164267 3300048918 Bacteria 1836
558 Ga0496115_0175129 3300048918 Bacteria 1774
559 Ga0496115_0207488 3300048918 Bacteria 1618
560 Ga0496116_0269129 3300048919 Bacteria 834
561 Ga0496118_0027055 3300048921 Bacteria 4864
562 Ga0496118_0041510 3300048921 Bacteria 3641
563 Ga0496119_0008671 3300048922 Bacteria 8891
564 Ga0496119_0140041 3300048922 Bacteria 1307
565 Ga0496120_0069541 3300048923 Bacteria 1939
566 Ga0496121_0000923 3300048924 Bacteria 53102
567 Ga0496121_0008770 3300048924 Bacteria 11796
568 Ga0496121_0183637 3300048924 Bacteria 1507
569 Ga0496123_0137237 3300048926 Bacteria 1344
570 Ga0496123_0222752 3300048926 Bacteria 950
571 Ga0496124_0089663 3300048927 Bacteria 2510
572 Ga0496124_0224791 3300048927 Bacteria 1409
573 Ga0496125_0055387 3300048928 Bacteria 3231
574 Ga0496125_0065358 3300048928 Bacteria 2882
575 Ga0496126_0002227 3300048929 Bacteria 26819
576 Ga0496126_0069530 3300048929 Bacteria 3140
577 Ga0496126_0101280 3300048929 Bacteria 2520
578 Ga0496126_0368407 3300048929 Bacteria 1172
579 Ga0496126_0450369 3300048929 Bacteria 1036
580 Ga0501031_0421220 3300049568 Bacteria 863
581 Ga0501036_0480833 3300049572 Bacteria 1034
582 Ga0501046_0164933 3300049580 Bacteria 1664
583 Ga0501046_0205092 3300049580 Bacteria 1466
584 Ga0501047_0222923 3300049581 Bacteria 1741
585 Ga0501072_0017442 3300049588 Bacteria 5516
586 Ga0501072_0206770 3300049588 Bacteria 1565
587 Ga0501076_0108736 3300049592 Bacteria 2240
588 Ga0501077_0074876 3300049593 Bacteria 2144
589 Ga0501079_0380106 3300049741 Bacteria 1107
590 Ga0501080_0878199 3300049742 Bacteria 783
591 Ga0501081_0054244 3300049743 Bacteria 2770
592 Ga0501081_0233668 3300049743 Bacteria 1340
593 Ga0501081_0269933 3300049743 Bacteria 1244
594 Ga0501081_0502410 3300049743 Bacteria 904
595 Ga0501083_0015836 3300049744 Bacteria 5278
596 Ga0501083_0381416 3300049744 Bacteria 917
597 Ga0501045_0014870 3300049824 Bacteria 5520
598 nmdc:mga03683_11845_c2 3300050489 Bacteria 2660
599 nmdc:mga03683_69359_c1 3300050489 Bacteria 1504
600 nmdc:mga03683_8694_c1 3300050489 Bacteria 3579
601 nmdc:mga03n38_149464_c1 3300050490 Bacteria 1174
602 nmdc:mga0yw44_1495_c1 3300050492 Bacteria 6905
603 nmdc:mga0yw44_9814_c1 3300050492 Bacteria 4861
604 nmdc:mga0yw44_98448_c1 3300050492 Bacteria 1859
605 nmdc:mga0k408_11727_c1 3300050493 Bacteria 4780
606 nmdc:mga0k408_371521_c1 3300050493 Bacteria 852
607 nmdc:mga0k408_5327_c1 3300050493 Bacteria 6832
608 nmdc:mga06z11_14848_c1 3300050494 Bacteria 3461
609 nmdc:mga06z11_214082_c1 3300050494 Bacteria 1124
610 nmdc:mga06z11_27431_c1 3300050494 Bacteria 2722
611 nmdc:mga06z11_32286_c1 3300050494 Bacteria 2552
612 nmdc:mga06z11_89510_c1 3300050494 Bacteria 1668
613 nmdc:mga04h51_100923_c1 3300050495 Bacteria 1051
614 nmdc:mga04h51_213639_c1 3300050495 Bacteria 762
615 nmdc:mga07m45_180557_c1 3300050496 Bacteria 1227
616 nmdc:mga07m45_30738_c1 3300050496 Bacteria 2975
617 nmdc:mga07m45_324956_c1 3300050496 Bacteria 894
618 nmdc:mga07m45_83547_c1 3300050496 Bacteria 1825
619 nmdc:mga05p37_1072_c1 3300050507 Bacteria 31317
620 nmdc:mga05p37_18171_c1 3300050507 Bacteria 8496
621 nmdc:mga05p37_4399_c1 3300050507 Bacteria 16466
622 nmdc:mga05p37_467604_c1 3300050507 Bacteria 1456
623 nmdc:mga09592_146073_c1 3300050508 Bacteria 2039
624 nmdc:mga0qj67_170347_c1 3300050509 Bacteria 1768
625 nmdc:mga0qj67_229523_c1 3300050509 Bacteria 1506
626 nmdc:mga0qj67_91553_c1 3300050509 Bacteria 2444
627 nmdc:mga0qj67_98121_c1 3300050509 Bacteria 2360
628 nmdc:mga06r32_20124_c1 3300050510 Bacteria 6139
629 nmdc:mga06r32_458_c1 3300050510 Bacteria 34859
630 nmdc:mga08y16_24138_c1 3300050511 Bacteria 6420
631 nmdc:mga08y16_3771_c1 3300050511 Bacteria 15779
632 nmdc:mga0n895_1118069_c1 3300050512 Bacteria 765
633 nmdc:mga0n895_188745_c1 3300050512 Bacteria 2092
634 nmdc:mga0n895_32503_c1 3300050512 Bacteria 5008
635 nmdc:mga0n895_588117_c1 3300050512 Bacteria 1116
636 nmdc:mga0rr50_174553_c1 3300050513 Bacteria 1753
637 nmdc:mga0rr50_243265_c1 3300050513 Bacteria 1492
638 nmdc:mga0sz30_1382_c2 3300050516 Bacteria 8451
639 nmdc:mga0sz30_164682_c1 3300050516 Bacteria 982
640 nmdc:mga0sz30_56311_c1 3300050516 Bacteria 1674
641 nmdc:mga0sz30_85955_c1 3300050516 Bacteria 1365
642 Ga0495601_0045232 3300053077 Bacteria 2767
643 Ga0495601_0103176 3300053077 Bacteria 1843
644 Ga0495601_0242278 3300053077 Bacteria 1177
645 Ga0495612_0011958 3300053078 Bacteria 3498
646 Ga0495612_0036385 3300053078 Bacteria 1998
647 Ga0495612_0122871 3300053078 Bacteria 1118
648 Ga0495595_0177475 3300053084 Bacteria 1055
649 Ga0495619_0031257 3300053085 Bacteria 3449
650 Ga0495619_0223507 3300053085 Bacteria 1304
651 Ga0500555_000310 3300053103 Bacteria 20978
652 Ga0500559_0014141 3300053136 Bacteria 3374
653 Ga0500568_0028671 3300053139 Bacteria 2319
654 Ga0500636_0009768 3300053177 Bacteria 5589
655 Ga0500636_0245015 3300053177 Bacteria 918
656 Ga0500552_000141 3300053733 Bacteria 6206
657 Ga0501084_0137295 3300054114 Bacteria 2058
658 Ga0501082_0000038 3300060353 Bacteria 94168
659 Ga0501082_0220648 3300060353 Bacteria 1650
660 Ga0501082_0421149 3300060353 Bacteria 1166
661 Ga0530510_0246063 3300061734 Bacteria 1332
662 Ga0530510_0570622 3300061734 Bacteria 860
663 2513655074 2513237096 Bacteria 8722461
664 2513861094 2513237137 Bacteria 9558895
665 2513915903 2513237145 Bacteria 8979722
666 2517894792 2517572143 Bacteria 9484767
667 2545676769 2545555834 Bacteria 8130841
668 2671119208 2667528175 Bacteria 7532676
669 2728747555 2728368998 Bacteria 8720350
670 2793071262 2791355197 Bacteria 8420563
671 2885376944 2885374607 Bacteria 8927485
672 2903753003 2903748898 Bacteria 9972761
673 2904697776 2904690495 Bacteria 9412302
674 2906611513
675 2906642445 2906635258 Bacteria 8601019
676 2906660752 2906660503 Bacteria 8595048
677 2908745097 2908739725 Bacteria 8628932
678 2908757127 2908756301 Bacteria 8864324
679 2922427843
680 2935632222 2935630451 Bacteria 8169952
681 2941508170 2941507105 Bacteria 8166816
682 2941515325 2941515067 Bacteria 8166720
683 2941524100 2941523033 Bacteria 8169134
684 3005477554 3005474847 Bacteria 9259049
685 641642900 641522639 Bacteria 7737025
686 8019559611 8019555841 Bacteria 9642137
687 8019569714 8019565922 Bacteria 9639779
688 8056695208 8056689827 Bacteria 6712655
689 Ga0495590_0035320
690 JGI24738J21930_10013519
691 JGI24742J22300_10002527
692 JGI24751J29686_10012785
693 JGI25406J46586_10083757
694 Ga0065707_10082160
695 Ga0065707_10086978
696 Ga0065707_10243856
697 Ga0070683_100005456
698 Ga0070683_100325727
699 Ga0070690_100050904
700 Ga0070670_100029346
701 Ga0070670_100059809
702 Ga0070670_100341469
703 Ga0070666_10007822
704 Ga0070666_10014598
705 Ga0070666_10135376
706 Ga0068868_100212153
707 Ga0070660_100101243
708 Ga0070689_100019528
709 Ga0070689_100070646
710 Ga0070689_100209815
711 Ga0070687_100001575
712 Ga0070668_100008384
713 Ga0070668_100599329
714 Ga0070668_100904596
715 Ga0070669_100001489
716 Ga0070669_100205900
717 Ga0070675_100291323
718 Ga0070671_100001709
719 Ga0070671_100054688
720 Ga0070671_100722399
721 Ga0070674_100355375
722 Ga0070688_100470697
723 Ga0070667_100019202
724 Ga0070667_100024186
725 Ga0070667_100104363
726 Ga0070703_10021001
727 Ga0070709_10008191
728 Ga0070709_10142422
729 Ga0070714_100027888
730 Ga0070714_100102705
731 Ga0070713_100003459
732 Ga0070713_100069688
733 Ga0070713_100444985
734 Ga0070713_100513604
735 Ga0070710_10015742
736 Ga0070710_10069799
737 Ga0070701_10001746
738 Ga0070711_100042369
739 Ga0070711_100049397
740 Ga0070705_100303501
741 Ga0070700_100191742
742 Ga0070708_100028912
743 Ga0070708_100049539
744 Ga0070663_100040341
745 Ga0070678_100124732
746 Ga0070662_100203744
747 Ga0070662_100635597
748 Ga0070681_10087284
749 Ga0070685_10009109
750 Ga0070706_100110008
751 Ga0070706_100819125
752 Ga0070707_100237479
753 Ga0070699_100000717
754 Ga0070699_100036672
755 Ga0070679_100011913
756 Ga0070684_100094649
757 Ga0070684_100234321
758 Ga0070697_100156271
759 Ga0070697_100250049
760 Ga0070697_100677961
761 Ga0068853_100084749
762 Ga0068853_100576132
763 Ga0070672_100002423
764 Ga0070672_100288078
765 Ga0070686_100015395
766 Ga0070686_100051639
767 Ga0070696_100432946
768 Ga0070665_100000878
769 Ga0070665_100179628
770 Ga0070665_100296757
771 Ga0070665_100486803
772 Ga0070665_100552463
773 Ga0070665_100628769
774 Ga0070704_100099533
775 Ga0068855_100158370
776 Ga0068855_100161916
777 Ga0068855_100165476
778 Ga0068855_100284905
779 Ga0070664_100029016
780 Ga0070664_100180645
781 Ga0068857_100071066
782 Ga0068854_100094741
783 Ga0068856_100024659
784 Ga0068856_100201123
785 Ga0068859_100059542
786 Ga0068864_100017927
787 Ga0068864_100146926
788 Ga0068864_100722170
789 Ga0068866_10249146
790 Ga0068861_100020438
791 Ga0068861_100123913
792 Ga0068861_100493072
793 Ga0068851_10059535
794 Ga0068851_10235888
795 Ga0068870_10013821
796 Ga0068863_100005190
797 Ga0068858_100098872
798 Ga0068858_100190548
799 Ga0068860_100008518
800 Ga0068860_100034327
801 Ga0068860_100396868
802 Ga0068862_100038784
803 Ga0081455_10004816
804 Ga0081455_10016316
805 Ga0081455_10047841
806 Ga0081538_10119520
807 Ga0081540_1006146
808 Ga0081540_1026123
809 Ga0081540_1027834
810 Ga0081540_1044506
811 Ga0081540_1093159
812 Ga0081539_10003518
813 Ga0081539_10036773
814 Ga0070717_10048895
815 Ga0070717_10400721
816 Ga0070717_10690714
817 Ga0075365_10020959
818 Ga0075365_10027361
819 Ga0075365_10110049
820 Ga0075368_10040532
821 Ga0075368_10096447
822 Ga0075363_100317717
823 Ga0075364_10049166
824 Ga0075364_10139548
825 Ga0075364_10318966
826 Ga0070715_10352543
827 Ga0070716_100161921
828 Ga0070716_100234783
829 Ga0070712_100001343
830 Ga0070712_100014615
831 Ga0070712_100165235
832 Ga0070712_100196549
833 Ga0070712_100245625
834 Ga0070712_100259710
835 Ga0070712_100308161
836 Ga0075362_10209003
837 Ga0075369_10065649
838 Ga0075366_10006588
839 Ga0097621_100008043
840 Ga0097621_100384174
841 Ga0075370_10025723
842 Ga0075370_10350461
843 Ga0068871_100317150
844 Ga0075428_100009253
845 Ga0075428_100028270
846 Ga0075428_100028529
847 Ga0075428_100825653
848 Ga0075430_100012173
849 Ga0075430_100062697
850 Ga0075430_100157895
851 Ga0075431_100001953
852 Ga0075431_100026428
853 Ga0075431_100780565
854 Ga0075434_100041554
855 Ga0075434_100126898
856 Ga0075434_100203965
857 Ga0075434_100230744
858 Ga0075429_100189038
859 Ga0075429_100255844
860 Ga0068865_100100265
861 Ga0075436_100053515
862 Ga0075436_100466644
863 Ga0075436_100513875
864 Ga0097620_100059542
865 Ga0099824_1005291
866 Ga0099822_1009136
867 Ga0075435_100411046
868 Ga0099794_10088432
869 Ga0099794_10104583
870 Ga0099795_10030859
871 Ga0099795_10066638
872 Ga0099795_10092521
873 Ga0105251_10001607
874 Ga0105251_10081356
875 Ga0105240_10463334
876 Ga0105240_10601656
877 Ga0105240_10729270
878 Ga0111539_10000738
879 Ga0111539_10011258
880 Ga0111539_10320595
881 Ga0111539_10370171
882 Ga0111539_10644208
883 Ga0105245_10056795
884 Ga0105245_10620426
885 Ga0105247_10154430
886 Ga0105247_10160061
887 Ga0105247_10282670
888 Ga0114129_10000066
889 Ga0114129_10001660
890 Ga0114129_10006951
891 Ga0114129_10079963
892 Ga0105242_10333190
893 Ga0105242_10744350
894 Ga0105248_10003673
895 Ga0105248_10054219
896 Ga0105248_11075705
897 Ga0105238_10016713
898 Ga0105238_10063079
899 Ga0105238_10128894
900 Ga0105238_10278341
901 Ga0105238_11395569
902 Ga0105249_10014702
903 Ga0105249_10242254
904 Ga0099796_10052025
905 Ga0105239_10083591
906 Ga0105239_10417386
907 Ga0105239_10521684
908 Ga0105246_10002911
909 Ga0157370_10019448
910 Ga0157374_10021511
911 Ga0157374_10023190
912 Ga0157374_11152836
913 Ga0157378_10731701
914 Ga0163162_10254662
915 Ga0163162_10340694
916 Ga0163162_10441334
917 Ga0163162_10491180
918 Ga0163162_10735479
919 Ga0157372_10510489
920 Ga0157375_10004170
921 Ga0163163_10054759
922 Ga0163163_10060794
923 Ga0163163_10130068
924 Ga0157380_10914808
925 Ga0157377_10008253
926 Ga0157379_10000337
927 Ga0157379_10201161
928 Ga0157379_10472790
929 Ga0157376_10253271
930 Ga0163161_10176237
931 Ga0213872_10047326
932 Ga0213876_10255639
933 Ga0213875_10000003
934 Ga0213875_10014516
935 Ga0209233_1001106
936 Ga0207697_10065121
937 Ga0207696_1000069
938 Ga0207713_1024593
939 Ga0207692_10012729
940 Ga0207692_10056398
941 Ga0207642_10024956
942 Ga0207642_10259968
943 Ga0207710_10002725
944 Ga0207710_10068985
945 Ga0207688_10002899
946 Ga0207680_10143822
947 Ga0207647_10264749
948 Ga0207685_10044480
949 Ga0207685_10179596
950 Ga0207699_10002630
951 Ga0207699_10061074
952 Ga0207645_10078327
953 Ga0207643_10010894
954 Ga0207684_10060869
955 Ga0207684_10300491
956 Ga0207684_10371854
957 Ga0207707_10209679
958 Ga0207695_10254109
959 Ga0207695_10400739
960 Ga0207693_10003110
961 Ga0207693_10003660
962 Ga0207693_10009510
963 Ga0207693_10010641
964 Ga0207693_10069552
965 Ga0207693_10118075
966 Ga0207693_10179919
967 Ga0207693_10325227
968 Ga0207663_10024028
969 Ga0207663_10039429
970 Ga0207663_10839291
971 Ga0207662_10012930
972 Ga0207662_10133272
973 Ga0207662_10227613
974 Ga0207657_10023776
975 Ga0207652_10236858
976 Ga0207681_10004621
977 Ga0207681_10396750
978 Ga0207694_10080844
979 Ga0207694_10228986
980 Ga0207694_10796247
981 Ga0207650_10566048
982 Ga0207659_10177489
983 Ga0207700_10007283
984 Ga0207700_10014254
985 Ga0207700_10066662
986 Ga0207700_10082668
987 Ga0207700_10361957
988 Ga0207700_10374834
989 Ga0207664_10015284
990 Ga0207664_10261761
991 Ga0207644_10000766
992 Ga0207644_10366151
993 Ga0207706_10006548
994 Ga0207686_10052111
995 Ga0207686_10622156
996 Ga0207670_10117060
997 Ga0207669_10103541
998 Ga0207704_10012670
999 Ga0207704_10275206
1000 Ga0207704_10552667
1001 Ga0207665_10009844
1002 Ga0207665_10090679
1003 Ga0207665_10164180
1004 Ga0207691_10003357
1005 Ga0207691_10357093
1006 Ga0207691_10539881
1007 Ga0207711_10021216
1008 Ga0207711_10028224
1009 Ga0207711_10055922
1010 Ga0207689_10006940
1011 Ga0207661_10075743
1012 Ga0207667_10235367
1013 Ga0207667_10263950
1014 Ga0207651_10049729
1015 Ga0207668_10003508
1016 Ga0207658_10121106
1017 Ga0207677_10108897
1018 Ga0207677_10190094
1019 Ga0207703_10393635
1020 Ga0207703_10496398
1021 Ga0207678_10020239
1022 Ga0207708_10020532
1023 Ga0207702_10680116
1024 Ga0207641_10002368
1025 Ga0207641_10168052
1026 Ga0207648_10009789
1027 Ga0207674_10016631
1028 Ga0207675_100027113
1029 Ga0207675_100035708
1030 Ga0207675_100297291
1031 Ga0207683_10004116
1032 Ga0207683_10377477
1033 Ga0209589_1000169
1034 Ga0209489_100493
1035 Ga0209700_100497
1036 Ga0209179_1016447
1037 Ga0209179_1042443
1038 Ga0209588_1081018
1039 Ga0207428_10009685
1040 Ga0207428_10038770
1041 Ga0207428_10264532
1042 Ga0268266_10001045
1043 Ga0268266_10439028
1044 Ga0268265_10248672
1045 Ga0268264_10027604
1046 Ga0268264_10431014
1047 Ga0268264_11071567
1048 Ga0265337_1033729
1049 Ga0265318_10002991
1050 Ga0265338_10040511
1051 Ga0265332_10004192
1052 Ga0265328_10002177
1053 Ga0265329_10004078
1054 Ga0265340_10018198
1055 Ga0265339_10000560
1056 Ga0265339_10089663
1057 Ga0265331_10007385
1058 Ga0265331_10088808
1059 Ga0265316_10010754
1060 Ga0265316_10450598
1061 Ga0307513_10318621
1062 Ga0265313_10056460
1063 Ga0265313_10113189
1064 Ga0265314_10021351
1065 Ga0265342_10024786
1066 Ga0265342_10221330
1067 Ga0307516_10001689
1068 Ga0307412_10687239
1069 Ga0315911_1000010
1070 Ga0373959_0033404
1071 Ga0373923_0060006
1072 Ga0373923_0080451
1073 Ga0373923_0179373
1074 Ga0373936_0069859
1075 Ga0373936_0226874
1076 Ga0373939_0084490
1077 Ga0373953_0009911
1078 Ga0373953_0076702
1079 Ga0373954_0083020
1080 Ga0373943_0006818
1081 Ga0373943_0260670
1082 Ga0373946_0027806
1083 Ga0373946_0041774
1084 Ga0373946_0046375
1085 Ga0373946_0216268
1086 Ga0373955_0131500
1087 Ga0373961_0036898
1088 Ga0373961_0054874
1089 Ga0373924_0016771
1090 Ga0373931_0003811
1091 Ga0373931_0041850
1092 Ga0373935_0111923
1093 Ga0373927_0001542
1094 Ga0373927_0023442
1095 Ga0373927_0262302
1096 Ga0373933_0000241
1097 Ga0373933_0038660
1098 Ga0373933_0088942
1099 Ga0373947_0055198
1100 Ga0373947_0337935
1101 Ga0373937_0000443
1102 Ga0373937_0004815
1103 Ga0373937_0029738
1104 Ga0373937_0094017
1105 Ga0373925_0135223
1106 Ga0395900_0306356
1107 Ga0395905_0189760
1108 Ga0436364_0010210
1109 Ga0436364_0645586
1110 Ga0436364_0693200
1111 Ga0436364_0858723
1112 Ga0436364_0875435
1113 Ga0395901_0145072
1114 Ga0436365_0464318
1115 Ga0436365_0650883
1116 Ga0436365_1522619
1117 Ga0436365_1878830
1118 Ga0436360_0364414
1119 Ga0436360_0651179
1120 Ga0436361_0210879
1121 Ga0436361_0213695
1122 Ga0436363_1328344
1123 Ga0436363_1586335
1124 Ga0439453_0002403
1125 Ga0451853_0208434
1126 Ga0451853_0775028
1127 Ga0451853_2874200
1128 Ga0439445_0078464
1129 Ga0439435_0071635
1130 Ga0439464_0089113
1131 Ga0439464_0153295
1132 Ga0466969_0133123
1133 Ga0495603_0003868
1134 Ga0495603_0271087
1135 Ga0495629_0092226
1136 Ga0495638_0001008
1137 Ga0495638_0143486
1138 Ga0495653_0012660
1139 Ga0495650_0039296
1140 Ga0495580_0462668
1141 Ga0495639_0030518
1142 Ga0495662_0003605
1143 Ga0495664_0000470
1144 Ga0495583_0000030
1145 Ga0495616_0185918
1146 Ga0495618_0002529
1147 Ga0495618_0045054
1148 Ga0495628_0266660
1149 Ga0495630_0012167
1150 Ga0495630_0131397
1151 Ga0495663_0105543
1152 Ga0495652_0040999
1153 Ga0495665_0170716
1154 Ga0495640_0063900
1155 Ga0495587_0022150
1156 Ga0495598_0001623
1157 Ga0495598_0037712
1158 Ga0495597_0189544
1159 Ga0495645_0024307
1160 Ga0495645_0278167
1161 Ga0495622_0069274
1162 Ga0495667_0029980
1163 Ga0495667_0200899
1164 Ga0495656_0090592
1165 Ga0495634_0004229
1166 Ga0495634_0017525
1167 Ga0495625_0005241
1168 Ga0495635_0000867
1169 Ga0495659_0094622
1170 Ga0495661_0045282
1171 Ga0495588_0277551
1172 Ga0495599_0039406
1173 Ga0495623_0097719
1174 Ga0495646_0083260
1175 Ga0495647_0243790
1176 Ga0495613_0076922
1177 Ga0495670_0007381
1178 Ga0495670_0255100
1179 Ga0495649_0104271
1180 Ga0495600_0339950
1181 Ga0495581_0051698
1182 Ga0495604_0155548
1183 Ga0495604_0256999
1184 Ga0495674_0014795
1185 Ga0495672_0024237
1186 Ga0495672_0070699
1187 Ga0495676_0027638
1188 Ga0495675_0038586
1189 Ga0495684_0042111
1190 Ga0495684_0091366
1191 Ga0495684_0175165
1192 Ga0495686_0000811
1193 Ga0495686_0007753
1194 Ga0495593_0051386
1195 Ga0495593_0085345
1196 Ga0495602_0402147
1197 Ga0496100_0000732
1198 Ga0496100_0292383
1199 Ga0496101_0043904
1200 Ga0496101_0366390
1201 Ga0496102_0012404
1202 Ga0496102_0014870
1203 Ga0496102_0062343
1204 Ga0496102_0235571
1205 Ga0496103_0033054
1206 Ga0496104_0000206
1207 Ga0496104_0005540
1208 Ga0496104_0021277
1209 Ga0496104_0076846
1210 Ga0496105_0016883
1211 Ga0496106_0014703
1212 Ga0496106_0101315
1213 Ga0496107_0006176
1214 Ga0496107_0222909
1215 Ga0496107_0285951
1216 Ga0496108_0000822
1217 Ga0496108_0043926
1218 Ga0496108_0293393
1219 Ga0496108_0795824
1220 Ga0496109_0001115
1221 Ga0496109_0045438
1222 Ga0496109_0875009
1223 Ga0496110_0021839
1224 Ga0496110_0026250
1225 Ga0496110_0032798
1226 Ga0496110_0150019
1227 Ga0496110_0196993
1228 Ga0496110_0438800
1229 Ga0496111_0003041
1230 Ga0496111_0035832
1231 Ga0496111_0138244
1232 Ga0496112_0001495
1233 Ga0496112_0004396
1234 Ga0496112_0018494
1235 Ga0496112_0664350
1236 Ga0496113_0003524
1237 Ga0496113_0041380
1238 Ga0496113_0499072
1239 Ga0496114_0015030
1240 Ga0496114_0020954
1241 Ga0496115_0010899
1242 Ga0496115_0020878
1243 Ga0496115_0061380
1244 Ga0496115_0067660
1245 Ga0496115_0164267
1246 Ga0496115_0175129
1247 Ga0496115_0207488
1248 Ga0496116_0269129
1249 Ga0496118_0027055
1250 Ga0496118_0041510
1251 Ga0496119_0008671
1252 Ga0496119_0140041
1253 Ga0496120_0069541
1254 Ga0496121_0000923
1255 Ga0496121_0008770
1256 Ga0496121_0183637
1257 Ga0496123_0137237
1258 Ga0496123_0222752
1259 Ga0496124_0089663
1260 Ga0496124_0224791
1261 Ga0496125_0055387
1262 Ga0496125_0065358
1263 Ga0496126_0002227
1264 Ga0496126_0069530
1265 Ga0496126_0101280
1266 Ga0496126_0368407
1267 Ga0496126_0450369
1268 Ga0501031_0421220
1269 Ga0501036_0480833
1270 Ga0501046_0164933
1271 Ga0501046_0205092
1272 Ga0501047_0222923
1273 Ga0501072_0017442
1274 Ga0501072_0206770
1275 Ga0501076_0108736
1276 Ga0501077_0074876
1277 Ga0501079_0380106
1278 Ga0501080_0878199
1279 Ga0501081_0054244
1280 Ga0501081_0233668
1281 Ga0501081_0269933
1282 Ga0501081_0502410
1283 Ga0501083_0015836
1284 Ga0501083_0381416
1285 Ga0501045_0014870
1286 nmdc:mga03683_11845_c2
1287 nmdc:mga03683_69359_c1
1288 nmdc:mga03683_8694_c1
1289 nmdc:mga03n38_149464_c1
1290 nmdc:mga0yw44_1495_c1
1291 nmdc:mga0yw44_9814_c1
1292 nmdc:mga0yw44_98448_c1
1293 nmdc:mga0k408_11727_c1
1294 nmdc:mga0k408_371521_c1
1295 nmdc:mga0k408_5327_c1
1296 nmdc:mga06z11_14848_c1
1297 nmdc:mga06z11_214082_c1
1298 nmdc:mga06z11_27431_c1
1299 nmdc:mga06z11_32286_c1
1300 nmdc:mga06z11_89510_c1
1301 nmdc:mga04h51_100923_c1
1302 nmdc:mga04h51_213639_c1
1303 nmdc:mga07m45_180557_c1
1304 nmdc:mga07m45_30738_c1
1305 nmdc:mga07m45_324956_c1
1306 nmdc:mga07m45_83547_c1
1307 nmdc:mga05p37_1072_c1
1308 nmdc:mga05p37_18171_c1
1309 nmdc:mga05p37_4399_c1
1310 nmdc:mga05p37_467604_c1
1311 nmdc:mga09592_146073_c1
1312 nmdc:mga0qj67_170347_c1
1313 nmdc:mga0qj67_229523_c1
1314 nmdc:mga0qj67_91553_c1
1315 nmdc:mga0qj67_98121_c1
1316 nmdc:mga06r32_20124_c1
1317 nmdc:mga06r32_458_c1
1318 nmdc:mga08y16_24138_c1
1319 nmdc:mga08y16_3771_c1
1320 nmdc:mga0n895_1118069_c1
1321 nmdc:mga0n895_188745_c1
1322 nmdc:mga0n895_32503_c1
1323 nmdc:mga0n895_588117_c1
1324 nmdc:mga0rr50_174553_c1
1325 nmdc:mga0rr50_243265_c1
1326 nmdc:mga0sz30_1382_c2
1327 nmdc:mga0sz30_164682_c1
1328 nmdc:mga0sz30_56311_c1
1329 nmdc:mga0sz30_85955_c1
1330 Ga0495601_0045232
1331 Ga0495601_0103176
1332 Ga0495601_0242278
1333 Ga0495612_0011958
1334 Ga0495612_0036385
1335 Ga0495612_0122871
1336 Ga0495595_0177475
1337 Ga0495619_0031257
1338 Ga0495619_0223507
1339 Ga0500555_000310
1340 Ga0500559_0014141
1341 Ga0500568_0028671
1342 Ga0500636_0009768
1343 Ga0500636_0245015
1344 Ga0500552_000141
1345 Ga0501084_0137295
1346 Ga0501082_0000038
1347 Ga0501082_0220648
1348 Ga0501082_0421149
1349 Ga0530510_0246063
1350 Ga0530510_0570622
1351 2513655074
1352 2513861094
1353 2513915903
1354 2517894792
1355 2545676769
1356 2671119208
1357 2728747555
1358 2793071262
1359 2885376944
1360 2903753003
1361 2904697776
1362 2906611513
1363 2906642445
1364 2906660752
1365 2908745097
1366 2908757127
1367 2922427843
1368 2935632222
1369 2941508170
1370 2941515325
1371 2941524100
1372 3005477554
1373 641642900
1374 8019559611
1375 8019569714
1376 8056695208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x0t-assembly1.cif.gz_A crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3 0.7738 25 76
1x0t-assembly1.cif.gz_A crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3 0.3749 25 76
7wic-assembly1.cif.gz_R cryo-em structure of the ss-14-bound human sstr2-gi1 complex 0.3527 32 163
4reu-assembly1.cif.gz_B revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli 0.3311 23 182
4reu-assembly1.cif.gz_A-2 revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli 0.325 10 182
ID Description Score Start End Superfamily
af_Q9DC37_260_445_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3591 25 145 1.20.1250.20
af_A4IDE9_223_375_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3447 24 212 1.25.40.10
af_A0A1D8PM72_154_256_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.3433 32 149 1.20.1280.290
af_B6T9A5_232_433_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3431 24 183 1.20.1250.20
af_P70600_859_1009_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.3352 24 167 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A554X8U7-F1-model_v4 Prokaryotic cytochrome b561 0.9656 2 195 GO:0016020
AF-A0A1S9CXQ3-F1-model_v4 DUF962 domain-containing protein 0.9638 1 195 GO:0016020
AF-A0A5E7ZP03-F1-model_v4 Membrane protein 0.9627 2 190 GO:0016020
AF-A0A221KAC2-F1-model_v4 Membrane protein 0.9572 3 196 GO:0016020
AF-A0A2W4TTE2-F1-model_v4 DUF962 domain-containing protein 0.9569 1 197 GO:0016020

Map