F475349
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 688 | 460 | 1376 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0147665|Ga0496121_0147665_297_881 |
| Length | 194 |
| Sequence | MQCTNNAWPKCQRRVGSVMTKVDTQGGFMSDISFVVNGRRVSGAAEDRTLLVHFLRENLGLTGTHVGCDTSQCGACVVHVDGKAVKSCTMLAVQASGSTIVTIEGLANGADLHPVQAAFKEHHGLQCGFCTPGMIMTATDMINRHPEGLDEATVRAELEGNICRCTGYHNIVKAILAASKTMAKVSKGRAKQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 117 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 118 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 119 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 129 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 130 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 132 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 133 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 134 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 135 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 136 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 137 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 138 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 139 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 140 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 141 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 142 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 143 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 170 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 171 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 172 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 173 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 174 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 175 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 176 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 177 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 178 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 179 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 181 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 190 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 191 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 192 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 193 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 194 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 195 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 201 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 202 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 203 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 204 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 205 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 223 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 224 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 225 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 226 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 227 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 228 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 229 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 230 | 2512875024 | |||
| 231 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 232 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 233 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 234 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 235 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 236 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 237 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 238 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 239 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 240 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 241 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 242 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 243 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 244 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 245 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 246 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 247 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 248 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 249 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 250 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 251 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 252 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 253 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 254 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 255 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 256 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 257 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 258 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 259 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 260 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 261 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 262 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 263 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 264 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 265 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 266 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 267 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 268 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 269 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 270 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 271 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 272 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 273 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 274 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 275 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 276 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 277 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 278 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 279 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 280 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 281 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 282 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 283 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 284 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 285 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 286 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 287 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 288 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 289 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 290 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 291 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 292 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 293 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 294 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 295 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 296 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 297 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 298 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 299 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 300 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 301 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 302 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 303 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 304 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 305 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 306 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 307 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 308 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 309 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 310 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 311 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 312 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 313 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 314 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 315 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 316 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 317 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 318 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 319 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 320 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 321 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 322 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 323 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 324 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 325 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 326 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 327 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 328 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 329 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 330 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 331 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 332 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 333 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 334 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 335 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 336 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 337 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 338 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 339 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 340 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 341 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 342 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 343 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 344 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 345 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 346 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 347 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 348 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 349 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 350 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 351 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 352 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 353 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 354 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 355 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 356 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 357 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 358 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 359 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 360 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 361 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 362 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 363 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 364 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 365 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 366 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 367 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 368 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 369 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 370 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 371 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 372 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 373 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 374 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 375 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 376 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 377 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 378 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 379 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 380 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 381 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 382 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 383 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 384 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 385 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 386 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 387 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 388 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 389 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 390 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 391 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 392 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 393 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 394 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 395 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 396 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 397 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 398 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 399 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 400 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 401 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 402 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 403 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 404 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 405 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 406 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 407 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 408 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 409 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 410 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 411 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 412 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 413 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 414 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 415 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 416 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 417 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 418 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 419 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 420 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 421 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 422 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 423 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 424 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 425 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 426 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 427 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 428 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 429 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 430 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 431 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 432 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 433 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 434 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 435 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 436 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 437 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 438 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 439 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 440 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 441 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 442 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 443 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 444 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 445 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 446 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 447 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 448 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 449 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 450 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 451 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 452 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 453 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 454 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 455 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 456 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 457 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 458 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 459 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 460 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 59.3 |
| Metatranscriptomes | 6.1 |
| Isolates | 34.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.4 |
| Nodule | 29.07 |
| Rhizoplane | 1.6 |
| Rhizosphere | 55.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496121_0147665 | 3300048924 | Bacteria | 1735 |
| 2 | JGI24740J21852_10064788 | 3300001979 | Bacteria | 996 |
| 3 | JGI24739J22299_10014828 | 3300001989 | Bacteria | 2834 |
| 4 | JGI24735J21928_10011175 | 3300002067 | Bacteria | 2851 |
| 5 | JGI25156J39149_1002644 | 3300002705 | Bacteria | 6293 |
| 6 | JGI25157J39369_1001346 | 3300002741 | Bacteria | 9699 |
| 7 | JGI25165J46597_1000062 | 3300003214 | Bacteria | 206459 |
| 8 | Ga0055542_1001266 | 3300003762 | Bacteria | 13749 |
| 9 | Ga0055529_1006508 | 3300003763 | Bacteria | 1631 |
| 10 | Ga0058861_11805547 | 3300004800 | Bacteria | 824 |
| 11 | Ga0058862_12721942 | 3300004803 | Bacteria | 1039 |
| 12 | Ga0065715_10097255 | 3300005293 | Bacteria | 3736 |
| 13 | Ga0070680_101061223 | 3300005336 | Bacteria | 700 |
| 14 | Ga0070689_100731063 | 3300005340 | Bacteria | 866 |
| 15 | Ga0070692_10346483 | 3300005345 | Bacteria | 922 |
| 16 | Ga0070669_100091100 | 3300005353 | Bacteria | 2286 |
| 17 | Ga0070674_100107055 | 3300005356 | Bacteria | 2047 |
| 18 | Ga0070674_100279852 | 3300005356 | Bacteria | 1322 |
| 19 | Ga0070705_100757949 | 3300005440 | Bacteria | 768 |
| 20 | Ga0070700_100080308 | 3300005441 | Bacteria | 2104 |
| 21 | Ga0070694_100009095 | 3300005444 | Bacteria | 6092 |
| 22 | Ga0070694_101139418 | 3300005444 | Bacteria | 652 |
| 23 | Ga0070708_100057280 | 3300005445 | Bacteria | 3469 |
| 24 | Ga0070708_101744918 | 3300005445 | Bacteria | 578 |
| 25 | Ga0070678_101087896 | 3300005456 | Bacteria | 738 |
| 26 | Ga0070681_10014884 | 3300005458 | Bacteria | 7734 |
| 27 | Ga0070706_100106712 | 3300005467 | Bacteria | 2605 |
| 28 | Ga0070706_100457319 | 3300005467 | Bacteria | 1188 |
| 29 | Ga0070698_100002853 | 3300005471 | Bacteria | 19022 |
| 30 | Ga0070698_100025196 | 3300005471 | Bacteria | 6197 |
| 31 | Ga0070698_100110063 | 3300005471 | Bacteria | 2720 |
| 32 | Ga0070698_101316893 | 3300005471 | Bacteria | 672 |
| 33 | Ga0070699_100092658 | 3300005518 | Bacteria | 2643 |
| 34 | Ga0070679_100667647 | 3300005530 | Bacteria | 982 |
| 35 | Ga0070697_100030341 | 3300005536 | Bacteria | 4343 |
| 36 | Ga0070697_100067712 | 3300005536 | Bacteria | 2921 |
| 37 | Ga0070697_100165469 | 3300005536 | Bacteria | 1870 |
| 38 | Ga0070697_101049859 | 3300005536 | Bacteria | 725 |
| 39 | Ga0068853_100065114 | 3300005539 | Bacteria | 3162 |
| 40 | Ga0070696_100156609 | 3300005546 | Bacteria | 1676 |
| 41 | Ga0070696_100366916 | 3300005546 | Bacteria | 1119 |
| 42 | Ga0070693_100008042 | 3300005547 | Bacteria | 5177 |
| 43 | Ga0070665_100041861 | 3300005548 | Bacteria | 4605 |
| 44 | Ga0070665_100043662 | 3300005548 | Bacteria | 4503 |
| 45 | Ga0070665_100064070 | 3300005548 | Bacteria | 3686 |
| 46 | Ga0070665_101171630 | 3300005548 | Bacteria | 779 |
| 47 | Ga0068854_100562741 | 3300005578 | Bacteria | 968 |
| 48 | Ga0068856_100134232 | 3300005614 | Bacteria | 2481 |
| 49 | Ga0068861_100148516 | 3300005719 | Bacteria | 1921 |
| 50 | Ga0068851_10288643 | 3300005834 | Bacteria | 940 |
| 51 | Ga0068858_100344410 | 3300005842 | Bacteria | 1427 |
| 52 | Ga0081538_10009385 | 3300005981 | Bacteria | 8174 |
| 53 | Ga0075365_10089845 | 3300006038 | Bacteria | 2091 |
| 54 | Ga0075365_10135178 | 3300006038 | Bacteria | 1708 |
| 55 | Ga0075365_10334779 | 3300006038 | Bacteria | 1066 |
| 56 | Ga0075365_10405263 | 3300006038 | Bacteria | 962 |
| 57 | Ga0075368_10034700 | 3300006042 | Bacteria | 1966 |
| 58 | Ga0075364_10181464 | 3300006051 | Bacteria | 1424 |
| 59 | Ga0075364_10214201 | 3300006051 | Bacteria | 1306 |
| 60 | Ga0075362_10118906 | 3300006177 | Bacteria | 1249 |
| 61 | Ga0075362_10168749 | 3300006177 | Bacteria | 1056 |
| 62 | Ga0075367_10133011 | 3300006178 | Bacteria | 1538 |
| 63 | Ga0075367_10141805 | 3300006178 | Bacteria | 1489 |
| 64 | Ga0075369_10087008 | 3300006186 | Bacteria | 1391 |
| 65 | Ga0075370_10131075 | 3300006353 | Bacteria | 1463 |
| 66 | Ga0075370_10250995 | 3300006353 | Bacteria | 1049 |
| 67 | Ga0075370_10346932 | 3300006353 | Bacteria | 887 |
| 68 | Ga0075431_100289073 | 3300006847 | Bacteria | 1659 |
| 69 | Ga0075433_10996785 | 3300006852 | Bacteria | 730 |
| 70 | Ga0068865_100037200 | 3300006881 | Bacteria | 3285 |
| 71 | Ga0075436_100125898 | 3300006914 | Bacteria | 1795 |
| 72 | Ga0105240_10415232 | 3300009093 | Bacteria | 1513 |
| 73 | Ga0111539_10000450 | 3300009094 | Bacteria | 51598 |
| 74 | Ga0111539_10927080 | 3300009094 | Bacteria | 1013 |
| 75 | Ga0114129_10034451 | 3300009147 | Bacteria | 7152 |
| 76 | Ga0114129_10110234 | 3300009147 | Bacteria | 3799 |
| 77 | Ga0114129_10374450 | 3300009147 | Bacteria | 1881 |
| 78 | Ga0114129_10401447 | 3300009147 | Bacteria | 1806 |
| 79 | Ga0105243_10101828 | 3300009148 | Bacteria | 2385 |
| 80 | Ga0105243_11420061 | 3300009148 | Bacteria | 715 |
| 81 | Ga0105241_10991092 | 3300009174 | Bacteria | 785 |
| 82 | Ga0105248_12254825 | 3300009177 | Bacteria | 620 |
| 83 | Ga0105237_10024376 | 3300009545 | Bacteria | 6190 |
| 84 | Ga0105238_10180783 | 3300009551 | Bacteria | 2086 |
| 85 | Ga0105239_10257567 | 3300010375 | Bacteria | 1960 |
| 86 | Ga0157342_1047517 | 3300012507 | Bacteria | 594 |
| 87 | Ga0157370_10430015 | 3300013104 | Bacteria | 1214 |
| 88 | Ga0157370_10633704 | 3300013104 | Bacteria | 978 |
| 89 | Ga0157369_10837934 | 3300013105 | Bacteria | 944 |
| 90 | Ga0157369_11090122 | 3300013105 | Bacteria | 816 |
| 91 | Ga0157374_10622684 | 3300013296 | Bacteria | 1090 |
| 92 | Ga0157380_10004196 | 3300014326 | Bacteria | 9965 |
| 93 | Ga0157380_10133039 | 3300014326 | Bacteria | 2125 |
| 94 | Ga0157380_11278582 | 3300014326 | Bacteria | 780 |
| 95 | Ga0182008_10268174 | 3300014497 | Bacteria | 885 |
| 96 | Ga0182007_10023438 | 3300015262 | Bacteria | 2170 |
| 97 | Ga0163161_10292737 | 3300017792 | Bacteria | 1280 |
| 98 | Ga0197907_10124309 | 3300020069 | Bacteria | 2453 |
| 99 | Ga0197907_11226427 | 3300020069 | Bacteria | 2028 |
| 100 | Ga0197907_11342124 | 3300020069 | Bacteria | 935 |
| 101 | Ga0206356_11056185 | 3300020070 | Bacteria | 798 |
| 102 | Ga0206356_11207831 | 3300020070 | Bacteria | 3015 |
| 103 | Ga0206349_1098660 | 3300020075 | Bacteria | 1470 |
| 104 | Ga0206349_1760105 | 3300020075 | Bacteria | 1497 |
| 105 | Ga0206351_10637505 | 3300020077 | Bacteria | 1497 |
| 106 | Ga0206352_10701579 | 3300020078 | Bacteria | 700 |
| 107 | Ga0206352_10884132 | 3300020078 | Bacteria | 1089 |
| 108 | Ga0206352_11228637 | 3300020078 | Bacteria | 2002 |
| 109 | Ga0206350_10105058 | 3300020080 | Bacteria | 1974 |
| 110 | Ga0206350_10743522 | 3300020080 | Bacteria | 530 |
| 111 | Ga0206350_11542253 | 3300020080 | Bacteria | 4179 |
| 112 | Ga0206354_10066698 | 3300020081 | Bacteria | 3371 |
| 113 | Ga0206354_10193729 | 3300020081 | Bacteria | 1032 |
| 114 | Ga0206353_10922145 | 3300020082 | Bacteria | 1675 |
| 115 | Ga0154015_1280372 | 3300020610 | Bacteria | 852 |
| 116 | Ga0213872_10061838 | 3300021361 | Bacteria | 1693 |
| 117 | Ga0224712_10002715 | 3300022467 | Bacteria | 4442 |
| 118 | Ga0224712_10002727 | 3300022467 | Bacteria | 4434 |
| 119 | Ga0224712_10016180 | 3300022467 | Bacteria | 2444 |
| 120 | Ga0224712_10105504 | 3300022467 | Bacteria | 1201 |
| 121 | Ga0224712_10249105 | 3300022467 | Bacteria | 820 |
| 122 | Ga0209026_1000024 | 3300025250 | Bacteria | 355839 |
| 123 | Ga0209677_111985 | 3300025253 | Bacteria | 1314 |
| 124 | Ga0209148_1000050 | 3300025254 | Bacteria | 413178 |
| 125 | Ga0209759_1000289 | 3300025256 | Bacteria | 69478 |
| 126 | Ga0209233_1000129 | 3300025261 | Bacteria | 206511 |
| 127 | Ga0209233_1013228 | 3300025261 | Bacteria | 2360 |
| 128 | Ga0209455_1000183 | 3300025272 | Bacteria | 99952 |
| 129 | Ga0207647_10037520 | 3300025904 | Bacteria | 3071 |
| 130 | Ga0207684_10041034 | 3300025910 | Bacteria | 3925 |
| 131 | Ga0207684_10043414 | 3300025910 | Bacteria | 3812 |
| 132 | Ga0207684_11040852 | 3300025910 | Bacteria | 683 |
| 133 | Ga0207707_10010340 | 3300025912 | Bacteria | 8096 |
| 134 | Ga0207695_10689271 | 3300025913 | Bacteria | 902 |
| 135 | Ga0207671_10133686 | 3300025914 | Bacteria | 1906 |
| 136 | Ga0207660_11272905 | 3300025917 | Bacteria | 598 |
| 137 | Ga0207657_10034393 | 3300025919 | Bacteria | 4557 |
| 138 | Ga0207652_10713211 | 3300025921 | Bacteria | 894 |
| 139 | Ga0207646_10141344 | 3300025922 | Bacteria | 2168 |
| 140 | Ga0207646_10233771 | 3300025922 | Bacteria | 1661 |
| 141 | Ga0207694_10031517 | 3300025924 | Bacteria | 4050 |
| 142 | Ga0207694_10445716 | 3300025924 | Bacteria | 1080 |
| 143 | Ga0207687_10807714 | 3300025927 | Bacteria | 800 |
| 144 | Ga0207709_11114380 | 3300025935 | Bacteria | 648 |
| 145 | Ga0207709_11145784 | 3300025935 | Bacteria | 640 |
| 146 | Ga0207669_10451457 | 3300025937 | Bacteria | 1019 |
| 147 | Ga0207669_11197734 | 3300025937 | Bacteria | 643 |
| 148 | Ga0207639_10008683 | 3300026041 | Bacteria | 6974 |
| 149 | Ga0207639_10242935 | 3300026041 | Bacteria | 1566 |
| 150 | Ga0207639_11706185 | 3300026041 | Bacteria | 590 |
| 151 | Ga0207678_10185917 | 3300026067 | Bacteria | 1775 |
| 152 | Ga0207702_10154388 | 3300026078 | Bacteria | 2091 |
| 153 | Ga0207648_11230546 | 3300026089 | Bacteria | 703 |
| 154 | Ga0207674_10369080 | 3300026116 | Bacteria | 1387 |
| 155 | Ga0207675_100105630 | 3300026118 | Bacteria | 2655 |
| 156 | Ga0207683_11068247 | 3300026121 | Bacteria | 749 |
| 157 | Ga0268266_10030881 | 3300028379 | Bacteria | 4550 |
| 158 | Ga0268266_10039504 | 3300028379 | Bacteria | 4020 |
| 159 | Ga0268266_10436949 | 3300028379 | Bacteria | 1242 |
| 160 | Ga0307513_10337380 | 3300031456 | Bacteria | 1259 |
| 161 | Ga0307410_10840834 | 3300031852 | Bacteria | 783 |
| 162 | Ga0307412_10468316 | 3300031911 | Bacteria | 1042 |
| 163 | Ga0373941_0016682 | 3300035115 | Bacteria | 2001 |
| 164 | Ga0373931_0422086 | 3300035691 | Bacteria | 848 |
| 165 | Ga0395899_0119213 | 3300037312 | Bacteria | 1892 |
| 166 | Ga0395899_0273712 | 3300037312 | Bacteria | 1151 |
| 167 | Ga0395900_0052146 | 3300037418 | Bacteria | 4211 |
| 168 | Ga0395900_0111364 | 3300037418 | Bacteria | 2812 |
| 169 | Ga0395900_0156874 | 3300037418 | Bacteria | 2324 |
| 170 | Ga0395900_0778026 | 3300037418 | Bacteria | 886 |
| 171 | Ga0395898_0022662 | 3300037466 | Bacteria | 6358 |
| 172 | Ga0395898_0061507 | 3300037466 | Bacteria | 3648 |
| 173 | Ga0395898_0063070 | 3300037466 | Bacteria | 3597 |
| 174 | Ga0395905_0044789 | 3300037471 | Bacteria | 4151 |
| 175 | Ga0395905_0234522 | 3300037471 | Bacteria | 1715 |
| 176 | Ga0395905_0648471 | 3300037471 | Bacteria | 958 |
| 177 | Ga0395901_0013973 | 3300038443 | Bacteria | 8171 |
| 178 | Ga0395901_0117423 | 3300038443 | Bacteria | 2795 |
| 179 | Ga0395901_0161809 | 3300038443 | Bacteria | 2351 |
| 180 | Ga0395901_0166901 | 3300038443 | Bacteria | 2311 |
| 181 | Ga0395901_0265872 | 3300038443 | Bacteria | 1785 |
| 182 | Ga0395901_0593893 | 3300038443 | Bacteria | 1117 |
| 183 | Ga0451791_1360050 | 3300041451 | Bacteria | 966 |
| 184 | Ga0439431_0019847 | 3300041997 | Bacteria | 1601 |
| 185 | Ga0439448_0187248 | 3300042005 | Bacteria | 724 |
| 186 | Ga0451576_0058529 | 3300045051 | Bacteria | 4027 |
| 187 | Ga0495627_038669 | 3300046453 | Bacteria | 1474 |
| 188 | Ga0495638_0017935 | 3300046460 | Bacteria | 4710 |
| 189 | Ga0495620_0189897 | 3300046515 | Bacteria | 792 |
| 190 | Ga0495648_0317963 | 3300046524 | Bacteria | 723 |
| 191 | Ga0495597_0079787 | 3300046542 | Bacteria | 1401 |
| 192 | Ga0495668_0039427 | 3300046616 | Bacteria | 2637 |
| 193 | Ga0495660_0098746 | 3300046810 | Bacteria | 1506 |
| 194 | Ga0495687_160665 | 3300047443 | Bacteria | 756 |
| 195 | Ga0495686_0319616 | 3300047472 | Bacteria | 851 |
| 196 | Ga0496102_1057906 | 3300048905 | Bacteria | 731 |
| 197 | Ga0496104_0331212 | 3300048907 | Bacteria | 1436 |
| 198 | Ga0496109_0380300 | 3300048912 | Bacteria | 1334 |
| 199 | Ga0496110_0634193 | 3300048913 | Bacteria | 968 |
| 200 | Ga0496112_0039529 | 3300048915 | Bacteria | 4611 |
| 201 | Ga0496113_0166196 | 3300048916 | Bacteria | 1746 |
| 202 | Ga0496113_0371575 | 3300048916 | Bacteria | 1148 |
| 203 | Ga0496115_0503092 | 3300048918 | Bacteria | 973 |
| 204 | Ga0496119_0030542 | 3300048922 | Bacteria | 3630 |
| 205 | Ga0496119_0113749 | 3300048922 | Bacteria | 1498 |
| 206 | Ga0496119_0256233 | 3300048922 | Bacteria | 880 |
| 207 | Ga0496120_0004963 | 3300048923 | Bacteria | 10809 |
| 208 | Ga0496121_0571813 | 3300048924 | Bacteria | 703 |
| 209 | Ga0496124_0098047 | 3300048927 | Bacteria | 2379 |
| 210 | Ga0496124_0123256 | 3300048927 | Bacteria | 2068 |
| 211 | Ga0496125_0200317 | 3300048928 | Bacteria | 1308 |
| 212 | Ga0496126_0362821 | 3300048929 | Bacteria | 1183 |
| 213 | Ga0501293_002557 | 3300049516 | Bacteria | 1383 |
| 214 | Ga0501295_033034 | 3300049518 | Bacteria | 1033 |
| 215 | Ga0501300_010870 | 3300049523 | Bacteria | 1327 |
| 216 | Ga0501031_0001036 | 3300049568 | Bacteria | 16868 |
| 217 | Ga0501031_0017658 | 3300049568 | Bacteria | 4639 |
| 218 | Ga0501031_0328609 | 3300049568 | Bacteria | 990 |
| 219 | Ga0501032_0005372 | 3300049569 | Bacteria | 9533 |
| 220 | Ga0501032_0052466 | 3300049569 | Bacteria | 2747 |
| 221 | Ga0501033_0003811 | 3300049570 | Bacteria | 12267 |
| 222 | Ga0501033_0005756 | 3300049570 | Bacteria | 9758 |
| 223 | Ga0501033_0034364 | 3300049570 | Bacteria | 3804 |
| 224 | Ga0501033_0076490 | 3300049570 | Bacteria | 2457 |
| 225 | Ga0501033_0109313 | 3300049570 | Bacteria | 2013 |
| 226 | Ga0501033_0395412 | 3300049570 | Bacteria | 964 |
| 227 | Ga0501034_0011047 | 3300049571 | Bacteria | 9377 |
| 228 | Ga0501034_0057496 | 3300049571 | Bacteria | 3910 |
| 229 | Ga0501034_0146233 | 3300049571 | Bacteria | 2341 |
| 230 | Ga0501034_0218981 | 3300049571 | Bacteria | 1856 |
| 231 | Ga0501036_0071225 | 3300049572 | Bacteria | 2940 |
| 232 | Ga0501036_0175309 | 3300049572 | Bacteria | 1805 |
| 233 | Ga0501036_0187039 | 3300049572 | Bacteria | 1743 |
| 234 | Ga0501036_1136338 | 3300049572 | Bacteria | 637 |
| 235 | Ga0501037_0000576 | 3300049573 | Bacteria | 28887 |
| 236 | Ga0501037_0091076 | 3300049573 | Bacteria | 2205 |
| 237 | Ga0501037_0110082 | 3300049573 | Bacteria | 1984 |
| 238 | Ga0501037_0718008 | 3300049573 | Bacteria | 664 |
| 239 | Ga0501038_0049367 | 3300049574 | Bacteria | 3638 |
| 240 | Ga0501038_0074520 | 3300049574 | Bacteria | 2871 |
| 241 | Ga0501038_0076656 | 3300049574 | Bacteria | 2824 |
| 242 | Ga0501038_0151833 | 3300049574 | Bacteria | 1888 |
| 243 | Ga0501038_0253227 | 3300049574 | Bacteria | 1394 |
| 244 | Ga0501038_0318708 | 3300049574 | Bacteria | 1217 |
| 245 | Ga0501038_0384127 | 3300049574 | Bacteria | 1089 |
| 246 | Ga0501039_0008358 | 3300049575 | Bacteria | 7888 |
| 247 | Ga0501039_0010688 | 3300049575 | Bacteria | 6992 |
| 248 | Ga0501039_0324021 | 3300049575 | Bacteria | 1211 |
| 249 | Ga0501039_0336769 | 3300049575 | Bacteria | 1186 |
| 250 | Ga0501040_0022938 | 3300049576 | Bacteria | 4181 |
| 251 | Ga0501040_0025361 | 3300049576 | Bacteria | 3985 |
| 252 | Ga0501040_0127097 | 3300049576 | Bacteria | 1791 |
| 253 | Ga0501040_0127552 | 3300049576 | Bacteria | 1788 |
| 254 | Ga0501041_0001880 | 3300049577 | Bacteria | 11769 |
| 255 | Ga0501041_0040036 | 3300049577 | Bacteria | 2844 |
| 256 | Ga0501041_0092702 | 3300049577 | Bacteria | 1865 |
| 257 | Ga0501042_0001688 | 3300049578 | Bacteria | 13159 |
| 258 | Ga0501042_0005416 | 3300049578 | Bacteria | 8218 |
| 259 | Ga0501042_0048982 | 3300049578 | Bacteria | 3013 |
| 260 | Ga0501042_0063056 | 3300049578 | Bacteria | 2649 |
| 261 | Ga0501042_0302891 | 3300049578 | Bacteria | 1155 |
| 262 | Ga0501042_0344826 | 3300049578 | Bacteria | 1077 |
| 263 | Ga0501043_0000003 | 3300049579 | Bacteria | 318844 |
| 264 | Ga0501043_0032313 | 3300049579 | Bacteria | 4114 |
| 265 | Ga0501043_0045424 | 3300049579 | Bacteria | 3455 |
| 266 | Ga0501043_0092021 | 3300049579 | Bacteria | 2384 |
| 267 | Ga0501043_0132140 | 3300049579 | Bacteria | 1956 |
| 268 | Ga0501043_0302736 | 3300049579 | Bacteria | 1221 |
| 269 | Ga0501043_0723681 | 3300049579 | Bacteria | 725 |
| 270 | Ga0501043_0798204 | 3300049579 | Bacteria | 683 |
| 271 | Ga0501046_0007394 | 3300049580 | Bacteria | 9653 |
| 272 | Ga0501046_0046307 | 3300049580 | Bacteria | 3452 |
| 273 | Ga0501047_0033716 | 3300049581 | Bacteria | 4941 |
| 274 | Ga0501047_0143080 | 3300049581 | Bacteria | 2269 |
| 275 | Ga0501048_0009800 | 3300049582 | Bacteria | 7182 |
| 276 | Ga0501048_0024115 | 3300049582 | Bacteria | 4442 |
| 277 | Ga0501048_0039499 | 3300049582 | Bacteria | 3385 |
| 278 | Ga0501048_0516922 | 3300049582 | Bacteria | 856 |
| 279 | Ga0501048_0641649 | 3300049582 | Bacteria | 762 |
| 280 | Ga0501048_1047308 | 3300049582 | Bacteria | 587 |
| 281 | Ga0501067_0077897 | 3300049583 | Bacteria | 1837 |
| 282 | Ga0501067_0199752 | 3300049583 | Bacteria | 1114 |
| 283 | Ga0501068_0024760 | 3300049584 | Bacteria | 3526 |
| 284 | Ga0501068_0039081 | 3300049584 | Bacteria | 2844 |
| 285 | Ga0501068_0067377 | 3300049584 | Bacteria | 2181 |
| 286 | Ga0501068_0292617 | 3300049584 | Bacteria | 1042 |
| 287 | Ga0501069_0000002 | 3300049585 | Bacteria | 269636 |
| 288 | Ga0501069_0042915 | 3300049585 | Bacteria | 2503 |
| 289 | Ga0501070_0001802 | 3300049586 | Bacteria | 18887 |
| 290 | Ga0501070_0007664 | 3300049586 | Bacteria | 9162 |
| 291 | Ga0501070_0007959 | 3300049586 | Bacteria | 8979 |
| 292 | Ga0501070_0016488 | 3300049586 | Bacteria | 6207 |
| 293 | Ga0501070_0029326 | 3300049586 | Bacteria | 4615 |
| 294 | Ga0501070_0326293 | 3300049586 | Bacteria | 1248 |
| 295 | Ga0501070_0368124 | 3300049586 | Bacteria | 1165 |
| 296 | Ga0501070_0829014 | 3300049586 | Bacteria | 725 |
| 297 | Ga0501071_0022311 | 3300049587 | Bacteria | 4413 |
| 298 | Ga0501071_0025187 | 3300049587 | Bacteria | 4166 |
| 299 | Ga0501071_0030465 | 3300049587 | Bacteria | 3816 |
| 300 | Ga0501071_0039344 | 3300049587 | Bacteria | 3383 |
| 301 | Ga0501071_0052714 | 3300049587 | Bacteria | 2934 |
| 302 | Ga0501071_0248063 | 3300049587 | Bacteria | 1343 |
| 303 | Ga0501071_0336757 | 3300049587 | Bacteria | 1147 |
| 304 | Ga0501071_1275181 | 3300049587 | Bacteria | 568 |
| 305 | Ga0501072_0000982 | 3300049588 | Bacteria | 21055 |
| 306 | Ga0501072_0012750 | 3300049588 | Bacteria | 6426 |
| 307 | Ga0501072_0018194 | 3300049588 | Bacteria | 5406 |
| 308 | Ga0501072_0034015 | 3300049588 | Bacteria | 3993 |
| 309 | Ga0501072_0086673 | 3300049588 | Bacteria | 2485 |
| 310 | Ga0501072_0208273 | 3300049588 | Bacteria | 1558 |
| 311 | Ga0501072_0418584 | 3300049588 | Bacteria | 1062 |
| 312 | Ga0501073_0027300 | 3300049589 | Bacteria | 4084 |
| 313 | Ga0501073_0033052 | 3300049589 | Bacteria | 3686 |
| 314 | Ga0501073_0040923 | 3300049589 | Bacteria | 3276 |
| 315 | Ga0501073_0365271 | 3300049589 | Bacteria | 997 |
| 316 | Ga0501073_0675776 | 3300049589 | Bacteria | 712 |
| 317 | Ga0501074_0000032 | 3300049590 | Bacteria | 65565 |
| 318 | Ga0501074_0000851 | 3300049590 | Bacteria | 19401 |
| 319 | Ga0501074_0012237 | 3300049590 | Bacteria | 6238 |
| 320 | Ga0501074_0043232 | 3300049590 | Bacteria | 3261 |
| 321 | Ga0501074_0522108 | 3300049590 | Bacteria | 841 |
| 322 | Ga0501074_0816867 | 3300049590 | Bacteria | 657 |
| 323 | Ga0501074_0869907 | 3300049590 | Bacteria | 634 |
| 324 | Ga0501075_0000787 | 3300049591 | Bacteria | 19821 |
| 325 | Ga0501075_0010423 | 3300049591 | Bacteria | 6532 |
| 326 | Ga0501075_0129671 | 3300049591 | Bacteria | 1921 |
| 327 | Ga0501075_0131873 | 3300049591 | Bacteria | 1904 |
| 328 | Ga0501076_0006027 | 3300049592 | Bacteria | 8765 |
| 329 | Ga0501076_0010286 | 3300049592 | Bacteria | 6935 |
| 330 | Ga0501076_0060385 | 3300049592 | Bacteria | 3016 |
| 331 | Ga0501076_0223962 | 3300049592 | Bacteria | 1537 |
| 332 | Ga0501076_0406631 | 3300049592 | Bacteria | 1119 |
| 333 | Ga0501077_0003632 | 3300049593 | Bacteria | 9281 |
| 334 | Ga0501077_0006047 | 3300049593 | Bacteria | 7389 |
| 335 | Ga0501206_012416 | 3300049653 | Bacteria | 1156 |
| 336 | Ga0501216_014581 | 3300049660 | Bacteria | 1315 |
| 337 | Ga0501223_005682 | 3300049663 | Bacteria | 2609 |
| 338 | Ga0501227_038883 | 3300049665 | Bacteria | 1169 |
| 339 | Ga0501233_027770 | 3300049668 | Bacteria | 1259 |
| 340 | Ga0501235_019232 | 3300049669 | Bacteria | 1515 |
| 341 | Ga0501236_003070 | 3300049670 | Bacteria | 1938 |
| 342 | Ga0501240_004463 | 3300049673 | Bacteria | 1625 |
| 343 | Ga0501259_043095 | 3300049688 | Bacteria | 893 |
| 344 | Ga0501221_020518 | 3300049704 | Bacteria | 1292 |
| 345 | Ga0501225_0017522 | 3300049705 | Bacteria | 1988 |
| 346 | Ga0501234_012783 | 3300049707 | Bacteria | 1316 |
| 347 | Ga0501079_0003219 | 3300049741 | Bacteria | 11955 |
| 348 | Ga0501079_0007239 | 3300049741 | Bacteria | 8374 |
| 349 | Ga0501079_0047191 | 3300049741 | Bacteria | 3323 |
| 350 | Ga0501079_0083119 | 3300049741 | Bacteria | 2477 |
| 351 | Ga0501079_0321329 | 3300049741 | Bacteria | 1212 |
| 352 | Ga0501079_0357250 | 3300049741 | Bacteria | 1145 |
| 353 | Ga0501079_1323552 | 3300049741 | Bacteria | 567 |
| 354 | Ga0501080_0037624 | 3300049742 | Bacteria | 4519 |
| 355 | Ga0501080_0041559 | 3300049742 | Bacteria | 4283 |
| 356 | Ga0501080_0052011 | 3300049742 | Bacteria | 3812 |
| 357 | Ga0501080_0056672 | 3300049742 | Bacteria | 3648 |
| 358 | Ga0501080_0364786 | 3300049742 | Bacteria | 1303 |
| 359 | Ga0501080_0828143 | 3300049742 | Bacteria | 810 |
| 360 | Ga0501081_0001400 | 3300049743 | Bacteria | 14719 |
| 361 | Ga0501081_0008846 | 3300049743 | Bacteria | 6545 |
| 362 | Ga0501083_0000819 | 3300049744 | Bacteria | 20356 |
| 363 | Ga0501083_0057426 | 3300049744 | Bacteria | 2605 |
| 364 | Ga0501083_0218961 | 3300049744 | Bacteria | 1240 |
| 365 | Ga0501270_082628 | 3300049767 | Bacteria | 642 |
| 366 | Ga0501035_0000200 | 3300049822 | Bacteria | 73015 |
| 367 | Ga0501035_0002238 | 3300049822 | Bacteria | 19169 |
| 368 | Ga0501035_0006427 | 3300049822 | Bacteria | 11042 |
| 369 | Ga0501035_0009362 | 3300049822 | Bacteria | 9104 |
| 370 | Ga0501035_0015417 | 3300049822 | Bacteria | 7050 |
| 371 | Ga0501035_0075807 | 3300049822 | Bacteria | 2975 |
| 372 | Ga0501035_0106172 | 3300049822 | Bacteria | 2462 |
| 373 | Ga0501035_0240194 | 3300049822 | Bacteria | 1541 |
| 374 | Ga0501035_0384171 | 3300049822 | Bacteria | 1170 |
| 375 | Ga0501035_0503052 | 3300049822 | Bacteria | 997 |
| 376 | Ga0501044_0000161 | 3300049823 | Bacteria | 83309 |
| 377 | Ga0501044_0007571 | 3300049823 | Bacteria | 11936 |
| 378 | Ga0501044_0027442 | 3300049823 | Bacteria | 6018 |
| 379 | Ga0501044_0029646 | 3300049823 | Bacteria | 5768 |
| 380 | Ga0501044_0037813 | 3300049823 | Bacteria | 5043 |
| 381 | Ga0501044_0042305 | 3300049823 | Bacteria | 4739 |
| 382 | Ga0501044_0100148 | 3300049823 | Bacteria | 2916 |
| 383 | Ga0501045_0008239 | 3300049824 | Bacteria | 7258 |
| 384 | Ga0501045_0011570 | 3300049824 | Bacteria | 6196 |
| 385 | Ga0501045_0014178 | 3300049824 | Bacteria | 5645 |
| 386 | Ga0501045_0237306 | 3300049824 | Bacteria | 1357 |
| 387 | Ga0501045_0642552 | 3300049824 | Bacteria | 784 |
| 388 | Ga0501045_1279980 | 3300049824 | Bacteria | 534 |
| 389 | Ga0501212_042753 | 3300049851 | Bacteria | 752 |
| 390 | nmdc:mga03683_53397_c1 | 3300050489 | Bacteria | 1691 |
| 391 | nmdc:mga03n38_106034_c1 | 3300050490 | Bacteria | 1362 |
| 392 | nmdc:mga03n38_88743_c1 | 3300050490 | Bacteria | 1468 |
| 393 | nmdc:mga00v17_373548_c1 | 3300050491 | Bacteria | 927 |
| 394 | nmdc:mga0yw44_10873_c1 | 3300050492 | Bacteria | 4667 |
| 395 | nmdc:mga0yw44_155916_c1 | 3300050492 | Bacteria | 1492 |
| 396 | nmdc:mga0yw44_327230_c1 | 3300050492 | Bacteria | 1030 |
| 397 | nmdc:mga0yw44_42700_c1 | 3300050492 | Bacteria | 2705 |
| 398 | nmdc:mga0yw44_769041_c1 | 3300050492 | Bacteria | 654 |
| 399 | nmdc:mga06z11_135672_c2 | 3300050494 | Bacteria | 818 |
| 400 | nmdc:mga06z11_456663_c1 | 3300050494 | Bacteria | 772 |
| 401 | nmdc:mga06z11_49634_c1 | 3300050494 | Bacteria | 2142 |
| 402 | nmdc:mga07m45_292746_c1 | 3300050496 | Bacteria | 947 |
| 403 | nmdc:mga07m45_54445_c1 | 3300050496 | Bacteria | 2261 |
| 404 | nmdc:mga05p37_243316_c1 | 3300050507 | Bacteria | 2162 |
| 405 | nmdc:mga05p37_420823_c1 | 3300050507 | Bacteria | 1555 |
| 406 | nmdc:mga08y16_49163_c1 | 3300050511 | Bacteria | 4413 |
| 407 | nmdc:mga0n895_1577480_c1 | 3300050512 | Bacteria | 621 |
| 408 | nmdc:mga08x19_288322_c1 | 3300050514 | Bacteria | 1138 |
| 409 | nmdc:mga0sz30_17013_c1 | 3300050516 | Bacteria | 2524 |
| 410 | nmdc:mga0sz30_51674_c1 | 3300050516 | Bacteria | 1011 |
| 411 | Ga0500610_0129367 | 3300053079 | Bacteria | 1285 |
| 412 | Ga0500568_0000059 | 3300053139 | Bacteria | 108096 |
| 413 | Ga0500568_0106067 | 3300053139 | Bacteria | 1053 |
| 414 | Ga0500627_0220375 | 3300053158 | Bacteria | 846 |
| 415 | Ga0500611_081864 | 3300053727 | Bacteria | 807 |
| 416 | Ga0501084_0004442 | 3300054114 | Bacteria | 11449 |
| 417 | Ga0501084_0009361 | 3300054114 | Bacteria | 8104 |
| 418 | Ga0501084_0161447 | 3300054114 | Bacteria | 1891 |
| 419 | Ga0501084_0446945 | 3300054114 | Bacteria | 1093 |
| 420 | Ga0501084_0511300 | 3300054114 | Bacteria | 1015 |
| 421 | Ga0501084_0596593 | 3300054114 | Bacteria | 933 |
| 422 | Ga0501084_0621273 | 3300054114 | Bacteria | 913 |
| 423 | Ga0587082_077044 | 3300059504 | Bacteria | 688 |
| 424 | Ga0587083_0024615 | 3300059505 | Bacteria | 1147 |
| 425 | Ga0587085_056080 | 3300059506 | Bacteria | 732 |
| 426 | Ga0587088_129452 | 3300059508 | Bacteria | 592 |
| 427 | Ga0587091_040408 | 3300059511 | Bacteria | 917 |
| 428 | Ga0587092_071860 | 3300059512 | Bacteria | 668 |
| 429 | Ga0587101_023349 | 3300059623 | Bacteria | 910 |
| 430 | Ga0587115_011953 | 3300059626 | Bacteria | 1102 |
| 431 | Ga0587069_025293 | 3300059642 | Bacteria | 922 |
| 432 | Ga0587075_027692 | 3300059644 | Bacteria | 884 |
| 433 | Ga0587076_033711 | 3300059645 | Bacteria | 922 |
| 434 | Ga0587079_016804 | 3300059647 | Bacteria | 1261 |
| 435 | Ga0587107_010486 | 3300059652 | Bacteria | 1116 |
| 436 | Ga0587107_043386 | 3300059652 | Bacteria | 736 |
| 437 | Ga0587110_010586 | 3300059654 | Bacteria | 924 |
| 438 | Ga0587111_0081452 | 3300060346 | Bacteria | 774 |
| 439 | Ga0587111_0136797 | 3300060346 | Bacteria | 646 |
| 440 | Ga0501082_0013544 | 3300060353 | Bacteria | 7006 |
| 441 | Ga0501082_0087731 | 3300060353 | Bacteria | 2684 |
| 442 | Ga0501082_0123657 | 3300060353 | Bacteria | 2243 |
| 443 | Ga0501082_0367326 | 3300060353 | Bacteria | 1255 |
| 444 | Ga0501082_0662309 | 3300060353 | Bacteria | 914 |
| 445 | Ga0501082_1243415 | 3300060353 | Bacteria | 651 |
| 446 | Ga0530510_0001837 | 3300061734 | Bacteria | 14507 |
| 447 | Ga0530510_0023810 | 3300061734 | Bacteria | 4365 |
| 448 | Ga0530510_0042078 | 3300061734 | Bacteria | 3299 |
| 449 | Ga0530510_0119881 | 3300061734 | Bacteria | 1930 |
| 450 | Ga0530510_0175057 | 3300061734 | Bacteria | 1590 |
| 451 | 2503201982 | 2503198000 | Bacteria | 6884444 |
| 452 | 2509115968 | 2508501123 | Bacteria | 6283661 |
| 453 | 2509141684 | 2508501127 | Bacteria | 7037543 |
| 454 | 2509371161 | 2509276018 | Bacteria | 6910194 |
| 455 | 2509396652 | 2509276022 | Bacteria | 6200534 |
| 456 | 2510313746 | 2510065059 | Bacteria | 6847884 |
| 457 | 2512931126 | 2512875016 | Bacteria | 6529530 |
| 458 | 2512958937 | 2512875024 | Bacteria | 7195110 |
| 459 | 2513610909 | 2513237090 | Bacteria | 7096802 |
| 460 | 2514038219 | 2513237164 | Bacteria | 7563725 |
| 461 | 2514420228 | 2513237305 | Bacteria | 7293571 |
| 462 | 2588516900 | 2588253730 | Bacteria | 6881675 |
| 463 | 2597814356 | 2597489875 | Bacteria | 7010078 |
| 464 | 2599938381 | 2599185301 | Bacteria | 6161860 |
| 465 | 2643775270 | 2643221551 | Bacteria | 3750538 |
| 466 | 2643793716 | 2643221555 | Bacteria | 3749717 |
| 467 | 2643985809 | 2643221595 | Bacteria | 6565519 |
| 468 | 2644129058 | 2643221623 | Bacteria | 5239945 |
| 469 | 2644158423 | 2643221627 | Bacteria | 6761570 |
| 470 | 2688598804 | 2687453392 | Bacteria | 6880454 |
| 471 | 2723575744 | 2721755686 | Bacteria | 7343952 |
| 472 | 2739308169 | 2738543024 | Bacteria | 5603683 |
| 473 | 2756675663 | 2756170246 | Bacteria | 7451806 |
| 474 | 2770196696 | 2767802442 | Bacteria | 5747986 |
| 475 | 2776272728 | 2775506902 | Bacteria | 6208009 |
| 476 | 2776284671 | 2775506904 | Bacteria | 5954060 |
| 477 | 2792749618 | 2791355123 | Bacteria | 8049106 |
| 478 | 2837680566 | 2837678835 | Bacteria | 5252418 |
| 479 | 2840769519 | 2840764183 | Bacteria | 6358399 |
| 480 | 2841739651 | 2841734538 | Bacteria | 6784580 |
| 481 | 2844006167 | 2844002411 | Bacteria | 7168230 |
| 482 | 2844014145 | 2844009547 | Bacteria | 6728125 |
| 483 | 2856325616 | 2856320880 | Bacteria | 7263508 |
| 484 | 2856331464 | 2856328259 | Bacteria | 6528202 |
| 485 | 2856339054 | 2856334872 | Bacteria | 7037011 |
| 486 | 2856347941 | 2856342000 | Bacteria | 7176905 |
| 487 | 2856352891 | 2856349417 | Bacteria | 6230045 |
| 488 | 2856358725 | 2856356410 | Bacteria | 6297484 |
| 489 | 2857350725 | 2857349434 | Bacteria | 7926032 |
| 490 | 2857370750 | 2857367948 | Bacteria | 6965560 |
| 491 | 2869167610 | 2869162929 | Bacteria | 6399702 |
| 492 | 2869173229 | 2869169390 | Bacteria | 6659796 |
| 493 | 2869234966 | 2869234852 | Bacteria | 6654993 |
| 494 | 2869249504 | 2869242130 | Bacteria | 6609239 |
| 495 | 2869250865 | 2869249662 | Bacteria | 6868783 |
| 496 | 2869262117 | 2869256925 | Bacteria | 6981691 |
| 497 | 2869270449 | 2869264136 | Bacteria | 6880765 |
| 498 | 2869272124 | 2869271264 | Bacteria | 6908218 |
| 499 | 2869279240 | 2869278585 | Bacteria | 7077053 |
| 500 | 2871443462 | 2871435913 | Bacteria | 6880295 |
| 501 | 2871459114 | 2871451962 | Bacteria | 7336357 |
| 502 | 2871466480 | 2871459585 | Bacteria | 6866887 |
| 503 | 2871468152 | 2871466892 | Bacteria | 6923287 |
| 504 | 2871480938 | 2871474448 | Bacteria | 6806570 |
| 505 | 2871485792 | 2871481445 | Bacteria | 6700002 |
| 506 | 2871491344 | 2871488783 | Bacteria | 6929816 |
| 507 | 2871502894 | 2871495908 | Bacteria | 6935695 |
| 508 | 2874114400 | 2874109183 | Bacteria | 6517025 |
| 509 | 2874119313 | 2874116593 | Bacteria | 6674494 |
| 510 | 2874123693 | 2874123672 | Bacteria | 7238285 |
| 511 | 2874134715 | 2874131515 | Bacteria | 6820270 |
| 512 | 2874144986 | 2874139085 | Bacteria | 7021506 |
| 513 | 2874166222 | 2874162495 | Bacteria | 6174670 |
| 514 | 2874174430 | 2874168670 | Bacteria | 8062617 |
| 515 | 2876365617 | 2876363079 | Bacteria | 6544991 |
| 516 | 2876370572 | 2876369609 | Bacteria | 6807521 |
| 517 | 2876387131 | 2876386047 | Bacteria | 6698674 |
| 518 | 2876406011 | 2876399893 | Bacteria | 6927900 |
| 519 | 2876407568 | 2876406927 | Bacteria | 6191900 |
| 520 | 2878731969 | 2878730984 | Bacteria | 6380721 |
| 521 | 2878745623 | 2878738818 | Bacteria | 7136951 |
| 522 | 2878757779 | 2878753008 | Bacteria | 6922523 |
| 523 | 2878766786 | 2878760144 | Bacteria | 6823465 |
| 524 | 2878773983 | 2878767105 | Bacteria | 6898628 |
| 525 | 2878777173 | 2878774303 | Bacteria | 6108671 |
| 526 | 2878782462 | 2878781027 | Bacteria | 6834456 |
| 527 | 2878791685 | 2878788777 | Bacteria | 6567085 |
| 528 | 2881151881 | 2881147464 | Bacteria | 7779814 |
| 529 | 2881155666 | 2881155292 | Bacteria | 6461656 |
| 530 | 2881167885 | 2881161766 | Bacteria | 7127907 |
| 531 | 2881849790 | 2881845957 | Bacteria | 6611900 |
| 532 | 2881854077 | 2881853255 | Bacteria | 6698367 |
| 533 | 2881864473 | 2881861095 | Bacteria | 7128710 |
| 534 | 2882635637 | 2882632389 | Bacteria | 8154593 |
| 535 | 2882915248 | 2882912400 | Bacteria | 6801539 |
| 536 | 2885309784 | 2885305155 | Bacteria | 7348390 |
| 537 | 2885317611 | 2885312484 | Bacteria | 6415165 |
| 538 | 2885321526 | 2885318864 | Bacteria | 6729568 |
| 539 | 2885328973 | 2885326080 | Bacteria | 7134805 |
| 540 | 2885338307 | 2885334103 | Bacteria | 7216818 |
| 541 | 2885345245 | 2885342637 | Bacteria | 7011821 |
| 542 | 2885351728 | 2885350715 | Bacteria | 6787678 |
| 543 | 2888339793 | 2888337043 | Bacteria | 6629336 |
| 544 | 2888347191 | 2888343758 | Bacteria | 6611049 |
| 545 | 2888356120 | 2888350351 | Bacteria | 7372807 |
| 546 | 2889017257 | 2889016732 | Bacteria | 6700763 |
| 547 | 2903455404 | 2903448605 | Bacteria | 7357801 |
| 548 | 2903506454 | 2903492973 | Bacteria | 13473544 |
| 549 | 2903520231 | 2903513507 | Bacteria | 6344008 |
| 550 | 2903523546 | 2903521522 | Bacteria | 6525694 |
| 551 | 2903534180 | 2903528002 | Bacteria | 6586099 |
| 552 | 2903548033 | 2903540706 | Bacteria | 7062119 |
| 553 | 2904579245 | 2904578770 | Bacteria | 5302906 |
| 554 | 2904661218 | 2904659560 | Bacteria | 6685615 |
| 555 | 2906367724 | 2906363423 | Bacteria | 6856682 |
| 556 | 2906371495 | 2906370794 | Bacteria | 6881062 |
| 557 | 2906382784 | 2906378014 | Bacteria | 6911440 |
| 558 | 2906390995 | 2906386501 | Bacteria | 5977019 |
| 559 | 2906396760 | 2906393657 | Bacteria | 6790866 |
| 560 | 2906405296 | 2906401398 | Bacteria | 6693206 |
| 561 | 2906412097 | 2906408224 | Bacteria | 6162342 |
| 562 | 2906434612 | 2906427513 | Bacteria | 6375796 |
| 563 | 2919121929 | 2919119836 | Bacteria | 5208557 |
| 564 | 2922137072 | 2922130491 | Bacteria | 7173936 |
| 565 | 2922155636 | 2922151315 | Bacteria | 6902399 |
| 566 | 2922177475 | 2922172374 | Bacteria | 6167644 |
| 567 | 2924713689 | 2924710171 | Bacteria | 6752351 |
| 568 | 2924721308 | 2924718760 | Bacteria | 6331356 |
| 569 | 2924739350 | 2924733363 | Bacteria | 7574837 |
| 570 | 2924743765 | 2924741084 | Bacteria | 6661321 |
| 571 | 2924748518 | 2924748358 | Bacteria | 6154725 |
| 572 | 2924762420 | 2924754689 | Bacteria | 6774424 |
| 573 | 2924766790 | 2924762789 | Bacteria | 6561353 |
| 574 | 2924783867 | 2924776078 | Bacteria | 7492003 |
| 575 | 2924785724 | 2924784321 | Bacteria | 7416538 |
| 576 | 2937824856 | 2937822353 | Bacteria | 7290551 |
| 577 | 2937838032 | 2937836603 | Bacteria | 6811263 |
| 578 | 2937844815 | 2937843397 | Bacteria | 5256375 |
| 579 | 2937855108 | 2937848649 | Bacteria | 6983481 |
| 580 | 2937862178 | 2937861824 | Bacteria | 6660327 |
| 581 | 2937873862 | 2937868953 | Bacteria | 6639878 |
| 582 | 2937877399 | 2937877337 | Bacteria | 7246526 |
| 583 | 2937975496 | 2937972304 | Bacteria | 7532020 |
| 584 | 2937984119 | 2937980651 | Bacteria | 6517427 |
| 585 | 2938001909 | 2937994558 | Bacteria | 7036190 |
| 586 | 2958035381 | 2958034702 | Bacteria | 6989922 |
| 587 | 2958043568 | 2958041894 | Bacteria | 13082850 |
| 588 | 2958067780 | 2958064165 | Bacteria | 7158582 |
| 589 | 2958072707 | 2958071322 | Bacteria | 6815895 |
| 590 | 2958084505 | 2958084443 | Bacteria | 7312792 |
| 591 | 2958096437 | 2958092219 | Bacteria | 6861151 |
| 592 | 2958104995 | 2958100919 | Bacteria | 6800575 |
| 593 | 2958110990 | 2958108152 | Bacteria | 6681128 |
| 594 | 2958125717 | 2958122699 | Bacteria | 7280457 |
| 595 | 2958143636 | 2958137437 | Bacteria | 6050276 |
| 596 | 2958147227 | 2958144490 | Bacteria | 6677056 |
| 597 | 2958163023 | 2958158011 | Bacteria | 6058449 |
| 598 | 2958171964 | 2958165035 | Bacteria | 6906348 |
| 599 | 2958175285 | 2958172287 | Bacteria | 6716688 |
| 600 | 2961116369 | 2961114664 | Bacteria | 6680456 |
| 601 | 2961132254 | 2961127735 | Bacteria | 7196641 |
| 602 | 2961144644 | 2961136820 | Bacteria | 6775228 |
| 603 | 2961170410 | 2961163497 | Bacteria | 6901077 |
| 604 | 2961174322 | 2961170736 | Bacteria | 7072258 |
| 605 | 2961189944 | 2961183825 | Bacteria | 6688536 |
| 606 | 2963648092 | 2963644680 | Bacteria | 6530403 |
| 607 | 2965025156 | 2965018300 | Bacteria | 6883036 |
| 608 | 2965026523 | 2965025482 | Bacteria | 6532201 |
| 609 | 2965035275 | 2965032056 | Bacteria | 6887443 |
| 610 | 2965040420 | 2965040258 | Bacteria | 6855979 |
| 611 | 2965055187 | 2965047637 | Bacteria | 6623551 |
| 612 | 2965094719 | 2965089291 | Bacteria | 6866420 |
| 613 | 2965107097 | 2965102966 | Bacteria | 6800987 |
| 614 | 2965114530 | 2965110997 | Bacteria | 6693150 |
| 615 | 2965122087 | 2965119406 | Bacteria | 6956431 |
| 616 | 2968000269 | 2967996073 | Bacteria | 6787468 |
| 617 | 2968005459 | 2968003550 | Bacteria | 6929263 |
| 618 | 2968018073 | 2968016561 | Bacteria | 7022047 |
| 619 | 2968090914 | 2968083720 | Bacteria | 7351627 |
| 620 | 2968112275 | 2968110612 | Bacteria | 6814636 |
| 621 | 2968121039 | 2968117919 | Bacteria | 6536078 |
| 622 | 2968139506 | 2968138860 | Bacteria | 6605449 |
| 623 | 2968178797 | 2968171901 | Bacteria | 6894245 |
| 624 | 2970471752 | 2970469710 | Bacteria | 6969209 |
| 625 | 2970495707 | 2970489779 | Bacteria | 6517260 |
| 626 | 2970506909 | 2970503327 | Bacteria | 7099517 |
| 627 | 2970512828 | 2970510686 | Bacteria | 7006402 |
| 628 | 2970530691 | 2970524798 | Bacteria | 6840927 |
| 629 | 2970533683 | 2970532167 | Bacteria | 6553173 |
| 630 | 2970554702 | 2970547951 | Bacteria | 6931819 |
| 631 | 2970561642 | 2970554993 | Bacteria | 6814252 |
| 632 | 2970593836 | 2970593180 | Bacteria | 7073582 |
| 633 | 2970619732 | 2970619444 | Bacteria | 6986144 |
| 634 | 2970633054 | 2970627176 | Bacteria | 6680862 |
| 635 | 2977822311 | 2977821940 | Bacteria | 6906439 |
| 636 | 2977833295 | 2977828996 | Bacteria | 7007971 |
| 637 | 2977855128 | 2977851361 | Bacteria | 6694324 |
| 638 | 2977867886 | 2977864932 | Bacteria | 7534097 |
| 639 | 2977875144 | 2977872689 | Bacteria | 7270173 |
| 640 | 2977901593 | 2977898635 | Bacteria | 6675551 |
| 641 | 2977907477 | 2977907340 | Bacteria | 6577984 |
| 642 | 2977917264 | 2977915119 | Bacteria | 6829656 |
| 643 | 2977929222 | 2977922695 | Bacteria | 6956781 |
| 644 | 2977940422 | 2977935797 | Bacteria | 6252826 |
| 645 | 2977947580 | 2977942078 | Bacteria | 7570577 |
| 646 | 2977955205 | 2977950692 | Bacteria | 6893264 |
| 647 | 2977961714 | 2977957713 | Bacteria | 6877875 |
| 648 | 2977974290 | 2977971508 | Bacteria | 7472917 |
| 649 | 2977986811 | 2977986579 | Bacteria | 6581278 |
| 650 | 2979710488 | 2979710463 | Bacteria | 6785254 |
| 651 | 2979775230 | 2979772303 | Bacteria | 6618277 |
| 652 | 2979799132 | 2979793036 | Bacteria | 6808957 |
| 653 | 2979812104 | 2979808191 | Bacteria | 7179355 |
| 654 | 2987637909 | 2987636660 | Bacteria | 8088555 |
| 655 | 2987646796 | 2987645492 | Bacteria | 6117018 |
| 656 | 2987659397 | 2987652177 | Bacteria | 6969023 |
| 657 | 2987666651 | 2987659509 | Bacteria | 6966464 |
| 658 | 2987668868 | 2987666974 | Bacteria | 6509233 |
| 659 | 2987674547 | 2987673487 | Bacteria | 6884027 |
| 660 | 2996310634 | 2996310559 | Bacteria | 6357320 |
| 661 | 2996350537 | 2996348954 | Bacteria | 7239054 |
| 662 | 2996389344 | 2996386984 | Bacteria | 6978667 |
| 663 | 3000140232 | 3000135777 | Bacteria | 6891109 |
| 664 | 3004169298 | 3004167301 | Bacteria | 8330599 |
| 665 | 3004195653 | 3004188549 | Bacteria | 6952365 |
| 666 | 3004197586 | 3004195979 | Bacteria | 6776956 |
| 667 | 3004205769 | 3004203850 | Bacteria | 7307914 |
| 668 | 3004216333 | 3004211236 | Bacteria | 7417683 |
| 669 | 3004224083 | 3004218560 | Bacteria | 7421728 |
| 670 | 3004238921 | 3004232784 | Bacteria | 6662140 |
| 671 | 3004243770 | 3004239961 | Bacteria | 6892290 |
| 672 | 3004251253 | 3004248173 | Bacteria | 6563236 |
| 673 | 3004268901 | 3004268573 | Bacteria | 7043476 |
| 674 | 3004277235 | 3004275668 | Bacteria | 7114440 |
| 675 | 3004297096 | 3004289098 | Bacteria | 6135450 |
| 676 | 3004341325 | 3004334049 | Bacteria | 8449246 |
| 677 | 637074228 | 637000159 | Bacteria | 7596297 |
| 678 | 649873322 | 649633066 | Bacteria | 6690028 |
| 679 | 8002288718 | 8002285264 | Bacteria | 6717907 |
| 680 | 8004301859 | 8004300914 | Bacteria | 6132239 |
| 681 | 8004366482 | 8004361976 | Bacteria | 6858373 |
| 682 | 8004379290 | 8004374579 | Bacteria | 6898112 |
| 683 | 8004400661 | 8004395343 | Bacteria | 6620908 |
| 684 | 8004635986 | 8004633249 | Bacteria | 6723080 |
| 685 | 8004696028 | 8004695233 | Bacteria | 6731676 |
| 686 | 8004731025 | 8004727605 | Bacteria | 6643904 |
| 687 | 8045866361 | 8045864390 | Bacteria | 5043873 |
| 688 | 8055621179 | 8055617313 | Bacteria | 7548464 |
| 689 | Ga0496121_0147665 | |||
| 690 | JGI24740J21852_10064788 | |||
| 691 | JGI24739J22299_10014828 | |||
| 692 | JGI24735J21928_10011175 | |||
| 693 | JGI25156J39149_1002644 | |||
| 694 | JGI25157J39369_1001346 | |||
| 695 | JGI25165J46597_1000062 | |||
| 696 | Ga0055542_1001266 | |||
| 697 | Ga0055529_1006508 | |||
| 698 | Ga0058861_11805547 | |||
| 699 | Ga0058862_12721942 | |||
| 700 | Ga0065715_10097255 | |||
| 701 | Ga0070680_101061223 | |||
| 702 | Ga0070689_100731063 | |||
| 703 | Ga0070692_10346483 | |||
| 704 | Ga0070669_100091100 | |||
| 705 | Ga0070674_100107055 | |||
| 706 | Ga0070674_100279852 | |||
| 707 | Ga0070705_100757949 | |||
| 708 | Ga0070700_100080308 | |||
| 709 | Ga0070694_100009095 | |||
| 710 | Ga0070694_101139418 | |||
| 711 | Ga0070708_100057280 | |||
| 712 | Ga0070708_101744918 | |||
| 713 | Ga0070678_101087896 | |||
| 714 | Ga0070681_10014884 | |||
| 715 | Ga0070706_100106712 | |||
| 716 | Ga0070706_100457319 | |||
| 717 | Ga0070698_100002853 | |||
| 718 | Ga0070698_100025196 | |||
| 719 | Ga0070698_100110063 | |||
| 720 | Ga0070698_101316893 | |||
| 721 | Ga0070699_100092658 | |||
| 722 | Ga0070679_100667647 | |||
| 723 | Ga0070697_100030341 | |||
| 724 | Ga0070697_100067712 | |||
| 725 | Ga0070697_100165469 | |||
| 726 | Ga0070697_101049859 | |||
| 727 | Ga0068853_100065114 | |||
| 728 | Ga0070696_100156609 | |||
| 729 | Ga0070696_100366916 | |||
| 730 | Ga0070693_100008042 | |||
| 731 | Ga0070665_100041861 | |||
| 732 | Ga0070665_100043662 | |||
| 733 | Ga0070665_100064070 | |||
| 734 | Ga0070665_101171630 | |||
| 735 | Ga0068854_100562741 | |||
| 736 | Ga0068856_100134232 | |||
| 737 | Ga0068861_100148516 | |||
| 738 | Ga0068851_10288643 | |||
| 739 | Ga0068858_100344410 | |||
| 740 | Ga0081538_10009385 | |||
| 741 | Ga0075365_10089845 | |||
| 742 | Ga0075365_10135178 | |||
| 743 | Ga0075365_10334779 | |||
| 744 | Ga0075365_10405263 | |||
| 745 | Ga0075368_10034700 | |||
| 746 | Ga0075364_10181464 | |||
| 747 | Ga0075364_10214201 | |||
| 748 | Ga0075362_10118906 | |||
| 749 | Ga0075362_10168749 | |||
| 750 | Ga0075367_10133011 | |||
| 751 | Ga0075367_10141805 | |||
| 752 | Ga0075369_10087008 | |||
| 753 | Ga0075370_10131075 | |||
| 754 | Ga0075370_10250995 | |||
| 755 | Ga0075370_10346932 | |||
| 756 | Ga0075431_100289073 | |||
| 757 | Ga0075433_10996785 | |||
| 758 | Ga0068865_100037200 | |||
| 759 | Ga0075436_100125898 | |||
| 760 | Ga0105240_10415232 | |||
| 761 | Ga0111539_10000450 | |||
| 762 | Ga0111539_10927080 | |||
| 763 | Ga0114129_10034451 | |||
| 764 | Ga0114129_10110234 | |||
| 765 | Ga0114129_10374450 | |||
| 766 | Ga0114129_10401447 | |||
| 767 | Ga0105243_10101828 | |||
| 768 | Ga0105243_11420061 | |||
| 769 | Ga0105241_10991092 | |||
| 770 | Ga0105248_12254825 | |||
| 771 | Ga0105237_10024376 | |||
| 772 | Ga0105238_10180783 | |||
| 773 | Ga0105239_10257567 | |||
| 774 | Ga0157342_1047517 | |||
| 775 | Ga0157370_10430015 | |||
| 776 | Ga0157370_10633704 | |||
| 777 | Ga0157369_10837934 | |||
| 778 | Ga0157369_11090122 | |||
| 779 | Ga0157374_10622684 | |||
| 780 | Ga0157380_10004196 | |||
| 781 | Ga0157380_10133039 | |||
| 782 | Ga0157380_11278582 | |||
| 783 | Ga0182008_10268174 | |||
| 784 | Ga0182007_10023438 | |||
| 785 | Ga0163161_10292737 | |||
| 786 | Ga0197907_10124309 | |||
| 787 | Ga0197907_11226427 | |||
| 788 | Ga0197907_11342124 | |||
| 789 | Ga0206356_11056185 | |||
| 790 | Ga0206356_11207831 | |||
| 791 | Ga0206349_1098660 | |||
| 792 | Ga0206349_1760105 | |||
| 793 | Ga0206351_10637505 | |||
| 794 | Ga0206352_10701579 | |||
| 795 | Ga0206352_10884132 | |||
| 796 | Ga0206352_11228637 | |||
| 797 | Ga0206350_10105058 | |||
| 798 | Ga0206350_10743522 | |||
| 799 | Ga0206350_11542253 | |||
| 800 | Ga0206354_10066698 | |||
| 801 | Ga0206354_10193729 | |||
| 802 | Ga0206353_10922145 | |||
| 803 | Ga0154015_1280372 | |||
| 804 | Ga0213872_10061838 | |||
| 805 | Ga0224712_10002715 | |||
| 806 | Ga0224712_10002727 | |||
| 807 | Ga0224712_10016180 | |||
| 808 | Ga0224712_10105504 | |||
| 809 | Ga0224712_10249105 | |||
| 810 | Ga0209026_1000024 | |||
| 811 | Ga0209677_111985 | |||
| 812 | Ga0209148_1000050 | |||
| 813 | Ga0209759_1000289 | |||
| 814 | Ga0209233_1000129 | |||
| 815 | Ga0209233_1013228 | |||
| 816 | Ga0209455_1000183 | |||
| 817 | Ga0207647_10037520 | |||
| 818 | Ga0207684_10041034 | |||
| 819 | Ga0207684_10043414 | |||
| 820 | Ga0207684_11040852 | |||
| 821 | Ga0207707_10010340 | |||
| 822 | Ga0207695_10689271 | |||
| 823 | Ga0207671_10133686 | |||
| 824 | Ga0207660_11272905 | |||
| 825 | Ga0207657_10034393 | |||
| 826 | Ga0207652_10713211 | |||
| 827 | Ga0207646_10141344 | |||
| 828 | Ga0207646_10233771 | |||
| 829 | Ga0207694_10031517 | |||
| 830 | Ga0207694_10445716 | |||
| 831 | Ga0207687_10807714 | |||
| 832 | Ga0207709_11114380 | |||
| 833 | Ga0207709_11145784 | |||
| 834 | Ga0207669_10451457 | |||
| 835 | Ga0207669_11197734 | |||
| 836 | Ga0207639_10008683 | |||
| 837 | Ga0207639_10242935 | |||
| 838 | Ga0207639_11706185 | |||
| 839 | Ga0207678_10185917 | |||
| 840 | Ga0207702_10154388 | |||
| 841 | Ga0207648_11230546 | |||
| 842 | Ga0207674_10369080 | |||
| 843 | Ga0207675_100105630 | |||
| 844 | Ga0207683_11068247 | |||
| 845 | Ga0268266_10030881 | |||
| 846 | Ga0268266_10039504 | |||
| 847 | Ga0268266_10436949 | |||
| 848 | Ga0307513_10337380 | |||
| 849 | Ga0307410_10840834 | |||
| 850 | Ga0307412_10468316 | |||
| 851 | Ga0373941_0016682 | |||
| 852 | Ga0373931_0422086 | |||
| 853 | Ga0395899_0119213 | |||
| 854 | Ga0395899_0273712 | |||
| 855 | Ga0395900_0052146 | |||
| 856 | Ga0395900_0111364 | |||
| 857 | Ga0395900_0156874 | |||
| 858 | Ga0395900_0778026 | |||
| 859 | Ga0395898_0022662 | |||
| 860 | Ga0395898_0061507 | |||
| 861 | Ga0395898_0063070 | |||
| 862 | Ga0395905_0044789 | |||
| 863 | Ga0395905_0234522 | |||
| 864 | Ga0395905_0648471 | |||
| 865 | Ga0395901_0013973 | |||
| 866 | Ga0395901_0117423 | |||
| 867 | Ga0395901_0161809 | |||
| 868 | Ga0395901_0166901 | |||
| 869 | Ga0395901_0265872 | |||
| 870 | Ga0395901_0593893 | |||
| 871 | Ga0451791_1360050 | |||
| 872 | Ga0439431_0019847 | |||
| 873 | Ga0439448_0187248 | |||
| 874 | Ga0451576_0058529 | |||
| 875 | Ga0495627_038669 | |||
| 876 | Ga0495638_0017935 | |||
| 877 | Ga0495620_0189897 | |||
| 878 | Ga0495648_0317963 | |||
| 879 | Ga0495597_0079787 | |||
| 880 | Ga0495668_0039427 | |||
| 881 | Ga0495660_0098746 | |||
| 882 | Ga0495687_160665 | |||
| 883 | Ga0495686_0319616 | |||
| 884 | Ga0496102_1057906 | |||
| 885 | Ga0496104_0331212 | |||
| 886 | Ga0496109_0380300 | |||
| 887 | Ga0496110_0634193 | |||
| 888 | Ga0496112_0039529 | |||
| 889 | Ga0496113_0166196 | |||
| 890 | Ga0496113_0371575 | |||
| 891 | Ga0496115_0503092 | |||
| 892 | Ga0496119_0030542 | |||
| 893 | Ga0496119_0113749 | |||
| 894 | Ga0496119_0256233 | |||
| 895 | Ga0496120_0004963 | |||
| 896 | Ga0496121_0571813 | |||
| 897 | Ga0496124_0098047 | |||
| 898 | Ga0496124_0123256 | |||
| 899 | Ga0496125_0200317 | |||
| 900 | Ga0496126_0362821 | |||
| 901 | Ga0501293_002557 | |||
| 902 | Ga0501295_033034 | |||
| 903 | Ga0501300_010870 | |||
| 904 | Ga0501031_0001036 | |||
| 905 | Ga0501031_0017658 | |||
| 906 | Ga0501031_0328609 | |||
| 907 | Ga0501032_0005372 | |||
| 908 | Ga0501032_0052466 | |||
| 909 | Ga0501033_0003811 | |||
| 910 | Ga0501033_0005756 | |||
| 911 | Ga0501033_0034364 | |||
| 912 | Ga0501033_0076490 | |||
| 913 | Ga0501033_0109313 | |||
| 914 | Ga0501033_0395412 | |||
| 915 | Ga0501034_0011047 | |||
| 916 | Ga0501034_0057496 | |||
| 917 | Ga0501034_0146233 | |||
| 918 | Ga0501034_0218981 | |||
| 919 | Ga0501036_0071225 | |||
| 920 | Ga0501036_0175309 | |||
| 921 | Ga0501036_0187039 | |||
| 922 | Ga0501036_1136338 | |||
| 923 | Ga0501037_0000576 | |||
| 924 | Ga0501037_0091076 | |||
| 925 | Ga0501037_0110082 | |||
| 926 | Ga0501037_0718008 | |||
| 927 | Ga0501038_0049367 | |||
| 928 | Ga0501038_0074520 | |||
| 929 | Ga0501038_0076656 | |||
| 930 | Ga0501038_0151833 | |||
| 931 | Ga0501038_0253227 | |||
| 932 | Ga0501038_0318708 | |||
| 933 | Ga0501038_0384127 | |||
| 934 | Ga0501039_0008358 | |||
| 935 | Ga0501039_0010688 | |||
| 936 | Ga0501039_0324021 | |||
| 937 | Ga0501039_0336769 | |||
| 938 | Ga0501040_0022938 | |||
| 939 | Ga0501040_0025361 | |||
| 940 | Ga0501040_0127097 | |||
| 941 | Ga0501040_0127552 | |||
| 942 | Ga0501041_0001880 | |||
| 943 | Ga0501041_0040036 | |||
| 944 | Ga0501041_0092702 | |||
| 945 | Ga0501042_0001688 | |||
| 946 | Ga0501042_0005416 | |||
| 947 | Ga0501042_0048982 | |||
| 948 | Ga0501042_0063056 | |||
| 949 | Ga0501042_0302891 | |||
| 950 | Ga0501042_0344826 | |||
| 951 | Ga0501043_0000003 | |||
| 952 | Ga0501043_0032313 | |||
| 953 | Ga0501043_0045424 | |||
| 954 | Ga0501043_0092021 | |||
| 955 | Ga0501043_0132140 | |||
| 956 | Ga0501043_0302736 | |||
| 957 | Ga0501043_0723681 | |||
| 958 | Ga0501043_0798204 | |||
| 959 | Ga0501046_0007394 | |||
| 960 | Ga0501046_0046307 | |||
| 961 | Ga0501047_0033716 | |||
| 962 | Ga0501047_0143080 | |||
| 963 | Ga0501048_0009800 | |||
| 964 | Ga0501048_0024115 | |||
| 965 | Ga0501048_0039499 | |||
| 966 | Ga0501048_0516922 | |||
| 967 | Ga0501048_0641649 | |||
| 968 | Ga0501048_1047308 | |||
| 969 | Ga0501067_0077897 | |||
| 970 | Ga0501067_0199752 | |||
| 971 | Ga0501068_0024760 | |||
| 972 | Ga0501068_0039081 | |||
| 973 | Ga0501068_0067377 | |||
| 974 | Ga0501068_0292617 | |||
| 975 | Ga0501069_0000002 | |||
| 976 | Ga0501069_0042915 | |||
| 977 | Ga0501070_0001802 | |||
| 978 | Ga0501070_0007664 | |||
| 979 | Ga0501070_0007959 | |||
| 980 | Ga0501070_0016488 | |||
| 981 | Ga0501070_0029326 | |||
| 982 | Ga0501070_0326293 | |||
| 983 | Ga0501070_0368124 | |||
| 984 | Ga0501070_0829014 | |||
| 985 | Ga0501071_0022311 | |||
| 986 | Ga0501071_0025187 | |||
| 987 | Ga0501071_0030465 | |||
| 988 | Ga0501071_0039344 | |||
| 989 | Ga0501071_0052714 | |||
| 990 | Ga0501071_0248063 | |||
| 991 | Ga0501071_0336757 | |||
| 992 | Ga0501071_1275181 | |||
| 993 | Ga0501072_0000982 | |||
| 994 | Ga0501072_0012750 | |||
| 995 | Ga0501072_0018194 | |||
| 996 | Ga0501072_0034015 | |||
| 997 | Ga0501072_0086673 | |||
| 998 | Ga0501072_0208273 | |||
| 999 | Ga0501072_0418584 | |||
| 1000 | Ga0501073_0027300 | |||
| 1001 | Ga0501073_0033052 | |||
| 1002 | Ga0501073_0040923 | |||
| 1003 | Ga0501073_0365271 | |||
| 1004 | Ga0501073_0675776 | |||
| 1005 | Ga0501074_0000032 | |||
| 1006 | Ga0501074_0000851 | |||
| 1007 | Ga0501074_0012237 | |||
| 1008 | Ga0501074_0043232 | |||
| 1009 | Ga0501074_0522108 | |||
| 1010 | Ga0501074_0816867 | |||
| 1011 | Ga0501074_0869907 | |||
| 1012 | Ga0501075_0000787 | |||
| 1013 | Ga0501075_0010423 | |||
| 1014 | Ga0501075_0129671 | |||
| 1015 | Ga0501075_0131873 | |||
| 1016 | Ga0501076_0006027 | |||
| 1017 | Ga0501076_0010286 | |||
| 1018 | Ga0501076_0060385 | |||
| 1019 | Ga0501076_0223962 | |||
| 1020 | Ga0501076_0406631 | |||
| 1021 | Ga0501077_0003632 | |||
| 1022 | Ga0501077_0006047 | |||
| 1023 | Ga0501206_012416 | |||
| 1024 | Ga0501216_014581 | |||
| 1025 | Ga0501223_005682 | |||
| 1026 | Ga0501227_038883 | |||
| 1027 | Ga0501233_027770 | |||
| 1028 | Ga0501235_019232 | |||
| 1029 | Ga0501236_003070 | |||
| 1030 | Ga0501240_004463 | |||
| 1031 | Ga0501259_043095 | |||
| 1032 | Ga0501221_020518 | |||
| 1033 | Ga0501225_0017522 | |||
| 1034 | Ga0501234_012783 | |||
| 1035 | Ga0501079_0003219 | |||
| 1036 | Ga0501079_0007239 | |||
| 1037 | Ga0501079_0047191 | |||
| 1038 | Ga0501079_0083119 | |||
| 1039 | Ga0501079_0321329 | |||
| 1040 | Ga0501079_0357250 | |||
| 1041 | Ga0501079_1323552 | |||
| 1042 | Ga0501080_0037624 | |||
| 1043 | Ga0501080_0041559 | |||
| 1044 | Ga0501080_0052011 | |||
| 1045 | Ga0501080_0056672 | |||
| 1046 | Ga0501080_0364786 | |||
| 1047 | Ga0501080_0828143 | |||
| 1048 | Ga0501081_0001400 | |||
| 1049 | Ga0501081_0008846 | |||
| 1050 | Ga0501083_0000819 | |||
| 1051 | Ga0501083_0057426 | |||
| 1052 | Ga0501083_0218961 | |||
| 1053 | Ga0501270_082628 | |||
| 1054 | Ga0501035_0000200 | |||
| 1055 | Ga0501035_0002238 | |||
| 1056 | Ga0501035_0006427 | |||
| 1057 | Ga0501035_0009362 | |||
| 1058 | Ga0501035_0015417 | |||
| 1059 | Ga0501035_0075807 | |||
| 1060 | Ga0501035_0106172 | |||
| 1061 | Ga0501035_0240194 | |||
| 1062 | Ga0501035_0384171 | |||
| 1063 | Ga0501035_0503052 | |||
| 1064 | Ga0501044_0000161 | |||
| 1065 | Ga0501044_0007571 | |||
| 1066 | Ga0501044_0027442 | |||
| 1067 | Ga0501044_0029646 | |||
| 1068 | Ga0501044_0037813 | |||
| 1069 | Ga0501044_0042305 | |||
| 1070 | Ga0501044_0100148 | |||
| 1071 | Ga0501045_0008239 | |||
| 1072 | Ga0501045_0011570 | |||
| 1073 | Ga0501045_0014178 | |||
| 1074 | Ga0501045_0237306 | |||
| 1075 | Ga0501045_0642552 | |||
| 1076 | Ga0501045_1279980 | |||
| 1077 | Ga0501212_042753 | |||
| 1078 | nmdc:mga03683_53397_c1 | |||
| 1079 | nmdc:mga03n38_106034_c1 | |||
| 1080 | nmdc:mga03n38_88743_c1 | |||
| 1081 | nmdc:mga00v17_373548_c1 | |||
| 1082 | nmdc:mga0yw44_10873_c1 | |||
| 1083 | nmdc:mga0yw44_155916_c1 | |||
| 1084 | nmdc:mga0yw44_327230_c1 | |||
| 1085 | nmdc:mga0yw44_42700_c1 | |||
| 1086 | nmdc:mga0yw44_769041_c1 | |||
| 1087 | nmdc:mga06z11_135672_c2 | |||
| 1088 | nmdc:mga06z11_456663_c1 | |||
| 1089 | nmdc:mga06z11_49634_c1 | |||
| 1090 | nmdc:mga07m45_292746_c1 | |||
| 1091 | nmdc:mga07m45_54445_c1 | |||
| 1092 | nmdc:mga05p37_243316_c1 | |||
| 1093 | nmdc:mga05p37_420823_c1 | |||
| 1094 | nmdc:mga08y16_49163_c1 | |||
| 1095 | nmdc:mga0n895_1577480_c1 | |||
| 1096 | nmdc:mga08x19_288322_c1 | |||
| 1097 | nmdc:mga0sz30_17013_c1 | |||
| 1098 | nmdc:mga0sz30_51674_c1 | |||
| 1099 | Ga0500610_0129367 | |||
| 1100 | Ga0500568_0000059 | |||
| 1101 | Ga0500568_0106067 | |||
| 1102 | Ga0500627_0220375 | |||
| 1103 | Ga0500611_081864 | |||
| 1104 | Ga0501084_0004442 | |||
| 1105 | Ga0501084_0009361 | |||
| 1106 | Ga0501084_0161447 | |||
| 1107 | Ga0501084_0446945 | |||
| 1108 | Ga0501084_0511300 | |||
| 1109 | Ga0501084_0596593 | |||
| 1110 | Ga0501084_0621273 | |||
| 1111 | Ga0587082_077044 | |||
| 1112 | Ga0587083_0024615 | |||
| 1113 | Ga0587085_056080 | |||
| 1114 | Ga0587088_129452 | |||
| 1115 | Ga0587091_040408 | |||
| 1116 | Ga0587092_071860 | |||
| 1117 | Ga0587101_023349 | |||
| 1118 | Ga0587115_011953 | |||
| 1119 | Ga0587069_025293 | |||
| 1120 | Ga0587075_027692 | |||
| 1121 | Ga0587076_033711 | |||
| 1122 | Ga0587079_016804 | |||
| 1123 | Ga0587107_010486 | |||
| 1124 | Ga0587107_043386 | |||
| 1125 | Ga0587110_010586 | |||
| 1126 | Ga0587111_0081452 | |||
| 1127 | Ga0587111_0136797 | |||
| 1128 | Ga0501082_0013544 | |||
| 1129 | Ga0501082_0087731 | |||
| 1130 | Ga0501082_0123657 | |||
| 1131 | Ga0501082_0367326 | |||
| 1132 | Ga0501082_0662309 | |||
| 1133 | Ga0501082_1243415 | |||
| 1134 | Ga0530510_0001837 | |||
| 1135 | Ga0530510_0023810 | |||
| 1136 | Ga0530510_0042078 | |||
| 1137 | Ga0530510_0119881 | |||
| 1138 | Ga0530510_0175057 | |||
| 1139 | 2503201982 | |||
| 1140 | 2509115968 | |||
| 1141 | 2509141684 | |||
| 1142 | 2509371161 | |||
| 1143 | 2509396652 | |||
| 1144 | 2510313746 | |||
| 1145 | 2512931126 | |||
| 1146 | 2512958937 | |||
| 1147 | 2513610909 | |||
| 1148 | 2514038219 | |||
| 1149 | 2514420228 | |||
| 1150 | 2588516900 | |||
| 1151 | 2597814356 | |||
| 1152 | 2599938381 | |||
| 1153 | 2643775270 | |||
| 1154 | 2643793716 | |||
| 1155 | 2643985809 | |||
| 1156 | 2644129058 | |||
| 1157 | 2644158423 | |||
| 1158 | 2688598804 | |||
| 1159 | 2723575744 | |||
| 1160 | 2739308169 | |||
| 1161 | 2756675663 | |||
| 1162 | 2770196696 | |||
| 1163 | 2776272728 | |||
| 1164 | 2776284671 | |||
| 1165 | 2792749618 | |||
| 1166 | 2837680566 | |||
| 1167 | 2840769519 | |||
| 1168 | 2841739651 | |||
| 1169 | 2844006167 | |||
| 1170 | 2844014145 | |||
| 1171 | 2856325616 | |||
| 1172 | 2856331464 | |||
| 1173 | 2856339054 | |||
| 1174 | 2856347941 | |||
| 1175 | 2856352891 | |||
| 1176 | 2856358725 | |||
| 1177 | 2857350725 | |||
| 1178 | 2857370750 | |||
| 1179 | 2869167610 | |||
| 1180 | 2869173229 | |||
| 1181 | 2869234966 | |||
| 1182 | 2869249504 | |||
| 1183 | 2869250865 | |||
| 1184 | 2869262117 | |||
| 1185 | 2869270449 | |||
| 1186 | 2869272124 | |||
| 1187 | 2869279240 | |||
| 1188 | 2871443462 | |||
| 1189 | 2871459114 | |||
| 1190 | 2871466480 | |||
| 1191 | 2871468152 | |||
| 1192 | 2871480938 | |||
| 1193 | 2871485792 | |||
| 1194 | 2871491344 | |||
| 1195 | 2871502894 | |||
| 1196 | 2874114400 | |||
| 1197 | 2874119313 | |||
| 1198 | 2874123693 | |||
| 1199 | 2874134715 | |||
| 1200 | 2874144986 | |||
| 1201 | 2874166222 | |||
| 1202 | 2874174430 | |||
| 1203 | 2876365617 | |||
| 1204 | 2876370572 | |||
| 1205 | 2876387131 | |||
| 1206 | 2876406011 | |||
| 1207 | 2876407568 | |||
| 1208 | 2878731969 | |||
| 1209 | 2878745623 | |||
| 1210 | 2878757779 | |||
| 1211 | 2878766786 | |||
| 1212 | 2878773983 | |||
| 1213 | 2878777173 | |||
| 1214 | 2878782462 | |||
| 1215 | 2878791685 | |||
| 1216 | 2881151881 | |||
| 1217 | 2881155666 | |||
| 1218 | 2881167885 | |||
| 1219 | 2881849790 | |||
| 1220 | 2881854077 | |||
| 1221 | 2881864473 | |||
| 1222 | 2882635637 | |||
| 1223 | 2882915248 | |||
| 1224 | 2885309784 | |||
| 1225 | 2885317611 | |||
| 1226 | 2885321526 | |||
| 1227 | 2885328973 | |||
| 1228 | 2885338307 | |||
| 1229 | 2885345245 | |||
| 1230 | 2885351728 | |||
| 1231 | 2888339793 | |||
| 1232 | 2888347191 | |||
| 1233 | 2888356120 | |||
| 1234 | 2889017257 | |||
| 1235 | 2903455404 | |||
| 1236 | 2903506454 | |||
| 1237 | 2903520231 | |||
| 1238 | 2903523546 | |||
| 1239 | 2903534180 | |||
| 1240 | 2903548033 | |||
| 1241 | 2904579245 | |||
| 1242 | 2904661218 | |||
| 1243 | 2906367724 | |||
| 1244 | 2906371495 | |||
| 1245 | 2906382784 | |||
| 1246 | 2906390995 | |||
| 1247 | 2906396760 | |||
| 1248 | 2906405296 | |||
| 1249 | 2906412097 | |||
| 1250 | 2906434612 | |||
| 1251 | 2919121929 | |||
| 1252 | 2922137072 | |||
| 1253 | 2922155636 | |||
| 1254 | 2922177475 | |||
| 1255 | 2924713689 | |||
| 1256 | 2924721308 | |||
| 1257 | 2924739350 | |||
| 1258 | 2924743765 | |||
| 1259 | 2924748518 | |||
| 1260 | 2924762420 | |||
| 1261 | 2924766790 | |||
| 1262 | 2924783867 | |||
| 1263 | 2924785724 | |||
| 1264 | 2937824856 | |||
| 1265 | 2937838032 | |||
| 1266 | 2937844815 | |||
| 1267 | 2937855108 | |||
| 1268 | 2937862178 | |||
| 1269 | 2937873862 | |||
| 1270 | 2937877399 | |||
| 1271 | 2937975496 | |||
| 1272 | 2937984119 | |||
| 1273 | 2938001909 | |||
| 1274 | 2958035381 | |||
| 1275 | 2958043568 | |||
| 1276 | 2958067780 | |||
| 1277 | 2958072707 | |||
| 1278 | 2958084505 | |||
| 1279 | 2958096437 | |||
| 1280 | 2958104995 | |||
| 1281 | 2958110990 | |||
| 1282 | 2958125717 | |||
| 1283 | 2958143636 | |||
| 1284 | 2958147227 | |||
| 1285 | 2958163023 | |||
| 1286 | 2958171964 | |||
| 1287 | 2958175285 | |||
| 1288 | 2961116369 | |||
| 1289 | 2961132254 | |||
| 1290 | 2961144644 | |||
| 1291 | 2961170410 | |||
| 1292 | 2961174322 | |||
| 1293 | 2961189944 | |||
| 1294 | 2963648092 | |||
| 1295 | 2965025156 | |||
| 1296 | 2965026523 | |||
| 1297 | 2965035275 | |||
| 1298 | 2965040420 | |||
| 1299 | 2965055187 | |||
| 1300 | 2965094719 | |||
| 1301 | 2965107097 | |||
| 1302 | 2965114530 | |||
| 1303 | 2965122087 | |||
| 1304 | 2968000269 | |||
| 1305 | 2968005459 | |||
| 1306 | 2968018073 | |||
| 1307 | 2968090914 | |||
| 1308 | 2968112275 | |||
| 1309 | 2968121039 | |||
| 1310 | 2968139506 | |||
| 1311 | 2968178797 | |||
| 1312 | 2970471752 | |||
| 1313 | 2970495707 | |||
| 1314 | 2970506909 | |||
| 1315 | 2970512828 | |||
| 1316 | 2970530691 | |||
| 1317 | 2970533683 | |||
| 1318 | 2970554702 | |||
| 1319 | 2970561642 | |||
| 1320 | 2970593836 | |||
| 1321 | 2970619732 | |||
| 1322 | 2970633054 | |||
| 1323 | 2977822311 | |||
| 1324 | 2977833295 | |||
| 1325 | 2977855128 | |||
| 1326 | 2977867886 | |||
| 1327 | 2977875144 | |||
| 1328 | 2977901593 | |||
| 1329 | 2977907477 | |||
| 1330 | 2977917264 | |||
| 1331 | 2977929222 | |||
| 1332 | 2977940422 | |||
| 1333 | 2977947580 | |||
| 1334 | 2977955205 | |||
| 1335 | 2977961714 | |||
| 1336 | 2977974290 | |||
| 1337 | 2977986811 | |||
| 1338 | 2979710488 | |||
| 1339 | 2979775230 | |||
| 1340 | 2979799132 | |||
| 1341 | 2979812104 | |||
| 1342 | 2987637909 | |||
| 1343 | 2987646796 | |||
| 1344 | 2987659397 | |||
| 1345 | 2987666651 | |||
| 1346 | 2987668868 | |||
| 1347 | 2987674547 | |||
| 1348 | 2996310634 | |||
| 1349 | 2996350537 | |||
| 1350 | 2996389344 | |||
| 1351 | 3000140232 | |||
| 1352 | 3004169298 | |||
| 1353 | 3004195653 | |||
| 1354 | 3004197586 | |||
| 1355 | 3004205769 | |||
| 1356 | 3004216333 | |||
| 1357 | 3004224083 | |||
| 1358 | 3004238921 | |||
| 1359 | 3004243770 | |||
| 1360 | 3004251253 | |||
| 1361 | 3004268901 | |||
| 1362 | 3004277235 | |||
| 1363 | 3004297096 | |||
| 1364 | 3004341325 | |||
| 1365 | 637074228 | |||
| 1366 | 649873322 | |||
| 1367 | 8002288718 | |||
| 1368 | 8004301859 | |||
| 1369 | 8004366482 | |||
| 1370 | 8004379290 | |||
| 1371 | 8004400661 | |||
| 1372 | 8004635986 | |||
| 1373 | 8004696028 | |||
| 1374 | 8004731025 | |||
| 1375 | 8045866361 | |||
| 1376 | 8055621179 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9431 | 3 | 154 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9412 | 1 | 154 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9359 | 1 | 154 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.93 | 2 | 154 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9238 | 1 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9507 | 1 | 76 | 3.10.20.30 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9388 | 2 | 74 | 3.10.20.30 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9357 | 2 | 76 | 3.10.20.30 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9337 | 2 | 76 | 3.10.20.30 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9273 | 1 | 76 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q98L90-F1-model_v4 | Carbon-monoxide dehydrogenase small subunit | 0.9563 | 2 | 166 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1H0J689-F1-model_v4 | Carbon-monoxide dehydrogenase small subunit | 0.9512 | 1 | 160 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A543L6H0-F1-model_v4 | deleted | 0.9511 | 1 | 165 |
|
| AF-A0A2H5WER8-F1-model_v4 | Carbon monoxide dehydrogenase small chain (EC 1.2.5.3) | 0.9507 | 1 | 158 |
GO:0008805
GO:0046872 GO:0051537 |
| AF-A0A0S8C2C2-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9505 | 1 | 154 |
GO:0016491
GO:0046872 GO:0051537 |