F475349

General Info

Members Datasets Scaffolds Average Seq Length
688 460 1376 164

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0147665|Ga0496121_0147665_297_881
Length 194
Sequence MQCTNNAWPKCQRRVGSVMTKVDTQGGFMSDISFVVNGRRVSGAAEDRTLLVHFLRENLGLTGTHVGCDTSQCGACVVHVDGKAVKSCTMLAVQASGSTIVTIEGLANGADLHPVQAAFKEHHGLQCGFCTPGMIMTATDMINRHPEGLDEATVRAELEGNICRCTGYHNIVKAILAASKTMAKVSKGRAKQAA

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
141 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
142 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
170 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
171 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
172 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
173 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
176 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
177 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
178 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
204 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
224 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
225 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
226 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
227 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
228 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
229 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
230 2512875024
231 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
232 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
233 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
234 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
235 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
236 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
237 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
238 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
239 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
240 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
241 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
242 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
243 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
244 2738543024 Aminobacter sp. AP02 Isolate Unclassified
245 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
246 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
247 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
248 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
249 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
250 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
251 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
252 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
253 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
254 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
255 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
256 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
257 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
258 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
259 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
260 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
261 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
262 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
263 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
264 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
265 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
266 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
267 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
268 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
269 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
270 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
271 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
272 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
273 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
274 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
275 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
276 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
277 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
278 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
279 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
280 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
281 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
282 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
283 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
284 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
285 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
286 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
287 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
288 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
289 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
290 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
291 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
292 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
293 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
294 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
295 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
296 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
297 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
298 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
299 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
300 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
301 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
302 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
303 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
304 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
305 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
306 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
307 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
308 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
309 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
310 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
311 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
312 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
313 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
314 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
315 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
316 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
317 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
318 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
319 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
320 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
321 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
322 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
323 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
324 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
325 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
326 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
327 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
328 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
329 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
330 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
331 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
332 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
333 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
334 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
335 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
336 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
337 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
338 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
339 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
340 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
341 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
342 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
343 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
344 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
345 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
346 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
347 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
348 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
349 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
350 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
351 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
352 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
353 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
354 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
355 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
356 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
357 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
358 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
359 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
360 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
361 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
362 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
363 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
364 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
365 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
366 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
367 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
368 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
369 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
370 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
371 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
372 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
373 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
374 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
375 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
376 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
377 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
378 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
379 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
380 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
381 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
382 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
383 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
384 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
385 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
386 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
387 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
388 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
389 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
390 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
391 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
392 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
393 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
394 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
395 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
396 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
397 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
398 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
399 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
400 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
401 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
402 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
403 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
404 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
405 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
406 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
407 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
408 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
409 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
410 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
411 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
412 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
413 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
414 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
415 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
416 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
417 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
418 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
419 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
420 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
421 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
422 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
423 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
424 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
425 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
426 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
427 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
428 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
429 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
430 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
431 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
432 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
433 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
434 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
435 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
436 3004167301 Mesorhizobium loti 582 Isolate Unclassified
437 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
438 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
439 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
440 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
441 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
442 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
443 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
444 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
445 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
446 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
447 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
448 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
449 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
450 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
451 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
452 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
453 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
454 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
455 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
456 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
457 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
458 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
459 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
460 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.3
Metatranscriptomes 6.1
Isolates 34.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 29.07
Rhizoplane 1.6
Rhizosphere 55.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0147665 3300048924 Bacteria 1735
2 JGI24740J21852_10064788 3300001979 Bacteria 996
3 JGI24739J22299_10014828 3300001989 Bacteria 2834
4 JGI24735J21928_10011175 3300002067 Bacteria 2851
5 JGI25156J39149_1002644 3300002705 Bacteria 6293
6 JGI25157J39369_1001346 3300002741 Bacteria 9699
7 JGI25165J46597_1000062 3300003214 Bacteria 206459
8 Ga0055542_1001266 3300003762 Bacteria 13749
9 Ga0055529_1006508 3300003763 Bacteria 1631
10 Ga0058861_11805547 3300004800 Bacteria 824
11 Ga0058862_12721942 3300004803 Bacteria 1039
12 Ga0065715_10097255 3300005293 Bacteria 3736
13 Ga0070680_101061223 3300005336 Bacteria 700
14 Ga0070689_100731063 3300005340 Bacteria 866
15 Ga0070692_10346483 3300005345 Bacteria 922
16 Ga0070669_100091100 3300005353 Bacteria 2286
17 Ga0070674_100107055 3300005356 Bacteria 2047
18 Ga0070674_100279852 3300005356 Bacteria 1322
19 Ga0070705_100757949 3300005440 Bacteria 768
20 Ga0070700_100080308 3300005441 Bacteria 2104
21 Ga0070694_100009095 3300005444 Bacteria 6092
22 Ga0070694_101139418 3300005444 Bacteria 652
23 Ga0070708_100057280 3300005445 Bacteria 3469
24 Ga0070708_101744918 3300005445 Bacteria 578
25 Ga0070678_101087896 3300005456 Bacteria 738
26 Ga0070681_10014884 3300005458 Bacteria 7734
27 Ga0070706_100106712 3300005467 Bacteria 2605
28 Ga0070706_100457319 3300005467 Bacteria 1188
29 Ga0070698_100002853 3300005471 Bacteria 19022
30 Ga0070698_100025196 3300005471 Bacteria 6197
31 Ga0070698_100110063 3300005471 Bacteria 2720
32 Ga0070698_101316893 3300005471 Bacteria 672
33 Ga0070699_100092658 3300005518 Bacteria 2643
34 Ga0070679_100667647 3300005530 Bacteria 982
35 Ga0070697_100030341 3300005536 Bacteria 4343
36 Ga0070697_100067712 3300005536 Bacteria 2921
37 Ga0070697_100165469 3300005536 Bacteria 1870
38 Ga0070697_101049859 3300005536 Bacteria 725
39 Ga0068853_100065114 3300005539 Bacteria 3162
40 Ga0070696_100156609 3300005546 Bacteria 1676
41 Ga0070696_100366916 3300005546 Bacteria 1119
42 Ga0070693_100008042 3300005547 Bacteria 5177
43 Ga0070665_100041861 3300005548 Bacteria 4605
44 Ga0070665_100043662 3300005548 Bacteria 4503
45 Ga0070665_100064070 3300005548 Bacteria 3686
46 Ga0070665_101171630 3300005548 Bacteria 779
47 Ga0068854_100562741 3300005578 Bacteria 968
48 Ga0068856_100134232 3300005614 Bacteria 2481
49 Ga0068861_100148516 3300005719 Bacteria 1921
50 Ga0068851_10288643 3300005834 Bacteria 940
51 Ga0068858_100344410 3300005842 Bacteria 1427
52 Ga0081538_10009385 3300005981 Bacteria 8174
53 Ga0075365_10089845 3300006038 Bacteria 2091
54 Ga0075365_10135178 3300006038 Bacteria 1708
55 Ga0075365_10334779 3300006038 Bacteria 1066
56 Ga0075365_10405263 3300006038 Bacteria 962
57 Ga0075368_10034700 3300006042 Bacteria 1966
58 Ga0075364_10181464 3300006051 Bacteria 1424
59 Ga0075364_10214201 3300006051 Bacteria 1306
60 Ga0075362_10118906 3300006177 Bacteria 1249
61 Ga0075362_10168749 3300006177 Bacteria 1056
62 Ga0075367_10133011 3300006178 Bacteria 1538
63 Ga0075367_10141805 3300006178 Bacteria 1489
64 Ga0075369_10087008 3300006186 Bacteria 1391
65 Ga0075370_10131075 3300006353 Bacteria 1463
66 Ga0075370_10250995 3300006353 Bacteria 1049
67 Ga0075370_10346932 3300006353 Bacteria 887
68 Ga0075431_100289073 3300006847 Bacteria 1659
69 Ga0075433_10996785 3300006852 Bacteria 730
70 Ga0068865_100037200 3300006881 Bacteria 3285
71 Ga0075436_100125898 3300006914 Bacteria 1795
72 Ga0105240_10415232 3300009093 Bacteria 1513
73 Ga0111539_10000450 3300009094 Bacteria 51598
74 Ga0111539_10927080 3300009094 Bacteria 1013
75 Ga0114129_10034451 3300009147 Bacteria 7152
76 Ga0114129_10110234 3300009147 Bacteria 3799
77 Ga0114129_10374450 3300009147 Bacteria 1881
78 Ga0114129_10401447 3300009147 Bacteria 1806
79 Ga0105243_10101828 3300009148 Bacteria 2385
80 Ga0105243_11420061 3300009148 Bacteria 715
81 Ga0105241_10991092 3300009174 Bacteria 785
82 Ga0105248_12254825 3300009177 Bacteria 620
83 Ga0105237_10024376 3300009545 Bacteria 6190
84 Ga0105238_10180783 3300009551 Bacteria 2086
85 Ga0105239_10257567 3300010375 Bacteria 1960
86 Ga0157342_1047517 3300012507 Bacteria 594
87 Ga0157370_10430015 3300013104 Bacteria 1214
88 Ga0157370_10633704 3300013104 Bacteria 978
89 Ga0157369_10837934 3300013105 Bacteria 944
90 Ga0157369_11090122 3300013105 Bacteria 816
91 Ga0157374_10622684 3300013296 Bacteria 1090
92 Ga0157380_10004196 3300014326 Bacteria 9965
93 Ga0157380_10133039 3300014326 Bacteria 2125
94 Ga0157380_11278582 3300014326 Bacteria 780
95 Ga0182008_10268174 3300014497 Bacteria 885
96 Ga0182007_10023438 3300015262 Bacteria 2170
97 Ga0163161_10292737 3300017792 Bacteria 1280
98 Ga0197907_10124309 3300020069 Bacteria 2453
99 Ga0197907_11226427 3300020069 Bacteria 2028
100 Ga0197907_11342124 3300020069 Bacteria 935
101 Ga0206356_11056185 3300020070 Bacteria 798
102 Ga0206356_11207831 3300020070 Bacteria 3015
103 Ga0206349_1098660 3300020075 Bacteria 1470
104 Ga0206349_1760105 3300020075 Bacteria 1497
105 Ga0206351_10637505 3300020077 Bacteria 1497
106 Ga0206352_10701579 3300020078 Bacteria 700
107 Ga0206352_10884132 3300020078 Bacteria 1089
108 Ga0206352_11228637 3300020078 Bacteria 2002
109 Ga0206350_10105058 3300020080 Bacteria 1974
110 Ga0206350_10743522 3300020080 Bacteria 530
111 Ga0206350_11542253 3300020080 Bacteria 4179
112 Ga0206354_10066698 3300020081 Bacteria 3371
113 Ga0206354_10193729 3300020081 Bacteria 1032
114 Ga0206353_10922145 3300020082 Bacteria 1675
115 Ga0154015_1280372 3300020610 Bacteria 852
116 Ga0213872_10061838 3300021361 Bacteria 1693
117 Ga0224712_10002715 3300022467 Bacteria 4442
118 Ga0224712_10002727 3300022467 Bacteria 4434
119 Ga0224712_10016180 3300022467 Bacteria 2444
120 Ga0224712_10105504 3300022467 Bacteria 1201
121 Ga0224712_10249105 3300022467 Bacteria 820
122 Ga0209026_1000024 3300025250 Bacteria 355839
123 Ga0209677_111985 3300025253 Bacteria 1314
124 Ga0209148_1000050 3300025254 Bacteria 413178
125 Ga0209759_1000289 3300025256 Bacteria 69478
126 Ga0209233_1000129 3300025261 Bacteria 206511
127 Ga0209233_1013228 3300025261 Bacteria 2360
128 Ga0209455_1000183 3300025272 Bacteria 99952
129 Ga0207647_10037520 3300025904 Bacteria 3071
130 Ga0207684_10041034 3300025910 Bacteria 3925
131 Ga0207684_10043414 3300025910 Bacteria 3812
132 Ga0207684_11040852 3300025910 Bacteria 683
133 Ga0207707_10010340 3300025912 Bacteria 8096
134 Ga0207695_10689271 3300025913 Bacteria 902
135 Ga0207671_10133686 3300025914 Bacteria 1906
136 Ga0207660_11272905 3300025917 Bacteria 598
137 Ga0207657_10034393 3300025919 Bacteria 4557
138 Ga0207652_10713211 3300025921 Bacteria 894
139 Ga0207646_10141344 3300025922 Bacteria 2168
140 Ga0207646_10233771 3300025922 Bacteria 1661
141 Ga0207694_10031517 3300025924 Bacteria 4050
142 Ga0207694_10445716 3300025924 Bacteria 1080
143 Ga0207687_10807714 3300025927 Bacteria 800
144 Ga0207709_11114380 3300025935 Bacteria 648
145 Ga0207709_11145784 3300025935 Bacteria 640
146 Ga0207669_10451457 3300025937 Bacteria 1019
147 Ga0207669_11197734 3300025937 Bacteria 643
148 Ga0207639_10008683 3300026041 Bacteria 6974
149 Ga0207639_10242935 3300026041 Bacteria 1566
150 Ga0207639_11706185 3300026041 Bacteria 590
151 Ga0207678_10185917 3300026067 Bacteria 1775
152 Ga0207702_10154388 3300026078 Bacteria 2091
153 Ga0207648_11230546 3300026089 Bacteria 703
154 Ga0207674_10369080 3300026116 Bacteria 1387
155 Ga0207675_100105630 3300026118 Bacteria 2655
156 Ga0207683_11068247 3300026121 Bacteria 749
157 Ga0268266_10030881 3300028379 Bacteria 4550
158 Ga0268266_10039504 3300028379 Bacteria 4020
159 Ga0268266_10436949 3300028379 Bacteria 1242
160 Ga0307513_10337380 3300031456 Bacteria 1259
161 Ga0307410_10840834 3300031852 Bacteria 783
162 Ga0307412_10468316 3300031911 Bacteria 1042
163 Ga0373941_0016682 3300035115 Bacteria 2001
164 Ga0373931_0422086 3300035691 Bacteria 848
165 Ga0395899_0119213 3300037312 Bacteria 1892
166 Ga0395899_0273712 3300037312 Bacteria 1151
167 Ga0395900_0052146 3300037418 Bacteria 4211
168 Ga0395900_0111364 3300037418 Bacteria 2812
169 Ga0395900_0156874 3300037418 Bacteria 2324
170 Ga0395900_0778026 3300037418 Bacteria 886
171 Ga0395898_0022662 3300037466 Bacteria 6358
172 Ga0395898_0061507 3300037466 Bacteria 3648
173 Ga0395898_0063070 3300037466 Bacteria 3597
174 Ga0395905_0044789 3300037471 Bacteria 4151
175 Ga0395905_0234522 3300037471 Bacteria 1715
176 Ga0395905_0648471 3300037471 Bacteria 958
177 Ga0395901_0013973 3300038443 Bacteria 8171
178 Ga0395901_0117423 3300038443 Bacteria 2795
179 Ga0395901_0161809 3300038443 Bacteria 2351
180 Ga0395901_0166901 3300038443 Bacteria 2311
181 Ga0395901_0265872 3300038443 Bacteria 1785
182 Ga0395901_0593893 3300038443 Bacteria 1117
183 Ga0451791_1360050 3300041451 Bacteria 966
184 Ga0439431_0019847 3300041997 Bacteria 1601
185 Ga0439448_0187248 3300042005 Bacteria 724
186 Ga0451576_0058529 3300045051 Bacteria 4027
187 Ga0495627_038669 3300046453 Bacteria 1474
188 Ga0495638_0017935 3300046460 Bacteria 4710
189 Ga0495620_0189897 3300046515 Bacteria 792
190 Ga0495648_0317963 3300046524 Bacteria 723
191 Ga0495597_0079787 3300046542 Bacteria 1401
192 Ga0495668_0039427 3300046616 Bacteria 2637
193 Ga0495660_0098746 3300046810 Bacteria 1506
194 Ga0495687_160665 3300047443 Bacteria 756
195 Ga0495686_0319616 3300047472 Bacteria 851
196 Ga0496102_1057906 3300048905 Bacteria 731
197 Ga0496104_0331212 3300048907 Bacteria 1436
198 Ga0496109_0380300 3300048912 Bacteria 1334
199 Ga0496110_0634193 3300048913 Bacteria 968
200 Ga0496112_0039529 3300048915 Bacteria 4611
201 Ga0496113_0166196 3300048916 Bacteria 1746
202 Ga0496113_0371575 3300048916 Bacteria 1148
203 Ga0496115_0503092 3300048918 Bacteria 973
204 Ga0496119_0030542 3300048922 Bacteria 3630
205 Ga0496119_0113749 3300048922 Bacteria 1498
206 Ga0496119_0256233 3300048922 Bacteria 880
207 Ga0496120_0004963 3300048923 Bacteria 10809
208 Ga0496121_0571813 3300048924 Bacteria 703
209 Ga0496124_0098047 3300048927 Bacteria 2379
210 Ga0496124_0123256 3300048927 Bacteria 2068
211 Ga0496125_0200317 3300048928 Bacteria 1308
212 Ga0496126_0362821 3300048929 Bacteria 1183
213 Ga0501293_002557 3300049516 Bacteria 1383
214 Ga0501295_033034 3300049518 Bacteria 1033
215 Ga0501300_010870 3300049523 Bacteria 1327
216 Ga0501031_0001036 3300049568 Bacteria 16868
217 Ga0501031_0017658 3300049568 Bacteria 4639
218 Ga0501031_0328609 3300049568 Bacteria 990
219 Ga0501032_0005372 3300049569 Bacteria 9533
220 Ga0501032_0052466 3300049569 Bacteria 2747
221 Ga0501033_0003811 3300049570 Bacteria 12267
222 Ga0501033_0005756 3300049570 Bacteria 9758
223 Ga0501033_0034364 3300049570 Bacteria 3804
224 Ga0501033_0076490 3300049570 Bacteria 2457
225 Ga0501033_0109313 3300049570 Bacteria 2013
226 Ga0501033_0395412 3300049570 Bacteria 964
227 Ga0501034_0011047 3300049571 Bacteria 9377
228 Ga0501034_0057496 3300049571 Bacteria 3910
229 Ga0501034_0146233 3300049571 Bacteria 2341
230 Ga0501034_0218981 3300049571 Bacteria 1856
231 Ga0501036_0071225 3300049572 Bacteria 2940
232 Ga0501036_0175309 3300049572 Bacteria 1805
233 Ga0501036_0187039 3300049572 Bacteria 1743
234 Ga0501036_1136338 3300049572 Bacteria 637
235 Ga0501037_0000576 3300049573 Bacteria 28887
236 Ga0501037_0091076 3300049573 Bacteria 2205
237 Ga0501037_0110082 3300049573 Bacteria 1984
238 Ga0501037_0718008 3300049573 Bacteria 664
239 Ga0501038_0049367 3300049574 Bacteria 3638
240 Ga0501038_0074520 3300049574 Bacteria 2871
241 Ga0501038_0076656 3300049574 Bacteria 2824
242 Ga0501038_0151833 3300049574 Bacteria 1888
243 Ga0501038_0253227 3300049574 Bacteria 1394
244 Ga0501038_0318708 3300049574 Bacteria 1217
245 Ga0501038_0384127 3300049574 Bacteria 1089
246 Ga0501039_0008358 3300049575 Bacteria 7888
247 Ga0501039_0010688 3300049575 Bacteria 6992
248 Ga0501039_0324021 3300049575 Bacteria 1211
249 Ga0501039_0336769 3300049575 Bacteria 1186
250 Ga0501040_0022938 3300049576 Bacteria 4181
251 Ga0501040_0025361 3300049576 Bacteria 3985
252 Ga0501040_0127097 3300049576 Bacteria 1791
253 Ga0501040_0127552 3300049576 Bacteria 1788
254 Ga0501041_0001880 3300049577 Bacteria 11769
255 Ga0501041_0040036 3300049577 Bacteria 2844
256 Ga0501041_0092702 3300049577 Bacteria 1865
257 Ga0501042_0001688 3300049578 Bacteria 13159
258 Ga0501042_0005416 3300049578 Bacteria 8218
259 Ga0501042_0048982 3300049578 Bacteria 3013
260 Ga0501042_0063056 3300049578 Bacteria 2649
261 Ga0501042_0302891 3300049578 Bacteria 1155
262 Ga0501042_0344826 3300049578 Bacteria 1077
263 Ga0501043_0000003 3300049579 Bacteria 318844
264 Ga0501043_0032313 3300049579 Bacteria 4114
265 Ga0501043_0045424 3300049579 Bacteria 3455
266 Ga0501043_0092021 3300049579 Bacteria 2384
267 Ga0501043_0132140 3300049579 Bacteria 1956
268 Ga0501043_0302736 3300049579 Bacteria 1221
269 Ga0501043_0723681 3300049579 Bacteria 725
270 Ga0501043_0798204 3300049579 Bacteria 683
271 Ga0501046_0007394 3300049580 Bacteria 9653
272 Ga0501046_0046307 3300049580 Bacteria 3452
273 Ga0501047_0033716 3300049581 Bacteria 4941
274 Ga0501047_0143080 3300049581 Bacteria 2269
275 Ga0501048_0009800 3300049582 Bacteria 7182
276 Ga0501048_0024115 3300049582 Bacteria 4442
277 Ga0501048_0039499 3300049582 Bacteria 3385
278 Ga0501048_0516922 3300049582 Bacteria 856
279 Ga0501048_0641649 3300049582 Bacteria 762
280 Ga0501048_1047308 3300049582 Bacteria 587
281 Ga0501067_0077897 3300049583 Bacteria 1837
282 Ga0501067_0199752 3300049583 Bacteria 1114
283 Ga0501068_0024760 3300049584 Bacteria 3526
284 Ga0501068_0039081 3300049584 Bacteria 2844
285 Ga0501068_0067377 3300049584 Bacteria 2181
286 Ga0501068_0292617 3300049584 Bacteria 1042
287 Ga0501069_0000002 3300049585 Bacteria 269636
288 Ga0501069_0042915 3300049585 Bacteria 2503
289 Ga0501070_0001802 3300049586 Bacteria 18887
290 Ga0501070_0007664 3300049586 Bacteria 9162
291 Ga0501070_0007959 3300049586 Bacteria 8979
292 Ga0501070_0016488 3300049586 Bacteria 6207
293 Ga0501070_0029326 3300049586 Bacteria 4615
294 Ga0501070_0326293 3300049586 Bacteria 1248
295 Ga0501070_0368124 3300049586 Bacteria 1165
296 Ga0501070_0829014 3300049586 Bacteria 725
297 Ga0501071_0022311 3300049587 Bacteria 4413
298 Ga0501071_0025187 3300049587 Bacteria 4166
299 Ga0501071_0030465 3300049587 Bacteria 3816
300 Ga0501071_0039344 3300049587 Bacteria 3383
301 Ga0501071_0052714 3300049587 Bacteria 2934
302 Ga0501071_0248063 3300049587 Bacteria 1343
303 Ga0501071_0336757 3300049587 Bacteria 1147
304 Ga0501071_1275181 3300049587 Bacteria 568
305 Ga0501072_0000982 3300049588 Bacteria 21055
306 Ga0501072_0012750 3300049588 Bacteria 6426
307 Ga0501072_0018194 3300049588 Bacteria 5406
308 Ga0501072_0034015 3300049588 Bacteria 3993
309 Ga0501072_0086673 3300049588 Bacteria 2485
310 Ga0501072_0208273 3300049588 Bacteria 1558
311 Ga0501072_0418584 3300049588 Bacteria 1062
312 Ga0501073_0027300 3300049589 Bacteria 4084
313 Ga0501073_0033052 3300049589 Bacteria 3686
314 Ga0501073_0040923 3300049589 Bacteria 3276
315 Ga0501073_0365271 3300049589 Bacteria 997
316 Ga0501073_0675776 3300049589 Bacteria 712
317 Ga0501074_0000032 3300049590 Bacteria 65565
318 Ga0501074_0000851 3300049590 Bacteria 19401
319 Ga0501074_0012237 3300049590 Bacteria 6238
320 Ga0501074_0043232 3300049590 Bacteria 3261
321 Ga0501074_0522108 3300049590 Bacteria 841
322 Ga0501074_0816867 3300049590 Bacteria 657
323 Ga0501074_0869907 3300049590 Bacteria 634
324 Ga0501075_0000787 3300049591 Bacteria 19821
325 Ga0501075_0010423 3300049591 Bacteria 6532
326 Ga0501075_0129671 3300049591 Bacteria 1921
327 Ga0501075_0131873 3300049591 Bacteria 1904
328 Ga0501076_0006027 3300049592 Bacteria 8765
329 Ga0501076_0010286 3300049592 Bacteria 6935
330 Ga0501076_0060385 3300049592 Bacteria 3016
331 Ga0501076_0223962 3300049592 Bacteria 1537
332 Ga0501076_0406631 3300049592 Bacteria 1119
333 Ga0501077_0003632 3300049593 Bacteria 9281
334 Ga0501077_0006047 3300049593 Bacteria 7389
335 Ga0501206_012416 3300049653 Bacteria 1156
336 Ga0501216_014581 3300049660 Bacteria 1315
337 Ga0501223_005682 3300049663 Bacteria 2609
338 Ga0501227_038883 3300049665 Bacteria 1169
339 Ga0501233_027770 3300049668 Bacteria 1259
340 Ga0501235_019232 3300049669 Bacteria 1515
341 Ga0501236_003070 3300049670 Bacteria 1938
342 Ga0501240_004463 3300049673 Bacteria 1625
343 Ga0501259_043095 3300049688 Bacteria 893
344 Ga0501221_020518 3300049704 Bacteria 1292
345 Ga0501225_0017522 3300049705 Bacteria 1988
346 Ga0501234_012783 3300049707 Bacteria 1316
347 Ga0501079_0003219 3300049741 Bacteria 11955
348 Ga0501079_0007239 3300049741 Bacteria 8374
349 Ga0501079_0047191 3300049741 Bacteria 3323
350 Ga0501079_0083119 3300049741 Bacteria 2477
351 Ga0501079_0321329 3300049741 Bacteria 1212
352 Ga0501079_0357250 3300049741 Bacteria 1145
353 Ga0501079_1323552 3300049741 Bacteria 567
354 Ga0501080_0037624 3300049742 Bacteria 4519
355 Ga0501080_0041559 3300049742 Bacteria 4283
356 Ga0501080_0052011 3300049742 Bacteria 3812
357 Ga0501080_0056672 3300049742 Bacteria 3648
358 Ga0501080_0364786 3300049742 Bacteria 1303
359 Ga0501080_0828143 3300049742 Bacteria 810
360 Ga0501081_0001400 3300049743 Bacteria 14719
361 Ga0501081_0008846 3300049743 Bacteria 6545
362 Ga0501083_0000819 3300049744 Bacteria 20356
363 Ga0501083_0057426 3300049744 Bacteria 2605
364 Ga0501083_0218961 3300049744 Bacteria 1240
365 Ga0501270_082628 3300049767 Bacteria 642
366 Ga0501035_0000200 3300049822 Bacteria 73015
367 Ga0501035_0002238 3300049822 Bacteria 19169
368 Ga0501035_0006427 3300049822 Bacteria 11042
369 Ga0501035_0009362 3300049822 Bacteria 9104
370 Ga0501035_0015417 3300049822 Bacteria 7050
371 Ga0501035_0075807 3300049822 Bacteria 2975
372 Ga0501035_0106172 3300049822 Bacteria 2462
373 Ga0501035_0240194 3300049822 Bacteria 1541
374 Ga0501035_0384171 3300049822 Bacteria 1170
375 Ga0501035_0503052 3300049822 Bacteria 997
376 Ga0501044_0000161 3300049823 Bacteria 83309
377 Ga0501044_0007571 3300049823 Bacteria 11936
378 Ga0501044_0027442 3300049823 Bacteria 6018
379 Ga0501044_0029646 3300049823 Bacteria 5768
380 Ga0501044_0037813 3300049823 Bacteria 5043
381 Ga0501044_0042305 3300049823 Bacteria 4739
382 Ga0501044_0100148 3300049823 Bacteria 2916
383 Ga0501045_0008239 3300049824 Bacteria 7258
384 Ga0501045_0011570 3300049824 Bacteria 6196
385 Ga0501045_0014178 3300049824 Bacteria 5645
386 Ga0501045_0237306 3300049824 Bacteria 1357
387 Ga0501045_0642552 3300049824 Bacteria 784
388 Ga0501045_1279980 3300049824 Bacteria 534
389 Ga0501212_042753 3300049851 Bacteria 752
390 nmdc:mga03683_53397_c1 3300050489 Bacteria 1691
391 nmdc:mga03n38_106034_c1 3300050490 Bacteria 1362
392 nmdc:mga03n38_88743_c1 3300050490 Bacteria 1468
393 nmdc:mga00v17_373548_c1 3300050491 Bacteria 927
394 nmdc:mga0yw44_10873_c1 3300050492 Bacteria 4667
395 nmdc:mga0yw44_155916_c1 3300050492 Bacteria 1492
396 nmdc:mga0yw44_327230_c1 3300050492 Bacteria 1030
397 nmdc:mga0yw44_42700_c1 3300050492 Bacteria 2705
398 nmdc:mga0yw44_769041_c1 3300050492 Bacteria 654
399 nmdc:mga06z11_135672_c2 3300050494 Bacteria 818
400 nmdc:mga06z11_456663_c1 3300050494 Bacteria 772
401 nmdc:mga06z11_49634_c1 3300050494 Bacteria 2142
402 nmdc:mga07m45_292746_c1 3300050496 Bacteria 947
403 nmdc:mga07m45_54445_c1 3300050496 Bacteria 2261
404 nmdc:mga05p37_243316_c1 3300050507 Bacteria 2162
405 nmdc:mga05p37_420823_c1 3300050507 Bacteria 1555
406 nmdc:mga08y16_49163_c1 3300050511 Bacteria 4413
407 nmdc:mga0n895_1577480_c1 3300050512 Bacteria 621
408 nmdc:mga08x19_288322_c1 3300050514 Bacteria 1138
409 nmdc:mga0sz30_17013_c1 3300050516 Bacteria 2524
410 nmdc:mga0sz30_51674_c1 3300050516 Bacteria 1011
411 Ga0500610_0129367 3300053079 Bacteria 1285
412 Ga0500568_0000059 3300053139 Bacteria 108096
413 Ga0500568_0106067 3300053139 Bacteria 1053
414 Ga0500627_0220375 3300053158 Bacteria 846
415 Ga0500611_081864 3300053727 Bacteria 807
416 Ga0501084_0004442 3300054114 Bacteria 11449
417 Ga0501084_0009361 3300054114 Bacteria 8104
418 Ga0501084_0161447 3300054114 Bacteria 1891
419 Ga0501084_0446945 3300054114 Bacteria 1093
420 Ga0501084_0511300 3300054114 Bacteria 1015
421 Ga0501084_0596593 3300054114 Bacteria 933
422 Ga0501084_0621273 3300054114 Bacteria 913
423 Ga0587082_077044 3300059504 Bacteria 688
424 Ga0587083_0024615 3300059505 Bacteria 1147
425 Ga0587085_056080 3300059506 Bacteria 732
426 Ga0587088_129452 3300059508 Bacteria 592
427 Ga0587091_040408 3300059511 Bacteria 917
428 Ga0587092_071860 3300059512 Bacteria 668
429 Ga0587101_023349 3300059623 Bacteria 910
430 Ga0587115_011953 3300059626 Bacteria 1102
431 Ga0587069_025293 3300059642 Bacteria 922
432 Ga0587075_027692 3300059644 Bacteria 884
433 Ga0587076_033711 3300059645 Bacteria 922
434 Ga0587079_016804 3300059647 Bacteria 1261
435 Ga0587107_010486 3300059652 Bacteria 1116
436 Ga0587107_043386 3300059652 Bacteria 736
437 Ga0587110_010586 3300059654 Bacteria 924
438 Ga0587111_0081452 3300060346 Bacteria 774
439 Ga0587111_0136797 3300060346 Bacteria 646
440 Ga0501082_0013544 3300060353 Bacteria 7006
441 Ga0501082_0087731 3300060353 Bacteria 2684
442 Ga0501082_0123657 3300060353 Bacteria 2243
443 Ga0501082_0367326 3300060353 Bacteria 1255
444 Ga0501082_0662309 3300060353 Bacteria 914
445 Ga0501082_1243415 3300060353 Bacteria 651
446 Ga0530510_0001837 3300061734 Bacteria 14507
447 Ga0530510_0023810 3300061734 Bacteria 4365
448 Ga0530510_0042078 3300061734 Bacteria 3299
449 Ga0530510_0119881 3300061734 Bacteria 1930
450 Ga0530510_0175057 3300061734 Bacteria 1590
451 2503201982 2503198000 Bacteria 6884444
452 2509115968 2508501123 Bacteria 6283661
453 2509141684 2508501127 Bacteria 7037543
454 2509371161 2509276018 Bacteria 6910194
455 2509396652 2509276022 Bacteria 6200534
456 2510313746 2510065059 Bacteria 6847884
457 2512931126 2512875016 Bacteria 6529530
458 2512958937 2512875024 Bacteria 7195110
459 2513610909 2513237090 Bacteria 7096802
460 2514038219 2513237164 Bacteria 7563725
461 2514420228 2513237305 Bacteria 7293571
462 2588516900 2588253730 Bacteria 6881675
463 2597814356 2597489875 Bacteria 7010078
464 2599938381 2599185301 Bacteria 6161860
465 2643775270 2643221551 Bacteria 3750538
466 2643793716 2643221555 Bacteria 3749717
467 2643985809 2643221595 Bacteria 6565519
468 2644129058 2643221623 Bacteria 5239945
469 2644158423 2643221627 Bacteria 6761570
470 2688598804 2687453392 Bacteria 6880454
471 2723575744 2721755686 Bacteria 7343952
472 2739308169 2738543024 Bacteria 5603683
473 2756675663 2756170246 Bacteria 7451806
474 2770196696 2767802442 Bacteria 5747986
475 2776272728 2775506902 Bacteria 6208009
476 2776284671 2775506904 Bacteria 5954060
477 2792749618 2791355123 Bacteria 8049106
478 2837680566 2837678835 Bacteria 5252418
479 2840769519 2840764183 Bacteria 6358399
480 2841739651 2841734538 Bacteria 6784580
481 2844006167 2844002411 Bacteria 7168230
482 2844014145 2844009547 Bacteria 6728125
483 2856325616 2856320880 Bacteria 7263508
484 2856331464 2856328259 Bacteria 6528202
485 2856339054 2856334872 Bacteria 7037011
486 2856347941 2856342000 Bacteria 7176905
487 2856352891 2856349417 Bacteria 6230045
488 2856358725 2856356410 Bacteria 6297484
489 2857350725 2857349434 Bacteria 7926032
490 2857370750 2857367948 Bacteria 6965560
491 2869167610 2869162929 Bacteria 6399702
492 2869173229 2869169390 Bacteria 6659796
493 2869234966 2869234852 Bacteria 6654993
494 2869249504 2869242130 Bacteria 6609239
495 2869250865 2869249662 Bacteria 6868783
496 2869262117 2869256925 Bacteria 6981691
497 2869270449 2869264136 Bacteria 6880765
498 2869272124 2869271264 Bacteria 6908218
499 2869279240 2869278585 Bacteria 7077053
500 2871443462 2871435913 Bacteria 6880295
501 2871459114 2871451962 Bacteria 7336357
502 2871466480 2871459585 Bacteria 6866887
503 2871468152 2871466892 Bacteria 6923287
504 2871480938 2871474448 Bacteria 6806570
505 2871485792 2871481445 Bacteria 6700002
506 2871491344 2871488783 Bacteria 6929816
507 2871502894 2871495908 Bacteria 6935695
508 2874114400 2874109183 Bacteria 6517025
509 2874119313 2874116593 Bacteria 6674494
510 2874123693 2874123672 Bacteria 7238285
511 2874134715 2874131515 Bacteria 6820270
512 2874144986 2874139085 Bacteria 7021506
513 2874166222 2874162495 Bacteria 6174670
514 2874174430 2874168670 Bacteria 8062617
515 2876365617 2876363079 Bacteria 6544991
516 2876370572 2876369609 Bacteria 6807521
517 2876387131 2876386047 Bacteria 6698674
518 2876406011 2876399893 Bacteria 6927900
519 2876407568 2876406927 Bacteria 6191900
520 2878731969 2878730984 Bacteria 6380721
521 2878745623 2878738818 Bacteria 7136951
522 2878757779 2878753008 Bacteria 6922523
523 2878766786 2878760144 Bacteria 6823465
524 2878773983 2878767105 Bacteria 6898628
525 2878777173 2878774303 Bacteria 6108671
526 2878782462 2878781027 Bacteria 6834456
527 2878791685 2878788777 Bacteria 6567085
528 2881151881 2881147464 Bacteria 7779814
529 2881155666 2881155292 Bacteria 6461656
530 2881167885 2881161766 Bacteria 7127907
531 2881849790 2881845957 Bacteria 6611900
532 2881854077 2881853255 Bacteria 6698367
533 2881864473 2881861095 Bacteria 7128710
534 2882635637 2882632389 Bacteria 8154593
535 2882915248 2882912400 Bacteria 6801539
536 2885309784 2885305155 Bacteria 7348390
537 2885317611 2885312484 Bacteria 6415165
538 2885321526 2885318864 Bacteria 6729568
539 2885328973 2885326080 Bacteria 7134805
540 2885338307 2885334103 Bacteria 7216818
541 2885345245 2885342637 Bacteria 7011821
542 2885351728 2885350715 Bacteria 6787678
543 2888339793 2888337043 Bacteria 6629336
544 2888347191 2888343758 Bacteria 6611049
545 2888356120 2888350351 Bacteria 7372807
546 2889017257 2889016732 Bacteria 6700763
547 2903455404 2903448605 Bacteria 7357801
548 2903506454 2903492973 Bacteria 13473544
549 2903520231 2903513507 Bacteria 6344008
550 2903523546 2903521522 Bacteria 6525694
551 2903534180 2903528002 Bacteria 6586099
552 2903548033 2903540706 Bacteria 7062119
553 2904579245 2904578770 Bacteria 5302906
554 2904661218 2904659560 Bacteria 6685615
555 2906367724 2906363423 Bacteria 6856682
556 2906371495 2906370794 Bacteria 6881062
557 2906382784 2906378014 Bacteria 6911440
558 2906390995 2906386501 Bacteria 5977019
559 2906396760 2906393657 Bacteria 6790866
560 2906405296 2906401398 Bacteria 6693206
561 2906412097 2906408224 Bacteria 6162342
562 2906434612 2906427513 Bacteria 6375796
563 2919121929 2919119836 Bacteria 5208557
564 2922137072 2922130491 Bacteria 7173936
565 2922155636 2922151315 Bacteria 6902399
566 2922177475 2922172374 Bacteria 6167644
567 2924713689 2924710171 Bacteria 6752351
568 2924721308 2924718760 Bacteria 6331356
569 2924739350 2924733363 Bacteria 7574837
570 2924743765 2924741084 Bacteria 6661321
571 2924748518 2924748358 Bacteria 6154725
572 2924762420 2924754689 Bacteria 6774424
573 2924766790 2924762789 Bacteria 6561353
574 2924783867 2924776078 Bacteria 7492003
575 2924785724 2924784321 Bacteria 7416538
576 2937824856 2937822353 Bacteria 7290551
577 2937838032 2937836603 Bacteria 6811263
578 2937844815 2937843397 Bacteria 5256375
579 2937855108 2937848649 Bacteria 6983481
580 2937862178 2937861824 Bacteria 6660327
581 2937873862 2937868953 Bacteria 6639878
582 2937877399 2937877337 Bacteria 7246526
583 2937975496 2937972304 Bacteria 7532020
584 2937984119 2937980651 Bacteria 6517427
585 2938001909 2937994558 Bacteria 7036190
586 2958035381 2958034702 Bacteria 6989922
587 2958043568 2958041894 Bacteria 13082850
588 2958067780 2958064165 Bacteria 7158582
589 2958072707 2958071322 Bacteria 6815895
590 2958084505 2958084443 Bacteria 7312792
591 2958096437 2958092219 Bacteria 6861151
592 2958104995 2958100919 Bacteria 6800575
593 2958110990 2958108152 Bacteria 6681128
594 2958125717 2958122699 Bacteria 7280457
595 2958143636 2958137437 Bacteria 6050276
596 2958147227 2958144490 Bacteria 6677056
597 2958163023 2958158011 Bacteria 6058449
598 2958171964 2958165035 Bacteria 6906348
599 2958175285 2958172287 Bacteria 6716688
600 2961116369 2961114664 Bacteria 6680456
601 2961132254 2961127735 Bacteria 7196641
602 2961144644 2961136820 Bacteria 6775228
603 2961170410 2961163497 Bacteria 6901077
604 2961174322 2961170736 Bacteria 7072258
605 2961189944 2961183825 Bacteria 6688536
606 2963648092 2963644680 Bacteria 6530403
607 2965025156 2965018300 Bacteria 6883036
608 2965026523 2965025482 Bacteria 6532201
609 2965035275 2965032056 Bacteria 6887443
610 2965040420 2965040258 Bacteria 6855979
611 2965055187 2965047637 Bacteria 6623551
612 2965094719 2965089291 Bacteria 6866420
613 2965107097 2965102966 Bacteria 6800987
614 2965114530 2965110997 Bacteria 6693150
615 2965122087 2965119406 Bacteria 6956431
616 2968000269 2967996073 Bacteria 6787468
617 2968005459 2968003550 Bacteria 6929263
618 2968018073 2968016561 Bacteria 7022047
619 2968090914 2968083720 Bacteria 7351627
620 2968112275 2968110612 Bacteria 6814636
621 2968121039 2968117919 Bacteria 6536078
622 2968139506 2968138860 Bacteria 6605449
623 2968178797 2968171901 Bacteria 6894245
624 2970471752 2970469710 Bacteria 6969209
625 2970495707 2970489779 Bacteria 6517260
626 2970506909 2970503327 Bacteria 7099517
627 2970512828 2970510686 Bacteria 7006402
628 2970530691 2970524798 Bacteria 6840927
629 2970533683 2970532167 Bacteria 6553173
630 2970554702 2970547951 Bacteria 6931819
631 2970561642 2970554993 Bacteria 6814252
632 2970593836 2970593180 Bacteria 7073582
633 2970619732 2970619444 Bacteria 6986144
634 2970633054 2970627176 Bacteria 6680862
635 2977822311 2977821940 Bacteria 6906439
636 2977833295 2977828996 Bacteria 7007971
637 2977855128 2977851361 Bacteria 6694324
638 2977867886 2977864932 Bacteria 7534097
639 2977875144 2977872689 Bacteria 7270173
640 2977901593 2977898635 Bacteria 6675551
641 2977907477 2977907340 Bacteria 6577984
642 2977917264 2977915119 Bacteria 6829656
643 2977929222 2977922695 Bacteria 6956781
644 2977940422 2977935797 Bacteria 6252826
645 2977947580 2977942078 Bacteria 7570577
646 2977955205 2977950692 Bacteria 6893264
647 2977961714 2977957713 Bacteria 6877875
648 2977974290 2977971508 Bacteria 7472917
649 2977986811 2977986579 Bacteria 6581278
650 2979710488 2979710463 Bacteria 6785254
651 2979775230 2979772303 Bacteria 6618277
652 2979799132 2979793036 Bacteria 6808957
653 2979812104 2979808191 Bacteria 7179355
654 2987637909 2987636660 Bacteria 8088555
655 2987646796 2987645492 Bacteria 6117018
656 2987659397 2987652177 Bacteria 6969023
657 2987666651 2987659509 Bacteria 6966464
658 2987668868 2987666974 Bacteria 6509233
659 2987674547 2987673487 Bacteria 6884027
660 2996310634 2996310559 Bacteria 6357320
661 2996350537 2996348954 Bacteria 7239054
662 2996389344 2996386984 Bacteria 6978667
663 3000140232 3000135777 Bacteria 6891109
664 3004169298 3004167301 Bacteria 8330599
665 3004195653 3004188549 Bacteria 6952365
666 3004197586 3004195979 Bacteria 6776956
667 3004205769 3004203850 Bacteria 7307914
668 3004216333 3004211236 Bacteria 7417683
669 3004224083 3004218560 Bacteria 7421728
670 3004238921 3004232784 Bacteria 6662140
671 3004243770 3004239961 Bacteria 6892290
672 3004251253 3004248173 Bacteria 6563236
673 3004268901 3004268573 Bacteria 7043476
674 3004277235 3004275668 Bacteria 7114440
675 3004297096 3004289098 Bacteria 6135450
676 3004341325 3004334049 Bacteria 8449246
677 637074228 637000159 Bacteria 7596297
678 649873322 649633066 Bacteria 6690028
679 8002288718 8002285264 Bacteria 6717907
680 8004301859 8004300914 Bacteria 6132239
681 8004366482 8004361976 Bacteria 6858373
682 8004379290 8004374579 Bacteria 6898112
683 8004400661 8004395343 Bacteria 6620908
684 8004635986 8004633249 Bacteria 6723080
685 8004696028 8004695233 Bacteria 6731676
686 8004731025 8004727605 Bacteria 6643904
687 8045866361 8045864390 Bacteria 5043873
688 8055621179 8055617313 Bacteria 7548464
689 Ga0496121_0147665
690 JGI24740J21852_10064788
691 JGI24739J22299_10014828
692 JGI24735J21928_10011175
693 JGI25156J39149_1002644
694 JGI25157J39369_1001346
695 JGI25165J46597_1000062
696 Ga0055542_1001266
697 Ga0055529_1006508
698 Ga0058861_11805547
699 Ga0058862_12721942
700 Ga0065715_10097255
701 Ga0070680_101061223
702 Ga0070689_100731063
703 Ga0070692_10346483
704 Ga0070669_100091100
705 Ga0070674_100107055
706 Ga0070674_100279852
707 Ga0070705_100757949
708 Ga0070700_100080308
709 Ga0070694_100009095
710 Ga0070694_101139418
711 Ga0070708_100057280
712 Ga0070708_101744918
713 Ga0070678_101087896
714 Ga0070681_10014884
715 Ga0070706_100106712
716 Ga0070706_100457319
717 Ga0070698_100002853
718 Ga0070698_100025196
719 Ga0070698_100110063
720 Ga0070698_101316893
721 Ga0070699_100092658
722 Ga0070679_100667647
723 Ga0070697_100030341
724 Ga0070697_100067712
725 Ga0070697_100165469
726 Ga0070697_101049859
727 Ga0068853_100065114
728 Ga0070696_100156609
729 Ga0070696_100366916
730 Ga0070693_100008042
731 Ga0070665_100041861
732 Ga0070665_100043662
733 Ga0070665_100064070
734 Ga0070665_101171630
735 Ga0068854_100562741
736 Ga0068856_100134232
737 Ga0068861_100148516
738 Ga0068851_10288643
739 Ga0068858_100344410
740 Ga0081538_10009385
741 Ga0075365_10089845
742 Ga0075365_10135178
743 Ga0075365_10334779
744 Ga0075365_10405263
745 Ga0075368_10034700
746 Ga0075364_10181464
747 Ga0075364_10214201
748 Ga0075362_10118906
749 Ga0075362_10168749
750 Ga0075367_10133011
751 Ga0075367_10141805
752 Ga0075369_10087008
753 Ga0075370_10131075
754 Ga0075370_10250995
755 Ga0075370_10346932
756 Ga0075431_100289073
757 Ga0075433_10996785
758 Ga0068865_100037200
759 Ga0075436_100125898
760 Ga0105240_10415232
761 Ga0111539_10000450
762 Ga0111539_10927080
763 Ga0114129_10034451
764 Ga0114129_10110234
765 Ga0114129_10374450
766 Ga0114129_10401447
767 Ga0105243_10101828
768 Ga0105243_11420061
769 Ga0105241_10991092
770 Ga0105248_12254825
771 Ga0105237_10024376
772 Ga0105238_10180783
773 Ga0105239_10257567
774 Ga0157342_1047517
775 Ga0157370_10430015
776 Ga0157370_10633704
777 Ga0157369_10837934
778 Ga0157369_11090122
779 Ga0157374_10622684
780 Ga0157380_10004196
781 Ga0157380_10133039
782 Ga0157380_11278582
783 Ga0182008_10268174
784 Ga0182007_10023438
785 Ga0163161_10292737
786 Ga0197907_10124309
787 Ga0197907_11226427
788 Ga0197907_11342124
789 Ga0206356_11056185
790 Ga0206356_11207831
791 Ga0206349_1098660
792 Ga0206349_1760105
793 Ga0206351_10637505
794 Ga0206352_10701579
795 Ga0206352_10884132
796 Ga0206352_11228637
797 Ga0206350_10105058
798 Ga0206350_10743522
799 Ga0206350_11542253
800 Ga0206354_10066698
801 Ga0206354_10193729
802 Ga0206353_10922145
803 Ga0154015_1280372
804 Ga0213872_10061838
805 Ga0224712_10002715
806 Ga0224712_10002727
807 Ga0224712_10016180
808 Ga0224712_10105504
809 Ga0224712_10249105
810 Ga0209026_1000024
811 Ga0209677_111985
812 Ga0209148_1000050
813 Ga0209759_1000289
814 Ga0209233_1000129
815 Ga0209233_1013228
816 Ga0209455_1000183
817 Ga0207647_10037520
818 Ga0207684_10041034
819 Ga0207684_10043414
820 Ga0207684_11040852
821 Ga0207707_10010340
822 Ga0207695_10689271
823 Ga0207671_10133686
824 Ga0207660_11272905
825 Ga0207657_10034393
826 Ga0207652_10713211
827 Ga0207646_10141344
828 Ga0207646_10233771
829 Ga0207694_10031517
830 Ga0207694_10445716
831 Ga0207687_10807714
832 Ga0207709_11114380
833 Ga0207709_11145784
834 Ga0207669_10451457
835 Ga0207669_11197734
836 Ga0207639_10008683
837 Ga0207639_10242935
838 Ga0207639_11706185
839 Ga0207678_10185917
840 Ga0207702_10154388
841 Ga0207648_11230546
842 Ga0207674_10369080
843 Ga0207675_100105630
844 Ga0207683_11068247
845 Ga0268266_10030881
846 Ga0268266_10039504
847 Ga0268266_10436949
848 Ga0307513_10337380
849 Ga0307410_10840834
850 Ga0307412_10468316
851 Ga0373941_0016682
852 Ga0373931_0422086
853 Ga0395899_0119213
854 Ga0395899_0273712
855 Ga0395900_0052146
856 Ga0395900_0111364
857 Ga0395900_0156874
858 Ga0395900_0778026
859 Ga0395898_0022662
860 Ga0395898_0061507
861 Ga0395898_0063070
862 Ga0395905_0044789
863 Ga0395905_0234522
864 Ga0395905_0648471
865 Ga0395901_0013973
866 Ga0395901_0117423
867 Ga0395901_0161809
868 Ga0395901_0166901
869 Ga0395901_0265872
870 Ga0395901_0593893
871 Ga0451791_1360050
872 Ga0439431_0019847
873 Ga0439448_0187248
874 Ga0451576_0058529
875 Ga0495627_038669
876 Ga0495638_0017935
877 Ga0495620_0189897
878 Ga0495648_0317963
879 Ga0495597_0079787
880 Ga0495668_0039427
881 Ga0495660_0098746
882 Ga0495687_160665
883 Ga0495686_0319616
884 Ga0496102_1057906
885 Ga0496104_0331212
886 Ga0496109_0380300
887 Ga0496110_0634193
888 Ga0496112_0039529
889 Ga0496113_0166196
890 Ga0496113_0371575
891 Ga0496115_0503092
892 Ga0496119_0030542
893 Ga0496119_0113749
894 Ga0496119_0256233
895 Ga0496120_0004963
896 Ga0496121_0571813
897 Ga0496124_0098047
898 Ga0496124_0123256
899 Ga0496125_0200317
900 Ga0496126_0362821
901 Ga0501293_002557
902 Ga0501295_033034
903 Ga0501300_010870
904 Ga0501031_0001036
905 Ga0501031_0017658
906 Ga0501031_0328609
907 Ga0501032_0005372
908 Ga0501032_0052466
909 Ga0501033_0003811
910 Ga0501033_0005756
911 Ga0501033_0034364
912 Ga0501033_0076490
913 Ga0501033_0109313
914 Ga0501033_0395412
915 Ga0501034_0011047
916 Ga0501034_0057496
917 Ga0501034_0146233
918 Ga0501034_0218981
919 Ga0501036_0071225
920 Ga0501036_0175309
921 Ga0501036_0187039
922 Ga0501036_1136338
923 Ga0501037_0000576
924 Ga0501037_0091076
925 Ga0501037_0110082
926 Ga0501037_0718008
927 Ga0501038_0049367
928 Ga0501038_0074520
929 Ga0501038_0076656
930 Ga0501038_0151833
931 Ga0501038_0253227
932 Ga0501038_0318708
933 Ga0501038_0384127
934 Ga0501039_0008358
935 Ga0501039_0010688
936 Ga0501039_0324021
937 Ga0501039_0336769
938 Ga0501040_0022938
939 Ga0501040_0025361
940 Ga0501040_0127097
941 Ga0501040_0127552
942 Ga0501041_0001880
943 Ga0501041_0040036
944 Ga0501041_0092702
945 Ga0501042_0001688
946 Ga0501042_0005416
947 Ga0501042_0048982
948 Ga0501042_0063056
949 Ga0501042_0302891
950 Ga0501042_0344826
951 Ga0501043_0000003
952 Ga0501043_0032313
953 Ga0501043_0045424
954 Ga0501043_0092021
955 Ga0501043_0132140
956 Ga0501043_0302736
957 Ga0501043_0723681
958 Ga0501043_0798204
959 Ga0501046_0007394
960 Ga0501046_0046307
961 Ga0501047_0033716
962 Ga0501047_0143080
963 Ga0501048_0009800
964 Ga0501048_0024115
965 Ga0501048_0039499
966 Ga0501048_0516922
967 Ga0501048_0641649
968 Ga0501048_1047308
969 Ga0501067_0077897
970 Ga0501067_0199752
971 Ga0501068_0024760
972 Ga0501068_0039081
973 Ga0501068_0067377
974 Ga0501068_0292617
975 Ga0501069_0000002
976 Ga0501069_0042915
977 Ga0501070_0001802
978 Ga0501070_0007664
979 Ga0501070_0007959
980 Ga0501070_0016488
981 Ga0501070_0029326
982 Ga0501070_0326293
983 Ga0501070_0368124
984 Ga0501070_0829014
985 Ga0501071_0022311
986 Ga0501071_0025187
987 Ga0501071_0030465
988 Ga0501071_0039344
989 Ga0501071_0052714
990 Ga0501071_0248063
991 Ga0501071_0336757
992 Ga0501071_1275181
993 Ga0501072_0000982
994 Ga0501072_0012750
995 Ga0501072_0018194
996 Ga0501072_0034015
997 Ga0501072_0086673
998 Ga0501072_0208273
999 Ga0501072_0418584
1000 Ga0501073_0027300
1001 Ga0501073_0033052
1002 Ga0501073_0040923
1003 Ga0501073_0365271
1004 Ga0501073_0675776
1005 Ga0501074_0000032
1006 Ga0501074_0000851
1007 Ga0501074_0012237
1008 Ga0501074_0043232
1009 Ga0501074_0522108
1010 Ga0501074_0816867
1011 Ga0501074_0869907
1012 Ga0501075_0000787
1013 Ga0501075_0010423
1014 Ga0501075_0129671
1015 Ga0501075_0131873
1016 Ga0501076_0006027
1017 Ga0501076_0010286
1018 Ga0501076_0060385
1019 Ga0501076_0223962
1020 Ga0501076_0406631
1021 Ga0501077_0003632
1022 Ga0501077_0006047
1023 Ga0501206_012416
1024 Ga0501216_014581
1025 Ga0501223_005682
1026 Ga0501227_038883
1027 Ga0501233_027770
1028 Ga0501235_019232
1029 Ga0501236_003070
1030 Ga0501240_004463
1031 Ga0501259_043095
1032 Ga0501221_020518
1033 Ga0501225_0017522
1034 Ga0501234_012783
1035 Ga0501079_0003219
1036 Ga0501079_0007239
1037 Ga0501079_0047191
1038 Ga0501079_0083119
1039 Ga0501079_0321329
1040 Ga0501079_0357250
1041 Ga0501079_1323552
1042 Ga0501080_0037624
1043 Ga0501080_0041559
1044 Ga0501080_0052011
1045 Ga0501080_0056672
1046 Ga0501080_0364786
1047 Ga0501080_0828143
1048 Ga0501081_0001400
1049 Ga0501081_0008846
1050 Ga0501083_0000819
1051 Ga0501083_0057426
1052 Ga0501083_0218961
1053 Ga0501270_082628
1054 Ga0501035_0000200
1055 Ga0501035_0002238
1056 Ga0501035_0006427
1057 Ga0501035_0009362
1058 Ga0501035_0015417
1059 Ga0501035_0075807
1060 Ga0501035_0106172
1061 Ga0501035_0240194
1062 Ga0501035_0384171
1063 Ga0501035_0503052
1064 Ga0501044_0000161
1065 Ga0501044_0007571
1066 Ga0501044_0027442
1067 Ga0501044_0029646
1068 Ga0501044_0037813
1069 Ga0501044_0042305
1070 Ga0501044_0100148
1071 Ga0501045_0008239
1072 Ga0501045_0011570
1073 Ga0501045_0014178
1074 Ga0501045_0237306
1075 Ga0501045_0642552
1076 Ga0501045_1279980
1077 Ga0501212_042753
1078 nmdc:mga03683_53397_c1
1079 nmdc:mga03n38_106034_c1
1080 nmdc:mga03n38_88743_c1
1081 nmdc:mga00v17_373548_c1
1082 nmdc:mga0yw44_10873_c1
1083 nmdc:mga0yw44_155916_c1
1084 nmdc:mga0yw44_327230_c1
1085 nmdc:mga0yw44_42700_c1
1086 nmdc:mga0yw44_769041_c1
1087 nmdc:mga06z11_135672_c2
1088 nmdc:mga06z11_456663_c1
1089 nmdc:mga06z11_49634_c1
1090 nmdc:mga07m45_292746_c1
1091 nmdc:mga07m45_54445_c1
1092 nmdc:mga05p37_243316_c1
1093 nmdc:mga05p37_420823_c1
1094 nmdc:mga08y16_49163_c1
1095 nmdc:mga0n895_1577480_c1
1096 nmdc:mga08x19_288322_c1
1097 nmdc:mga0sz30_17013_c1
1098 nmdc:mga0sz30_51674_c1
1099 Ga0500610_0129367
1100 Ga0500568_0000059
1101 Ga0500568_0106067
1102 Ga0500627_0220375
1103 Ga0500611_081864
1104 Ga0501084_0004442
1105 Ga0501084_0009361
1106 Ga0501084_0161447
1107 Ga0501084_0446945
1108 Ga0501084_0511300
1109 Ga0501084_0596593
1110 Ga0501084_0621273
1111 Ga0587082_077044
1112 Ga0587083_0024615
1113 Ga0587085_056080
1114 Ga0587088_129452
1115 Ga0587091_040408
1116 Ga0587092_071860
1117 Ga0587101_023349
1118 Ga0587115_011953
1119 Ga0587069_025293
1120 Ga0587075_027692
1121 Ga0587076_033711
1122 Ga0587079_016804
1123 Ga0587107_010486
1124 Ga0587107_043386
1125 Ga0587110_010586
1126 Ga0587111_0081452
1127 Ga0587111_0136797
1128 Ga0501082_0013544
1129 Ga0501082_0087731
1130 Ga0501082_0123657
1131 Ga0501082_0367326
1132 Ga0501082_0662309
1133 Ga0501082_1243415
1134 Ga0530510_0001837
1135 Ga0530510_0023810
1136 Ga0530510_0042078
1137 Ga0530510_0119881
1138 Ga0530510_0175057
1139 2503201982
1140 2509115968
1141 2509141684
1142 2509371161
1143 2509396652
1144 2510313746
1145 2512931126
1146 2512958937
1147 2513610909
1148 2514038219
1149 2514420228
1150 2588516900
1151 2597814356
1152 2599938381
1153 2643775270
1154 2643793716
1155 2643985809
1156 2644129058
1157 2644158423
1158 2688598804
1159 2723575744
1160 2739308169
1161 2756675663
1162 2770196696
1163 2776272728
1164 2776284671
1165 2792749618
1166 2837680566
1167 2840769519
1168 2841739651
1169 2844006167
1170 2844014145
1171 2856325616
1172 2856331464
1173 2856339054
1174 2856347941
1175 2856352891
1176 2856358725
1177 2857350725
1178 2857370750
1179 2869167610
1180 2869173229
1181 2869234966
1182 2869249504
1183 2869250865
1184 2869262117
1185 2869270449
1186 2869272124
1187 2869279240
1188 2871443462
1189 2871459114
1190 2871466480
1191 2871468152
1192 2871480938
1193 2871485792
1194 2871491344
1195 2871502894
1196 2874114400
1197 2874119313
1198 2874123693
1199 2874134715
1200 2874144986
1201 2874166222
1202 2874174430
1203 2876365617
1204 2876370572
1205 2876387131
1206 2876406011
1207 2876407568
1208 2878731969
1209 2878745623
1210 2878757779
1211 2878766786
1212 2878773983
1213 2878777173
1214 2878782462
1215 2878791685
1216 2881151881
1217 2881155666
1218 2881167885
1219 2881849790
1220 2881854077
1221 2881864473
1222 2882635637
1223 2882915248
1224 2885309784
1225 2885317611
1226 2885321526
1227 2885328973
1228 2885338307
1229 2885345245
1230 2885351728
1231 2888339793
1232 2888347191
1233 2888356120
1234 2889017257
1235 2903455404
1236 2903506454
1237 2903520231
1238 2903523546
1239 2903534180
1240 2903548033
1241 2904579245
1242 2904661218
1243 2906367724
1244 2906371495
1245 2906382784
1246 2906390995
1247 2906396760
1248 2906405296
1249 2906412097
1250 2906434612
1251 2919121929
1252 2922137072
1253 2922155636
1254 2922177475
1255 2924713689
1256 2924721308
1257 2924739350
1258 2924743765
1259 2924748518
1260 2924762420
1261 2924766790
1262 2924783867
1263 2924785724
1264 2937824856
1265 2937838032
1266 2937844815
1267 2937855108
1268 2937862178
1269 2937873862
1270 2937877399
1271 2937975496
1272 2937984119
1273 2938001909
1274 2958035381
1275 2958043568
1276 2958067780
1277 2958072707
1278 2958084505
1279 2958096437
1280 2958104995
1281 2958110990
1282 2958125717
1283 2958143636
1284 2958147227
1285 2958163023
1286 2958171964
1287 2958175285
1288 2961116369
1289 2961132254
1290 2961144644
1291 2961170410
1292 2961174322
1293 2961189944
1294 2963648092
1295 2965025156
1296 2965026523
1297 2965035275
1298 2965040420
1299 2965055187
1300 2965094719
1301 2965107097
1302 2965114530
1303 2965122087
1304 2968000269
1305 2968005459
1306 2968018073
1307 2968090914
1308 2968112275
1309 2968121039
1310 2968139506
1311 2968178797
1312 2970471752
1313 2970495707
1314 2970506909
1315 2970512828
1316 2970530691
1317 2970533683
1318 2970554702
1319 2970561642
1320 2970593836
1321 2970619732
1322 2970633054
1323 2977822311
1324 2977833295
1325 2977855128
1326 2977867886
1327 2977875144
1328 2977901593
1329 2977907477
1330 2977917264
1331 2977929222
1332 2977940422
1333 2977947580
1334 2977955205
1335 2977961714
1336 2977974290
1337 2977986811
1338 2979710488
1339 2979775230
1340 2979799132
1341 2979812104
1342 2987637909
1343 2987646796
1344 2987659397
1345 2987666651
1346 2987668868
1347 2987674547
1348 2996310634
1349 2996350537
1350 2996389344
1351 3000140232
1352 3004169298
1353 3004195653
1354 3004197586
1355 3004205769
1356 3004216333
1357 3004224083
1358 3004238921
1359 3004243770
1360 3004251253
1361 3004268901
1362 3004277235
1363 3004297096
1364 3004341325
1365 637074228
1366 649873322
1367 8002288718
1368 8004301859
1369 8004366482
1370 8004379290
1371 8004400661
1372 8004635986
1373 8004696028
1374 8004731025
1375 8045866361
1376 8055621179

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

102

176

0.97

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

34

100

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9431 3 154
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9412 1 154
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9359 1 154
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.93 2 154
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9238 1 154
ID Description Score Start End Superfamily
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9507 1 76 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9388 2 74 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9357 2 76 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9337 2 76 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9273 1 76 3.10.20.30
ID Description Score Start End GO Terms
AF-Q98L90-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9563 2 166 GO:0016491
GO:0046872
GO:0051537
AF-A0A1H0J689-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9512 1 160 GO:0016491
GO:0046872
GO:0051537
AF-A0A543L6H0-F1-model_v4 deleted 0.9511 1 165
AF-A0A2H5WER8-F1-model_v4 Carbon monoxide dehydrogenase small chain (EC 1.2.5.3) 0.9507 1 158 GO:0008805
GO:0046872
GO:0051537
AF-A0A0S8C2C2-F1-model_v4 Carbon monoxide dehydrogenase 0.9505 1 154 GO:0016491
GO:0046872
GO:0051537

Map