F475352

General Info

Members Datasets Scaffolds Average Seq Length
688 513 1376 278

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_137914_c1|nmdc:mga0a205_137914_c1_1253_2245
Length 330
Sequence MAATTLFESRLLSVIDYRCTASPADRPFAESHERYSLAYVRKGSFGCRAHGESFDLVTGSLMVGYPGDEYVCTHEHHHGGDECLSFQLAPELVETIGGRTAPWRAGEVPPLAGLMVLGELAQATAENNAELGLDEVGVSLAARFVATVSGTARNARLPVDRRRAVEAAHWIDAHSGEDIDLDRIATAAGLSPFHFLRLFSGVLGVTPHQYLVRSRLRHAARLLAAGGQPITSIALDVGFGDLSNFVRTFHRAAGASPRTFRRTARGDRTVLRNRWPSLIKGSFSSRMSASGRDRWRRPSRAGRPGGPRSSAPSDRGIRPPTRARRQRADP

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
112 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
113 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
114 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
164 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
165 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
171 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
315 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
316 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
317 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
318 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
319 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
320 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
321 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
322 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
323 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
324 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
325 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
326 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
327 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
328 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
332 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
333 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
334 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
335 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
336 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
337 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
338 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
339 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
340 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
341 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
342 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
343 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
344 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
345 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
346 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
347 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
348 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
349 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
350 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
351 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
352 2738541307 Variovorax sp. GV008 Isolate Unclassified
353 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
354 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
355 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
356 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
357 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
358 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
359 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
360 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
361 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
362 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
363 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
364 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
365 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
366 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
367 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
368 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
369 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
370 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
371 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
372 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
373 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
374 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
375 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
376 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
377 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
378 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
379 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
380 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
381 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
382 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
383 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
384 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
385 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
386 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
387 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
388 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
389 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
390 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
391 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
392 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
393 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
394 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
395 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
396 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
397 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
398 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
399 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
400 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
401 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
402 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
403 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
404 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
405 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
406 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
407 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
408 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
409 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
410 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
411 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
412 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
413 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
414 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
415 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
416 2922368715
417 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
418 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
419 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
420 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
421 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
422 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
423 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
424 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
425 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
426 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
427 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
428 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
429 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
430 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
431 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
432 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
433 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
434 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
435 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
436 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
437 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
438 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
439 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
440 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
441 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
442 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
443 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
444 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
445 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
446 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
447 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
448 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
449 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
450 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
451 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
452 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
453 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
454 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
455 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
456 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
457 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
458 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
459 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
460 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
461 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
462 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
463 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
464 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
465 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
466 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
467 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
468 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
469 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
470 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
471 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
472 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
473 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
474 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
475 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
476 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
477 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
478 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
479 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
480 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
481 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
482 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
483 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
484 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
485 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
486 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
487 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
488 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
489 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
490 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
491 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
492 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
493 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
494 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
495 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
496 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
497 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
498 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
499 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
500 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
501 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
502 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
503 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
504 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
505 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
506 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
507 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
508 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
509 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
510 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
511 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
512 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
513 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.09
Metatranscriptomes 0.15
Isolates 25.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.08
Nodule 20.35
Rhizoplane 4.8
Rhizosphere 50.44
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_137914_c1 3300050515 Bacteria 2339
2 JGI25157J39369_1000486 3300002741 Bacteria 24704
3 JGI25151J46595_10003411 3300003187 Bacteria 8795
4 JGI25153J46596_10000657 3300003215 Bacteria 21147
5 JGI25153J46596_10002490 3300003215 Bacteria 10574
6 JGI25153J46596_10002760 3300003215 Bacteria 9988
7 JGI25153J46596_10008218 3300003215 Bacteria 5019
8 JGI25153J46596_10013820 3300003215 Bacteria 3391
9 rootH2_10024294 3300003320 Bacteria 27838
10 JGI25160J50197_1000486 3300003354 Bacteria 23951
11 JGI25160J50197_1011041 3300003354 Bacteria 3228
12 Ga0055542_1013049 3300003762 Bacteria 1413
13 Ga0055531_10007130 3300003794 Bacteria 6168
14 Ga0055543_1001606 3300004625 Bacteria 8671
15 Ga0065165_1001966 3300005262 Bacteria 19466
16 Ga0065165_1002218 3300005262 Bacteria 17339
17 Ga0065165_1003663 3300005262 Bacteria 10488
18 Ga0070658_10010484 3300005327 Bacteria 7433
19 Ga0070658_10084641 3300005327 Bacteria 2607
20 Ga0070676_10294957 3300005328 Bacteria 1097
21 Ga0070683_100107702 3300005329 Bacteria 2628
22 Ga0070690_100000520 3300005330 Bacteria 19295
23 Ga0070670_100514945 3300005331 Bacteria 1065
24 Ga0068869_100057606 3300005334 Bacteria 2837
25 Ga0068869_100250444 3300005334 Bacteria 1414
26 Ga0068869_100291804 3300005334 Bacteria 1314
27 Ga0070680_100009613 3300005336 Bacteria 7433
28 Ga0070680_100030884 3300005336 Bacteria 4304
29 Ga0070680_100117172 3300005336 Bacteria 2221
30 Ga0070682_100029557 3300005337 Bacteria 3300
31 Ga0070682_100121530 3300005337 Bacteria 1754
32 Ga0068868_100038249 3300005338 Unclassified 3724
33 Ga0070660_100001396 3300005339 Bacteria 16455
34 Ga0070689_100008610 3300005340 Bacteria 7194
35 Ga0070689_100342036 3300005340 Bacteria 1253
36 Ga0070691_10000427 3300005341 Bacteria 15494
37 Ga0070691_10044327 3300005341 Bacteria 2109
38 Ga0070687_100131952 3300005343 Bacteria 1443
39 Ga0070661_100111451 3300005344 Bacteria 2043
40 Ga0070692_10117639 3300005345 Bacteria 1478
41 Ga0070675_100319682 3300005354 Bacteria 1371
42 Ga0070675_100384231 3300005354 Bacteria 1250
43 Ga0070688_100103154 3300005365 Bacteria 1884
44 Ga0070688_100183282 3300005365 Bacteria 1454
45 Ga0070659_100046623 3300005366 Bacteria 3398
46 Ga0070667_100026636 3300005367 Bacteria 4809
47 Ga0070667_100455352 3300005367 Bacteria 1169
48 Ga0070713_100005721 3300005436 Bacteria 8537
49 Ga0070713_100113086 3300005436 Bacteria 2370
50 Ga0070701_10170924 3300005438 Bacteria 1265
51 Ga0070705_100138636 3300005440 Bacteria 1598
52 Ga0070700_100001891 3300005441 Bacteria 10585
53 Ga0070694_100239181 3300005444 Bacteria 1369
54 Ga0070694_100445104 3300005444 Bacteria 1022
55 Ga0070663_100018666 3300005455 Bacteria 4552
56 Ga0070663_100473883 3300005455 Bacteria 1035
57 Ga0070678_100011776 3300005456 Bacteria 5410
58 Ga0070681_10004932 3300005458 Bacteria 12823
59 Ga0068867_100464112 3300005459 Bacteria 1082
60 Ga0070706_100052820 3300005467 Bacteria 3750
61 Ga0070698_100037444 3300005471 Bacteria 5001
62 Ga0070698_100251487 3300005471 Bacteria 1700
63 Ga0070679_100004561 3300005530 Bacteria 12791
64 Ga0070684_100201682 3300005535 Bacteria 1812
65 Ga0070697_100043659 3300005536 Bacteria 3631
66 Ga0068853_100094206 3300005539 Bacteria 2638
67 Ga0070672_100497942 3300005543 Bacteria 1054
68 Ga0070686_100000809 3300005544 Bacteria 18125
69 Ga0070686_100187423 3300005544 Bacteria 1474
70 Ga0070693_100001065 3300005547 Bacteria 12260
71 Ga0070693_100042353 3300005547 Bacteria 2565
72 Ga0070665_100022309 3300005548 Bacteria 6370
73 Ga0070665_100224762 3300005548 Bacteria 1877
74 Ga0070704_100022030 3300005549 Bacteria 4140
75 Ga0070704_100050701 3300005549 Bacteria 2919
76 Ga0068855_100040145 3300005563 Bacteria 5556
77 Ga0068857_100324554 3300005577 Bacteria 1422
78 Ga0068854_100127219 3300005578 Bacteria 1942
79 Ga0068856_100018089 3300005614 Bacteria 6833
80 Ga0068856_100052457 3300005614 Bacteria 4021
81 Ga0068856_100169740 3300005614 Bacteria 2193
82 Ga0070702_100000187 3300005615 Bacteria 20119
83 Ga0068852_100097046 3300005616 Bacteria 2650
84 Ga0068852_100115875 3300005616 Bacteria 2443
85 Ga0068859_100006511 3300005617 Bacteria 11857
86 Ga0068859_100015117 3300005617 Bacteria 7745
87 Ga0068859_100137700 3300005617 Bacteria 2515
88 Ga0068859_100170502 3300005617 Bacteria 2257
89 Ga0068864_100123098 3300005618 Bacteria 2321
90 Ga0068864_100203077 3300005618 Bacteria 1821
91 Ga0068866_10003262 3300005718 Bacteria 6679
92 Ga0068861_100094471 3300005719 Bacteria 2366
93 Ga0068861_100180427 3300005719 Bacteria 1757
94 Ga0068861_100668439 3300005719 Bacteria 962
95 Ga0068870_10110377 3300005840 Bacteria 1569
96 Ga0068863_100114717 3300005841 Bacteria 2566
97 Ga0068858_100058917 3300005842 Bacteria 3550
98 Ga0068858_100181671 3300005842 Bacteria 1987
99 Ga0068860_100319856 3300005843 Bacteria 1523
100 Ga0068862_100006449 3300005844 Bacteria 9748
101 Ga0068862_100602737 3300005844 Bacteria 1055
102 Ga0081455_10036662 3300005937 Bacteria 4362
103 Ga0081455_10048926 3300005937 Bacteria 3648
104 Ga0081455_10084507 3300005937 Bacteria 2590
105 Ga0075365_10026761 3300006038 Bacteria 3665
106 Ga0075365_10050580 3300006038 Bacteria 2741
107 Ga0075368_10010204 3300006042 Bacteria 3392
108 Ga0075363_100021973 3300006048 Bacteria 3221
109 Ga0075364_10017052 3300006051 Bacteria 4529
110 Ga0075362_10001519 3300006177 Bacteria 7471
111 Ga0075362_10065181 3300006177 Bacteria 1654
112 Ga0075367_10009903 3300006178 Bacteria 4992
113 Ga0075366_10021518 3300006195 Bacteria 3749
114 Ga0075366_10026379 3300006195 Bacteria 3403
115 Ga0075366_10169916 3300006195 Bacteria 1323
116 Ga0097621_100011876 3300006237 Bacteria 6439
117 Ga0097621_100501929 3300006237 Bacteria 1099
118 Ga0075370_10001788 3300006353 Bacteria 9605
119 Ga0075370_10027768 3300006353 Bacteria 3143
120 Ga0075370_10035051 3300006353 Bacteria 2815
121 Ga0075370_10078692 3300006353 Bacteria 1894
122 Ga0068871_100059265 3300006358 Bacteria 3119
123 Ga0075428_100044431 3300006844 Bacteria 4883
124 Ga0075431_100071115 3300006847 Bacteria 3589
125 Ga0075433_10449494 3300006852 Bacteria 1136
126 Ga0075434_100057610 3300006871 Bacteria 3861
127 Ga0075429_100000233 3300006880 Bacteria 38047
128 Ga0068865_100000472 3300006881 Bacteria 22488
129 Ga0097620_100006512 3300006931 Bacteria 11857
130 Ga0097620_100015118 3300006931 Bacteria 7745
131 Ga0097620_100137698 3300006931 Bacteria 2515
132 Ga0097620_100170510 3300006931 Bacteria 2257
133 Ga0099824_1008958 3300006942 Bacteria 12537
134 Ga0075435_100346749 3300007076 Bacteria 1273
135 Ga0075435_100426051 3300007076 Bacteria 1143
136 Ga0105240_10002869 3300009093 Bacteria 27260
137 Ga0111539_10129689 3300009094 Bacteria 2953
138 Ga0111539_10621242 3300009094 Bacteria 1258
139 Ga0105245_10010755 3300009098 Bacteria 7962
140 Ga0105245_10065023 3300009098 Bacteria 3298
141 Ga0105245_10336270 3300009098 Bacteria 1492
142 Ga0114129_10080988 3300009147 Bacteria 4513
143 Ga0105243_10003964 3300009148 Bacteria 11809
144 Ga0105243_10326013 3300009148 Bacteria 1401
145 Ga0105243_10353228 3300009148 Bacteria 1351
146 Ga0105241_10035504 3300009174 Bacteria 3749
147 Ga0105241_10095867 3300009174 Bacteria 2349
148 Ga0105241_10635952 3300009174 Bacteria 968
149 Ga0105242_10015993 3300009176 Bacteria 5831
150 Ga0105248_11054866 3300009177 Bacteria 918
151 Ga0105237_10110994 3300009545 Bacteria 2734
152 Ga0105237_10383247 3300009545 Bacteria 1411
153 Ga0105238_10001037 3300009551 Bacteria 28190
154 Ga0105238_10099982 3300009551 Bacteria 2883
155 Ga0105238_10233336 3300009551 Unclassified 1816
156 Ga0105249_10038619 3300009553 Bacteria 4332
157 Ga0105239_10045796 3300010375 Bacteria 4793
158 Ga0105239_10093934 3300010375 Bacteria 3312
159 Ga0105239_10154204 3300010375 Bacteria 2565
160 Ga0105239_10272153 3300010375 Bacteria 1905
161 Ga0105246_10333351 3300011119 Bacteria 1237
162 Ga0157371_10167720 3300013102 Bacteria 1568
163 Ga0157370_10003506 3300013104 Bacteria 18393
164 Ga0157370_10155040 3300013104 Bacteria 2131
165 Ga0157378_10008257 3300013297 Bacteria 9077
166 Ga0163162_10059776 3300013306 Bacteria 3844
167 Ga0163162_10092320 3300013306 Bacteria 3111
168 Ga0157372_10019688 3300013307 Bacteria 7274
169 Ga0163163_10075378 3300014325 Bacteria 3367
170 Ga0163163_10100525 3300014325 Bacteria 2914
171 Ga0163163_10295677 3300014325 Bacteria 1671
172 Ga0157380_10001571 3300014326 Bacteria 15007
173 Ga0157377_10180883 3300014745 Bacteria 1326
174 Ga0157379_10017417 3300014968 Bacteria 6327
175 Ga0157379_10041137 3300014968 Bacteria 4126
176 Ga0157379_10187817 3300014968 Bacteria 1867
177 Ga0157379_10658031 3300014968 Unclassified 981
178 Ga0157376_10497035 3300014969 Bacteria 1198
179 Ga0182007_10023554 3300015262 Bacteria 2164
180 Ga0163161_10041640 3300017792 Bacteria 3301
181 Ga0206356_11316191 3300020070 Bacteria 2543
182 Ga0214544_1000003 3300021320 Bacteria 643752
183 Ga0214542_1000003 3300021321 Bacteria 435700
184 Ga0214545_1000004 3300021324 Bacteria 453352
185 Ga0214545_1020783 3300021324 Bacteria 5131
186 Ga0214543_1000007 3300021327 Bacteria 414744
187 Ga0213875_10031643 3300021388 Bacteria 2502
188 Ga0209563_102406 3300025230 Bacteria 4246
189 Ga0209026_1000214 3300025250 Bacteria 80595
190 Ga0209148_1000904 3300025254 Bacteria 20182
191 Ga0209233_1002498 3300025261 Bacteria 6743
192 Ga0209233_1033107 3300025261 Bacteria 1189
193 Ga0209025_1000073 3300025294 Bacteria 282133
194 Ga0209564_1002641 3300025295 Bacteria 13692
195 Ga0209758_1000015 3300025297 Bacteria 851943
196 Ga0209758_1000389 3300025297 Bacteria 75919
197 Ga0209758_1000716 3300025297 Bacteria 48984
198 Ga0209758_1001131 3300025297 Bacteria 34274
199 Ga0209758_1042364 3300025297 Bacteria 1689
200 Ga0209256_1005691 3300025299 Bacteria 7003
201 Ga0207426_1000380 3300025302 Bacteria 76046
202 Ga0207426_1000832 3300025302 Bacteria 32765
203 Ga0207426_1015195 3300025302 Bacteria 2798
204 Ga0207426_1029421 3300025302 Bacteria 1811
205 Ga0207426_1052753 3300025302 Bacteria 1203
206 Ga0209051_1053276 3300025303 Bacteria 1330
207 Ga0207642_10001254 3300025899 Bacteria 7866
208 Ga0207642_10209941 3300025899 Bacteria 1081
209 Ga0207710_10077811 3300025900 Bacteria 1533
210 Ga0207647_10005598 3300025904 Bacteria 9180
211 Ga0207705_10000172 3300025909 Bacteria 69285
212 Ga0207705_10158282 3300025909 Bacteria 1700
213 Ga0207684_10071103 3300025910 Bacteria 2957
214 Ga0207654_10104411 3300025911 Bacteria 1752
215 Ga0207654_10332690 3300025911 Bacteria 1041
216 Ga0207707_10001137 3300025912 Bacteria 25207
217 Ga0207695_10000065 3300025913 Bacteria 336949
218 Ga0207671_10002455 3300025914 Bacteria 19836
219 Ga0207671_10079524 3300025914 Bacteria 2457
220 Ga0207660_10000082 3300025917 Bacteria 50637
221 Ga0207657_10000214 3300025919 Bacteria 60258
222 Ga0207657_10352488 3300025919 Bacteria 1161
223 Ga0207652_10000669 3300025921 Bacteria 33475
224 Ga0207646_10259782 3300025922 Bacteria 1570
225 Ga0207694_10285680 3300025924 Bacteria 1356
226 Ga0207687_10008733 3300025927 Bacteria 6620
227 Ga0207687_10026769 3300025927 Bacteria 3864
228 Ga0207687_10282201 3300025927 Unclassified 1331
229 Ga0207664_10228550 3300025929 Bacteria 1616
230 Ga0207644_10100932 3300025931 Bacteria 2168
231 Ga0207706_10087777 3300025933 Bacteria 2735
232 Ga0207706_10103622 3300025933 Bacteria 2503
233 Ga0207686_10019826 3300025934 Bacteria 3832
234 Ga0207709_10003691 3300025935 Bacteria 9013
235 Ga0207709_10074880 3300025935 Bacteria 2162
236 Ga0207670_10320648 3300025936 Bacteria 1219
237 Ga0207704_10003752 3300025938 Bacteria 6915
238 Ga0207704_10251689 3300025938 Bacteria 1327
239 Ga0207665_10208886 3300025939 Bacteria 1425
240 Ga0207689_10000764 3300025942 Bacteria 30878
241 Ga0207689_10216347 3300025942 Bacteria 1583
242 Ga0207689_10517762 3300025942 Bacteria 1000
243 Ga0207667_10018820 3300025949 Bacteria 7733
244 Ga0207712_10171741 3300025961 Bacteria 1695
245 Ga0207658_10042490 3300025986 Bacteria 3298
246 Ga0207677_10126365 3300026023 Unclassified 1933
247 Ga0207703_10289786 3300026035 Bacteria 1489
248 Ga0207678_10089253 3300026067 Bacteria 2635
249 Ga0207678_10170318 3300026067 Bacteria 1859
250 Ga0207708_10000350 3300026075 Bacteria 36165
251 Ga0207641_10283480 3300026088 Bacteria 1559
252 Ga0207648_10000730 3300026089 Bacteria 36815
253 Ga0207648_10105219 3300026089 Bacteria 2475
254 Ga0207648_10154934 3300026089 Bacteria 2022
255 Ga0207676_10254814 3300026095 Bacteria 1581
256 Ga0207674_10290813 3300026116 Bacteria 1582
257 Ga0207675_100000407 3300026118 Bacteria 41288
258 Ga0207675_100107945 3300026118 Bacteria 2625
259 Ga0207675_100190930 3300026118 Bacteria 1965
260 Ga0209389_1000168 3300027296 Bacteria 52990
261 Ga0209389_1000180 3300027296 Bacteria 49331
262 Ga0209589_1000570 3300027357 Bacteria 52985
263 Ga0209489_101190 3300027361 Bacteria 52985
264 Ga0209489_101411 3300027361 Bacteria 49331
265 Ga0209700_101443 3300027363 Bacteria 49345
266 Ga0209813_10008452 3300027866 Bacteria 2602
267 Ga0268266_10093707 3300028379 Bacteria 2635
268 Ga0268265_10264672 3300028380 Bacteria 1530
269 Ga0268264_10044738 3300028381 Bacteria 3673
270 Ga0265337_1005458 3300028556 Bacteria 5044
271 Ga0265326_10001815 3300028558 Bacteria 7349
272 Ga0265319_1003086 3300028563 Bacteria 8810
273 Ga0265334_10007422 3300028573 Bacteria 4702
274 Ga0265318_10005985 3300028577 Bacteria 5648
275 Ga0265323_10002112 3300028653 Bacteria 9280
276 Ga0265336_10000380 3300028666 Bacteria 28330
277 Ga0307517_10233420 3300028786 Bacteria 1101
278 Ga0265338_10000024 3300028800 Bacteria 297778
279 Ga0265324_10001715 3300029957 Bacteria 12057
280 Ga0316183_1203507 3300030742 Bacteria 1304
281 Ga0265316_10099460 3300031344 Bacteria 2212
282 Ga0307513_10203663 3300031456 Bacteria 1817
283 Ga0307513_10327126 3300031456 Bacteria 1289
284 Ga0307508_10107939 3300031616 Bacteria 2383
285 Ga0265314_10028794 3300031711 Unclassified 4136
286 Ga0307516_10021041 3300031730 Bacteria 6726
287 Ga0307413_10179014 3300031824 Bacteria 1509
288 Ga0307412_10134415 3300031911 Bacteria 1802
289 Ga0307510_10013273 3300033180 Bacteria 9768
290 Ga0307510_10027539 3300033180 Bacteria 6511
291 Ga0373944_0014832 3300035089 Bacteria 2180
292 Ga0373943_0019818 3300035170 Bacteria 3097
293 Ga0373946_0019911 3300035171 Bacteria 2589
294 Ga0373946_0176840 3300035171 Bacteria 1011
295 Ga0373935_0014892 3300035692 Bacteria 4697
296 Ga0373927_0062927 3300035695 Bacteria 2399
297 Ga0373947_0033545 3300035725 Bacteria 3031
298 Ga0395899_0019135 3300037312 Bacteria 5204
299 Ga0395900_0000937 3300037418 Bacteria 38218
300 Ga0395900_0383213 3300037418 Bacteria 1373
301 Ga0395898_0005127 3300037466 Bacteria 14184
302 Ga0395905_0003588 3300037471 Bacteria 16513
303 Ga0395901_0006000 3300038443 Bacteria 12306
304 Ga0436365_0984935 3300039437 Bacteria 1563
305 Ga0436363_0595544 3300039450 Bacteria 2881
306 Ga0436363_1381581 3300039450 Bacteria 9461
307 Ga0439436_0016831 3300041404 Bacteria 2191
308 Ga0439441_015079 3300042001 Bacteria 1363
309 Ga0439432_004408 3300042006 Bacteria 5140
310 Ga0439432_007537 3300042006 Bacteria 3854
311 Ga0439449_0001420 3300042007 Bacteria 9360
312 Ga0439449_0001525 3300042007 Bacteria 9067
313 Ga0466969_0108394 3300044656 Bacteria 1302
314 Ga0466972_0000171 3300044658 Bacteria 50915
315 Ga0466972_0001665 3300044658 Bacteria 10868
316 Ga0466972_0035014 3300044658 Bacteria 2458
317 Ga0466972_0085354 3300044658 Bacteria 1501
318 Ga0466965_0032001 3300044683 Bacteria 2568
319 Ga0466966_0000287 3300044684 Bacteria 33106
320 Ga0466961_0000126 3300044693 Bacteria 51032
321 Ga0466963_0097828 3300044694 Bacteria 2005
322 Ga0466964_0117972 3300044706 Bacteria 1192
323 Ga0466968_0057790 3300044735 Bacteria 1668
324 Ga0466968_0076430 3300044735 Bacteria 1466
325 Ga0466970_0015519 3300044765 Bacteria 3919
326 Ga0466970_0016622 3300044765 Bacteria 3796
327 Ga0466960_0068970 3300044901 Bacteria 1756
328 Ga0466960_0192202 3300044901 Bacteria 1111
329 Ga0466959_0020395 3300045049 Bacteria 4882
330 Ga0466959_0049570 3300045049 Bacteria 3085
331 Ga0466959_0171276 3300045049 Bacteria 1523
332 Ga0466967_0545937 3300045976 Bacteria 1140
333 Ga0495627_014134 3300046453 Bacteria 2794
334 Ga0495592_0024033 3300046454 Bacteria 4635
335 Ga0495603_0014393 3300046455 Bacteria 4785
336 Ga0495603_0049568 3300046455 Bacteria 2500
337 Ga0495638_0031304 3300046460 Bacteria 3420
338 Ga0495638_0095236 3300046460 Bacteria 1788
339 Ga0495651_0041817 3300046462 Bacteria 3560
340 Ga0495605_0104415 3300046474 Bacteria 1299
341 Ga0495639_0112122 3300046475 Bacteria 1295
342 Ga0495639_0251321 3300046475 Bacteria 874
343 Ga0495664_0036240 3300046477 Bacteria 2907
344 Ga0495584_0007894 3300046491 Bacteria 5535
345 Ga0495583_0096689 3300046506 Bacteria 1265
346 Ga0495606_0000244 3300046507 Bacteria 95942
347 Ga0495606_0049462 3300046507 Bacteria 2756
348 Ga0495606_0068647 3300046507 Bacteria 2242
349 Ga0495606_0166909 3300046507 Bacteria 1280
350 Ga0495608_0033683 3300046511 Bacteria 3460
351 Ga0495610_0103985 3300046512 Bacteria 1268
352 Ga0495628_0010621 3300046516 Bacteria 7810
353 Ga0495628_0512086 3300046516 Bacteria 865
354 Ga0495643_0010141 3300046522 Bacteria 5810
355 Ga0495648_0003301 3300046524 Bacteria 14240
356 Ga0495648_0113780 3300046524 Bacteria 1467
357 Ga0495652_0005571 3300046529 Bacteria 11837
358 Ga0495640_0135531 3300046533 Bacteria 1590
359 Ga0495587_0082212 3300046536 Bacteria 1866
360 Ga0495621_0034177 3300046539 Bacteria 1756
361 Ga0495597_0025697 3300046542 Bacteria 2710
362 Ga0495645_0102381 3300046543 Bacteria 2035
363 Ga0495622_0008202 3300046557 Bacteria 4840
364 Ga0495668_0039713 3300046616 Bacteria 2627
365 Ga0495634_0193908 3300046642 Bacteria 1265
366 Ga0495611_0112140 3300046648 Bacteria 1270
367 Ga0495635_0018225 3300046663 Bacteria 4901
368 Ga0495588_0143988 3300046674 Bacteria 1259
369 Ga0495657_0075300 3300046675 Bacteria 2194
370 Ga0495599_0041186 3300046678 Bacteria 2901
371 Ga0495623_0106486 3300046679 Bacteria 1703
372 Ga0495646_0026395 3300046680 Bacteria 3648
373 Ga0495600_0001145 3300046809 Bacteria 14497
374 Ga0495604_0029345 3300047317 Bacteria 4375
375 Ga0495674_0042610 3300047319 Bacteria 4047
376 Ga0495672_0018096 3300047320 Bacteria 4690
377 Ga0495672_0097378 3300047320 Bacteria 1602
378 Ga0495680_0009328 3300047322 Bacteria 8839
379 Ga0495687_006948 3300047443 Bacteria 6806
380 Ga0495687_105839 3300047443 Bacteria 1045
381 Ga0495675_0027465 3300047444 Bacteria 3626
382 Ga0495673_0043853 3300047469 Bacteria 1999
383 Ga0495602_0028430 3300048088 Bacteria 5350
384 Ga0496100_0032873 3300048903 Bacteria 3240
385 Ga0496100_0059143 3300048903 Bacteria 2517
386 Ga0496101_0094810 3300048904 Bacteria 2225
387 Ga0496102_0282346 3300048905 Bacteria 1565
388 Ga0496102_0453768 3300048905 Bacteria 1202
389 Ga0496103_0019895 3300048906 Bacteria 4031
390 Ga0496104_0007351 3300048907 Bacteria 9725
391 Ga0496104_0146723 3300048907 Bacteria 2266
392 Ga0496104_0149169 3300048907 Bacteria 2245
393 Ga0496105_0002518 3300048908 Bacteria 13288
394 Ga0496106_0168465 3300048909 Bacteria 1735
395 Ga0496107_0150201 3300048910 Bacteria 1723
396 Ga0496108_0000416 3300048911 Bacteria 34834
397 Ga0496108_0010875 3300048911 Bacteria 7388
398 Ga0496108_0215834 3300048911 Bacteria 1666
399 Ga0496108_0475115 3300048911 Bacteria 1092
400 Ga0496109_0001317 3300048912 Bacteria 20486
401 Ga0496110_0004470 3300048913 Bacteria 10838
402 Ga0496110_0071333 3300048913 Bacteria 3080
403 Ga0496110_0227653 3300048913 Bacteria 1695
404 Ga0496111_0015024 3300048914 Bacteria 5303
405 Ga0496111_0164648 3300048914 Bacteria 1647
406 Ga0496111_0356907 3300048914 Bacteria 1082
407 Ga0496112_0000019 3300048915 Bacteria 185531
408 Ga0496112_0007446 3300048915 Bacteria 9715
409 Ga0496112_0088979 3300048915 Bacteria 3055
410 Ga0496112_0090981 3300048915 Bacteria 3020
411 Ga0496113_0001503 3300048916 Bacteria 13056
412 Ga0496113_0545774 3300048916 Bacteria 930
413 Ga0496115_0001063 3300048918 Bacteria 19879
414 Ga0496115_0087423 3300048918 Bacteria 2543
415 Ga0496115_0336617 3300048918 Bacteria 1232
416 Ga0496115_0524198 3300048918 Bacteria 950
417 Ga0496116_0062603 3300048919 Bacteria 2402
418 Ga0496117_0113620 3300048920 Bacteria 1681
419 Ga0496117_0173956 3300048920 Bacteria 1246
420 Ga0496118_0001109 3300048921 Bacteria 41808
421 Ga0496118_0049821 3300048921 Bacteria 3221
422 Ga0496118_0049939 3300048921 Bacteria 3216
423 Ga0496118_0178197 3300048921 Bacteria 1288
424 Ga0496120_0030191 3300048923 Bacteria 3299
425 Ga0496120_0064357 3300048923 Bacteria 2036
426 Ga0496121_0004585 3300048924 Bacteria 18424
427 Ga0496122_0047174 3300048925 Bacteria 3328
428 Ga0496123_0028179 3300048926 Bacteria 4165
429 Ga0496124_0035884 3300048927 Bacteria 4333
430 Ga0496124_0036432 3300048927 Bacteria 4291
431 Ga0496125_0101626 3300048928 Bacteria 2115
432 Ga0496125_0221675 3300048928 Bacteria 1218
433 Ga0501031_0126928 3300049568 Bacteria 1666
434 Ga0501032_0180705 3300049569 Bacteria 1381
435 Ga0501033_0040655 3300049570 Bacteria 3471
436 Ga0501033_0041065 3300049570 Bacteria 3453
437 Ga0501033_0195930 3300049570 Bacteria 1444
438 Ga0501033_0214561 3300049570 Bacteria 1372
439 Ga0501034_0000730 3300049571 Bacteria 49754
440 Ga0501034_0518944 3300049571 Bacteria 1103
441 Ga0501037_0013662 3300049573 Bacteria 5982
442 Ga0501037_0187817 3300049573 Bacteria 1464
443 Ga0501038_0083895 3300049574 Bacteria 2682
444 Ga0501038_0265701 3300049574 Bacteria 1354
445 Ga0501043_0044068 3300049579 Bacteria 3507
446 Ga0501043_0052292 3300049579 Unclassified 3209
447 Ga0501047_0042513 3300049581 Bacteria 4391
448 Ga0501047_0132554 3300049581 Bacteria 2372
449 Ga0501070_0001198 3300049586 Bacteria 23203
450 Ga0501070_0195616 3300049586 Bacteria 1661
451 Ga0501072_0006277 3300049588 Bacteria 9052
452 Ga0501080_0008637 3300049742 Bacteria 9246
453 Ga0501080_0330473 3300049742 Bacteria 1379
454 Ga0501035_0001266 3300049822 Bacteria 26215
455 Ga0501035_0099387 3300049822 Bacteria 2554
456 Ga0501035_0555019 3300049822 Bacteria 940
457 Ga0501044_0003979 3300049823 Bacteria 16551
458 Ga0501044_0043051 3300049823 Bacteria 4692
459 Ga0501044_0078100 3300049823 Bacteria 3355
460 Ga0501044_0096091 3300049823 Bacteria 2985
461 nmdc:mga03683_3235_c1 3300050489 Bacteria 5215
462 nmdc:mga03n38_30151_c1 3300050490 Bacteria 2277
463 nmdc:mga03n38_9437_c1 3300050490 Bacteria 3551
464 nmdc:mga0yw44_162283_c1 3300050492 Bacteria 1463
465 nmdc:mga0yw44_360408_c1 3300050492 Bacteria 980
466 nmdc:mga0yw44_44090_c1 3300050492 Bacteria 2667
467 nmdc:mga0yw44_51685_c1 3300050492 Bacteria 2489
468 nmdc:mga0yw44_8432_c1 3300050492 Bacteria 5135
469 nmdc:mga0k408_140267_c1 3300050493 Bacteria 1437
470 nmdc:mga0k408_51778_c1 3300050493 Bacteria 2379
471 nmdc:mga06z11_333419_c1 3300050494 Bacteria 906
472 nmdc:mga04h51_9256_c1 3300050495 Bacteria 2663
473 nmdc:mga05p37_9043_c1 3300050507 Bacteria 11777
474 nmdc:mga09592_487_c1 3300050508 Bacteria 29737
475 nmdc:mga0qj67_4953_c1 3300050509 Bacteria 9678
476 nmdc:mga0qj67_531401_c1 3300050509 Bacteria 944
477 nmdc:mga06r32_26444_c1 3300050510 Bacteria 5410
478 nmdc:mga0n895_48557_c1 3300050512 Bacteria 4155
479 nmdc:mga0rr50_397711_c1 3300050513 Bacteria 1163
480 Ga0500635_0039058 3300053080 Bacteria 1577
481 Ga0500635_0046936 3300053080 Bacteria 1466
482 Ga0495619_0144611 3300053085 Bacteria 1639
483 Ga0500578_0156246 3300053086 Bacteria 1418
484 Ga0500643_000091 3300053087 Bacteria 93825
485 Ga0500647_0034570 3300053091 Bacteria 2413
486 Ga0500566_0000565 3300053094 Bacteria 20802
487 Ga0500641_0032316 3300053096 Bacteria 2070
488 Ga0500554_000764 3300053102 Bacteria 6445
489 Ga0500555_005028 3300053103 Bacteria 3751
490 Ga0500557_000028 3300053105 Bacteria 78414
491 Ga0500562_021500 3300053108 Bacteria 1679
492 Ga0500569_006745 3300053109 Bacteria 2538
493 Ga0500572_032557 3300053111 Bacteria 1464
494 Ga0500607_041417 3300053121 Bacteria 2489
495 Ga0500608_107015 3300053122 Bacteria 1287
496 Ga0500642_0000189 3300053130 Bacteria 25159
497 Ga0500642_0002517 3300053130 Bacteria 5395
498 Ga0500568_0045356 3300053139 Bacteria 1750
499 Ga0500577_0038757 3300053142 Bacteria 1723
500 Ga0500589_070570 3300053147 Bacteria 1581
501 Ga0500603_000264 3300053150 Bacteria 13814
502 Ga0500604_0082903 3300053151 Bacteria 1038
503 Ga0500616_0101967 3300053153 Bacteria 1401
504 Ga0500636_0000246 3300053177 Bacteria 29834
505 Ga0500637_0000269 3300053178 Bacteria 19469
506 Ga0500637_0077321 3300053178 Bacteria 1920
507 Ga0500609_006349 3300053731 Bacteria 1610
508 Ga0500599_003473 3300053736 Bacteria 1922
509 Ga0500601_000069 3300053737 Bacteria 21313
510 Ga0500661_016759 3300055283 Bacteria 1309
511 2507504747 2507262055 Bacteria 8048963
512 2508546099 2508501009 Bacteria 7784016
513 2508695033 2508501042 Bacteria 8719808
514 2511397007 2511231028 Bacteria 8046582
515 2513626677 2513237092 Bacteria 8341956
516 2513641812 2513237094 Bacteria 8789602
517 2513648067 2513237095 Bacteria 8976980
518 2513715595 2513237104 Bacteria 10034502
519 2513875716 2513237139 Bacteria 8737671
520 2514016382 2513237161 Bacteria 8871253
521 2515625964 2515154112 Bacteria 8294334
522 2517106964 2517093001 Bacteria 9002274
523 2524435638 2524023205 Bacteria 8918781
524 2528850291 2528768022 Bacteria 10457665
525 2617352947 2617270735 Bacteria 9163226
526 2617374233 2617270741 Bacteria 8201522
527 2738879239 2738541307 Bacteria 8606193
528 2745079905 2744054633 Bacteria 8678936
529 2793063205 2791355196 Bacteria 7323613
530 2805919392 2802429603 Bacteria 8777136
531 2818237174 2816332527 Bacteria 8933356
532 2824608675 2824600985 Bacteria 8488197
533 2824612752 2824609381 Bacteria 8672835
534 2824626365 2824617872 Bacteria 8814715
535 2824632490 2824626560 Bacteria 8813858
536 2824643644 2824635225 Bacteria 8785348
537 2824652530 2824644064 Bacteria 8743947
538 2824659005 2824653114 Bacteria 8493680
539 2824663558 2824661429 Bacteria 9877870
540 2824677890 2824671348 Bacteria 8369588
541 2824687172 2824679649 Bacteria 8248951
542 2824694608 2824687955 Bacteria 8360029
543 2824702776 2824696289 Bacteria 8335049
544 2824713206 2824704595 Bacteria 9667483
545 2824723308 2824714736 Bacteria 8717648
546 2824732467 2824723954 Bacteria 8758240
547 2824736938 2824732956 Bacteria 7810675
548 2824748230 2824746037 Bacteria 7911610
549 2824760629 2824753945 Bacteria 9787441
550 2824772020 2824763712 Bacteria 9792355
551 2824779869 2824773399 Bacteria 8360218
552 2838129446 2838122688 Bacteria 8803140
553 2841944347 2841941048 Bacteria 8688029
554 2841954476 2841949485 Bacteria 8680857
555 2841969124 2841966195 Bacteria 8673214
556 2841979898 2841974524 Bacteria 8931498
557 2841990921 2841983080 Bacteria 8395090
558 2842043994 2842038055 Bacteria 8002051
559 2842052017 2842045827 Bacteria 8006841
560 2844321724 2844315083 Bacteria 8138177
561 2847939690 2847930680 Bacteria 9342022
562 2847941643 2847939898 Bacteria 8606328
563 2849082566 2849076700 Bacteria 7039503
564 2857511462 2857509624 Bacteria 7472071
565 2874594296 2874590934 Bacteria 8299676
566 2874615554 2874612657 Bacteria 8252029
567 2874624323 2874620515 Bacteria 8290088
568 2874634084 2874628541 Bacteria 8630250
569 2874647722 2874645413 Bacteria 8214782
570 2876772604 2876771140 Bacteria 8287509
571 2876819865 2876818435 Bacteria 8274608
572 2879076371 2879074833 Bacteria 8279565
573 2879090507 2879083081 Bacteria 8587928
574 2879101847 2879099564 Bacteria 10442239
575 2879130674 2879127579 Bacteria 8294491
576 2879143144 2879142872 Bacteria 8267021
577 2881364989 2881364244 Bacteria 7710352
578 2881673622 2881665667 Bacteria 8175609
579 2885368105 2885366525 Bacteria 8326213
580 2885410902 2885409591 Bacteria 9235467
581 2888380075 2888378607 Bacteria 9652610
582 2888391134 2888388044 Bacteria 7304136
583 2888420879 2888419890 Bacteria 7857137
584 2903727730 2903727486 Bacteria 8281579
585 2904672338 2904666416 Bacteria 8226587
586 2904717924 2904711408 Bacteria 9771557
587 2906602784 2906602504 Bacteria 8295279
588 2906632411 2906626472 Bacteria 8826946
589 2906645045 2906643746 Bacteria 8722424
590 2908776708 2908775508 Bacteria 8092255
591 2922378457
592 2929622442 2929615660 Bacteria 9193770
593 2929631341 2929624759 Bacteria 9339455
594 2932786242 2932784394 Bacteria 9704911
595 2932794782 2932794094 Bacteria 7915132
596 2932805408 2932801729 Bacteria 7987968
597 2932812684 2932809354 Bacteria 9135765
598 2932823046 2932818245 Bacteria 9955613
599 2932829480 2932828146 Bacteria 9745859
600 2933584478 2933577622 Bacteria 9116884
601 2935615055 2935608549 Bacteria 8203142
602 2935617998 2935616580 Bacteria 9032984
603 2935641604 2935638405 Bacteria 10015038
604 2935651593 2935648319 Bacteria 8801166
605 2935659639 2935656913 Bacteria 8965014
606 2935669338 2935665750 Bacteria 9571747
607 2935678066 2935675223 Bacteria 9928132
608 2935693615 2935684952 Bacteria 9590419
609 2935701697 2935694250 Bacteria 9291695
610 2935707161 2935703347 Bacteria 10242284
611 2935717004 2935713505 Bacteria 9608509
612 2935730162 2935722832 Bacteria 9608746
613 2935738418 2935732158 Bacteria 9706831
614 2935750206 2935741537 Bacteria 9707219
615 2935759800 2935750917 Bacteria 9590372
616 2935764549 2935760218 Bacteria 9817913
617 2935772871 2935769743 Bacteria 7878163
618 2935777990 2935777560 Bacteria 8077691
619 2935787220 2935785616 Bacteria 7962367
620 2935795992 2935793552 Bacteria 8012592
621 2935804458 2935801545 Bacteria 9301974
622 2935817319 2935810662 Bacteria 9401221
623 2935825907 2935819856 Bacteria 8261050
624 2935831335 2935827899 Bacteria 10038562
625 2935841944 2935837841 Bacteria 9454360
626 2935851526 2935847175 Bacteria 8228321
627 2935856503 2935855204 Bacteria 9035059
628 2935870955 2935864058 Bacteria 9784707
629 2935874471 2935873716 Bacteria 9632195
630 2935887510 2935883170 Bacteria 7964738
631 2935910453 2935908558 Bacteria 8568796
632 2935918253 2935916978 Bacteria 9113783
633 2935927636 2935926038 Bacteria 8601059
634 2935936492 2935934488 Bacteria 8602579
635 2935943955 2935942939 Bacteria 8599779
636 2935952392 2935951376 Bacteria 8602333
637 2935964247 2935959822 Bacteria 7869783
638 2935969232 2935967501 Bacteria 8603075
639 2935978007 2935975950 Bacteria 8347125
640 2935984693 2935984226 Bacteria 8302647
641 2935993932 2935992306 Bacteria 9802711
642 2936005057 2936002035 Bacteria 9362176
643 2936014055 2936011229 Bacteria 8801034
644 2936023036 2936019824 Bacteria 8804134
645 2936031172 2936028420 Bacteria 8965941
646 2936044116 2936037263 Bacteria 9446081
647 2936049294 2936046547 Bacteria 8903709
648 2936055863 2936055302 Bacteria 8785755
649 2940565746 2940556831 Bacteria 9590747
650 2941532257 2941531003 Bacteria 7653939
651 2941544017 2941538514 Bacteria 9402094
652 2954772525 2954767861 Bacteria 5535784
653 3005490986 3005483717 Bacteria 7877331
654 3005509648 3005506211 Bacteria 6943378
655 3005594253 3005587118 Bacteria 7794411
656 3005602073 3005594810 Bacteria 8716512
657 3005717827 3005710791 Bacteria 7622528
658 3005724859 3005718088 Bacteria 8283608
659 8006997111 8006994254 Bacteria 8309700
660 8016518753 8016511872 Bacteria 9921665
661 8016526706 8016522445 Bacteria 8156687
662 8016531790 8016530956 Bacteria 8155261
663 8016544995 8016539877 Bacteria 8155419
664 8016565429 8016557553 Bacteria 8154380
665 8016570071 8016566248 Bacteria 8158151
666 8016582641 8016575299 Bacteria 8154085
667 8016585827 8016583857 Bacteria 10421953
668 8016603064 8016595262 Bacteria 8149947
669 8016605966 8016603502 Bacteria 8731218
670 8016617851 8016613128 Bacteria 8794220
671 8016636189 8016630954 Bacteria 9217207
672 8017057924 8017057580 Bacteria 10023680
673 8019531620 8019530166 Bacteria 8155624
674 8019539914 8019538911 Bacteria 7872763
675 8019550739 8019547302 Bacteria 7996444
676 8019595901 8019586578 Bacteria 10212056
677 8019605854 8019597564 Bacteria 10041141
678 8019612679 8019608314 Bacteria 10042931
679 8019622440 8019619141 Bacteria 9218857
680 8019630674 8019629233 Bacteria 8687553
681 8019639943 8019638758 Bacteria 9062356
682 8019651967 8019648815 Bacteria 10014479
683 8019667498 8019659431 Bacteria 8577854
684 8019677270 8019668869 Bacteria 8791617
685 8019678712 8019678201 Bacteria 8863603
686 8019696804 8019687851 Bacteria 8712826
687 8055750893 8055742211 Bacteria 9226248
688 8056975577 8056967851 Bacteria 9038162
689 nmdc:mga0a205_137914_c1
690 JGI25157J39369_1000486
691 JGI25151J46595_10003411
692 JGI25153J46596_10000657
693 JGI25153J46596_10002490
694 JGI25153J46596_10002760
695 JGI25153J46596_10008218
696 JGI25153J46596_10013820
697 rootH2_10024294
698 JGI25160J50197_1000486
699 JGI25160J50197_1011041
700 Ga0055542_1013049
701 Ga0055531_10007130
702 Ga0055543_1001606
703 Ga0065165_1001966
704 Ga0065165_1002218
705 Ga0065165_1003663
706 Ga0070658_10010484
707 Ga0070658_10084641
708 Ga0070676_10294957
709 Ga0070683_100107702
710 Ga0070690_100000520
711 Ga0070670_100514945
712 Ga0068869_100057606
713 Ga0068869_100250444
714 Ga0068869_100291804
715 Ga0070680_100009613
716 Ga0070680_100030884
717 Ga0070680_100117172
718 Ga0070682_100029557
719 Ga0070682_100121530
720 Ga0068868_100038249
721 Ga0070660_100001396
722 Ga0070689_100008610
723 Ga0070689_100342036
724 Ga0070691_10000427
725 Ga0070691_10044327
726 Ga0070687_100131952
727 Ga0070661_100111451
728 Ga0070692_10117639
729 Ga0070675_100319682
730 Ga0070675_100384231
731 Ga0070688_100103154
732 Ga0070688_100183282
733 Ga0070659_100046623
734 Ga0070667_100026636
735 Ga0070667_100455352
736 Ga0070713_100005721
737 Ga0070713_100113086
738 Ga0070701_10170924
739 Ga0070705_100138636
740 Ga0070700_100001891
741 Ga0070694_100239181
742 Ga0070694_100445104
743 Ga0070663_100018666
744 Ga0070663_100473883
745 Ga0070678_100011776
746 Ga0070681_10004932
747 Ga0068867_100464112
748 Ga0070706_100052820
749 Ga0070698_100037444
750 Ga0070698_100251487
751 Ga0070679_100004561
752 Ga0070684_100201682
753 Ga0070697_100043659
754 Ga0068853_100094206
755 Ga0070672_100497942
756 Ga0070686_100000809
757 Ga0070686_100187423
758 Ga0070693_100001065
759 Ga0070693_100042353
760 Ga0070665_100022309
761 Ga0070665_100224762
762 Ga0070704_100022030
763 Ga0070704_100050701
764 Ga0068855_100040145
765 Ga0068857_100324554
766 Ga0068854_100127219
767 Ga0068856_100018089
768 Ga0068856_100052457
769 Ga0068856_100169740
770 Ga0070702_100000187
771 Ga0068852_100097046
772 Ga0068852_100115875
773 Ga0068859_100006511
774 Ga0068859_100015117
775 Ga0068859_100137700
776 Ga0068859_100170502
777 Ga0068864_100123098
778 Ga0068864_100203077
779 Ga0068866_10003262
780 Ga0068861_100094471
781 Ga0068861_100180427
782 Ga0068861_100668439
783 Ga0068870_10110377
784 Ga0068863_100114717
785 Ga0068858_100058917
786 Ga0068858_100181671
787 Ga0068860_100319856
788 Ga0068862_100006449
789 Ga0068862_100602737
790 Ga0081455_10036662
791 Ga0081455_10048926
792 Ga0081455_10084507
793 Ga0075365_10026761
794 Ga0075365_10050580
795 Ga0075368_10010204
796 Ga0075363_100021973
797 Ga0075364_10017052
798 Ga0075362_10001519
799 Ga0075362_10065181
800 Ga0075367_10009903
801 Ga0075366_10021518
802 Ga0075366_10026379
803 Ga0075366_10169916
804 Ga0097621_100011876
805 Ga0097621_100501929
806 Ga0075370_10001788
807 Ga0075370_10027768
808 Ga0075370_10035051
809 Ga0075370_10078692
810 Ga0068871_100059265
811 Ga0075428_100044431
812 Ga0075431_100071115
813 Ga0075433_10449494
814 Ga0075434_100057610
815 Ga0075429_100000233
816 Ga0068865_100000472
817 Ga0097620_100006512
818 Ga0097620_100015118
819 Ga0097620_100137698
820 Ga0097620_100170510
821 Ga0099824_1008958
822 Ga0075435_100346749
823 Ga0075435_100426051
824 Ga0105240_10002869
825 Ga0111539_10129689
826 Ga0111539_10621242
827 Ga0105245_10010755
828 Ga0105245_10065023
829 Ga0105245_10336270
830 Ga0114129_10080988
831 Ga0105243_10003964
832 Ga0105243_10326013
833 Ga0105243_10353228
834 Ga0105241_10035504
835 Ga0105241_10095867
836 Ga0105241_10635952
837 Ga0105242_10015993
838 Ga0105248_11054866
839 Ga0105237_10110994
840 Ga0105237_10383247
841 Ga0105238_10001037
842 Ga0105238_10099982
843 Ga0105238_10233336
844 Ga0105249_10038619
845 Ga0105239_10045796
846 Ga0105239_10093934
847 Ga0105239_10154204
848 Ga0105239_10272153
849 Ga0105246_10333351
850 Ga0157371_10167720
851 Ga0157370_10003506
852 Ga0157370_10155040
853 Ga0157378_10008257
854 Ga0163162_10059776
855 Ga0163162_10092320
856 Ga0157372_10019688
857 Ga0163163_10075378
858 Ga0163163_10100525
859 Ga0163163_10295677
860 Ga0157380_10001571
861 Ga0157377_10180883
862 Ga0157379_10017417
863 Ga0157379_10041137
864 Ga0157379_10187817
865 Ga0157379_10658031
866 Ga0157376_10497035
867 Ga0182007_10023554
868 Ga0163161_10041640
869 Ga0206356_11316191
870 Ga0214544_1000003
871 Ga0214542_1000003
872 Ga0214545_1000004
873 Ga0214545_1020783
874 Ga0214543_1000007
875 Ga0213875_10031643
876 Ga0209563_102406
877 Ga0209026_1000214
878 Ga0209148_1000904
879 Ga0209233_1002498
880 Ga0209233_1033107
881 Ga0209025_1000073
882 Ga0209564_1002641
883 Ga0209758_1000015
884 Ga0209758_1000389
885 Ga0209758_1000716
886 Ga0209758_1001131
887 Ga0209758_1042364
888 Ga0209256_1005691
889 Ga0207426_1000380
890 Ga0207426_1000832
891 Ga0207426_1015195
892 Ga0207426_1029421
893 Ga0207426_1052753
894 Ga0209051_1053276
895 Ga0207642_10001254
896 Ga0207642_10209941
897 Ga0207710_10077811
898 Ga0207647_10005598
899 Ga0207705_10000172
900 Ga0207705_10158282
901 Ga0207684_10071103
902 Ga0207654_10104411
903 Ga0207654_10332690
904 Ga0207707_10001137
905 Ga0207695_10000065
906 Ga0207671_10002455
907 Ga0207671_10079524
908 Ga0207660_10000082
909 Ga0207657_10000214
910 Ga0207657_10352488
911 Ga0207652_10000669
912 Ga0207646_10259782
913 Ga0207694_10285680
914 Ga0207687_10008733
915 Ga0207687_10026769
916 Ga0207687_10282201
917 Ga0207664_10228550
918 Ga0207644_10100932
919 Ga0207706_10087777
920 Ga0207706_10103622
921 Ga0207686_10019826
922 Ga0207709_10003691
923 Ga0207709_10074880
924 Ga0207670_10320648
925 Ga0207704_10003752
926 Ga0207704_10251689
927 Ga0207665_10208886
928 Ga0207689_10000764
929 Ga0207689_10216347
930 Ga0207689_10517762
931 Ga0207667_10018820
932 Ga0207712_10171741
933 Ga0207658_10042490
934 Ga0207677_10126365
935 Ga0207703_10289786
936 Ga0207678_10089253
937 Ga0207678_10170318
938 Ga0207708_10000350
939 Ga0207641_10283480
940 Ga0207648_10000730
941 Ga0207648_10105219
942 Ga0207648_10154934
943 Ga0207676_10254814
944 Ga0207674_10290813
945 Ga0207675_100000407
946 Ga0207675_100107945
947 Ga0207675_100190930
948 Ga0209389_1000168
949 Ga0209389_1000180
950 Ga0209589_1000570
951 Ga0209489_101190
952 Ga0209489_101411
953 Ga0209700_101443
954 Ga0209813_10008452
955 Ga0268266_10093707
956 Ga0268265_10264672
957 Ga0268264_10044738
958 Ga0265337_1005458
959 Ga0265326_10001815
960 Ga0265319_1003086
961 Ga0265334_10007422
962 Ga0265318_10005985
963 Ga0265323_10002112
964 Ga0265336_10000380
965 Ga0307517_10233420
966 Ga0265338_10000024
967 Ga0265324_10001715
968 Ga0316183_1203507
969 Ga0265316_10099460
970 Ga0307513_10203663
971 Ga0307513_10327126
972 Ga0307508_10107939
973 Ga0265314_10028794
974 Ga0307516_10021041
975 Ga0307413_10179014
976 Ga0307412_10134415
977 Ga0307510_10013273
978 Ga0307510_10027539
979 Ga0373944_0014832
980 Ga0373943_0019818
981 Ga0373946_0019911
982 Ga0373946_0176840
983 Ga0373935_0014892
984 Ga0373927_0062927
985 Ga0373947_0033545
986 Ga0395899_0019135
987 Ga0395900_0000937
988 Ga0395900_0383213
989 Ga0395898_0005127
990 Ga0395905_0003588
991 Ga0395901_0006000
992 Ga0436365_0984935
993 Ga0436363_0595544
994 Ga0436363_1381581
995 Ga0439436_0016831
996 Ga0439441_015079
997 Ga0439432_004408
998 Ga0439432_007537
999 Ga0439449_0001420
1000 Ga0439449_0001525
1001 Ga0466969_0108394
1002 Ga0466972_0000171
1003 Ga0466972_0001665
1004 Ga0466972_0035014
1005 Ga0466972_0085354
1006 Ga0466965_0032001
1007 Ga0466966_0000287
1008 Ga0466961_0000126
1009 Ga0466963_0097828
1010 Ga0466964_0117972
1011 Ga0466968_0057790
1012 Ga0466968_0076430
1013 Ga0466970_0015519
1014 Ga0466970_0016622
1015 Ga0466960_0068970
1016 Ga0466960_0192202
1017 Ga0466959_0020395
1018 Ga0466959_0049570
1019 Ga0466959_0171276
1020 Ga0466967_0545937
1021 Ga0495627_014134
1022 Ga0495592_0024033
1023 Ga0495603_0014393
1024 Ga0495603_0049568
1025 Ga0495638_0031304
1026 Ga0495638_0095236
1027 Ga0495651_0041817
1028 Ga0495605_0104415
1029 Ga0495639_0112122
1030 Ga0495639_0251321
1031 Ga0495664_0036240
1032 Ga0495584_0007894
1033 Ga0495583_0096689
1034 Ga0495606_0000244
1035 Ga0495606_0049462
1036 Ga0495606_0068647
1037 Ga0495606_0166909
1038 Ga0495608_0033683
1039 Ga0495610_0103985
1040 Ga0495628_0010621
1041 Ga0495628_0512086
1042 Ga0495643_0010141
1043 Ga0495648_0003301
1044 Ga0495648_0113780
1045 Ga0495652_0005571
1046 Ga0495640_0135531
1047 Ga0495587_0082212
1048 Ga0495621_0034177
1049 Ga0495597_0025697
1050 Ga0495645_0102381
1051 Ga0495622_0008202
1052 Ga0495668_0039713
1053 Ga0495634_0193908
1054 Ga0495611_0112140
1055 Ga0495635_0018225
1056 Ga0495588_0143988
1057 Ga0495657_0075300
1058 Ga0495599_0041186
1059 Ga0495623_0106486
1060 Ga0495646_0026395
1061 Ga0495600_0001145
1062 Ga0495604_0029345
1063 Ga0495674_0042610
1064 Ga0495672_0018096
1065 Ga0495672_0097378
1066 Ga0495680_0009328
1067 Ga0495687_006948
1068 Ga0495687_105839
1069 Ga0495675_0027465
1070 Ga0495673_0043853
1071 Ga0495602_0028430
1072 Ga0496100_0032873
1073 Ga0496100_0059143
1074 Ga0496101_0094810
1075 Ga0496102_0282346
1076 Ga0496102_0453768
1077 Ga0496103_0019895
1078 Ga0496104_0007351
1079 Ga0496104_0146723
1080 Ga0496104_0149169
1081 Ga0496105_0002518
1082 Ga0496106_0168465
1083 Ga0496107_0150201
1084 Ga0496108_0000416
1085 Ga0496108_0010875
1086 Ga0496108_0215834
1087 Ga0496108_0475115
1088 Ga0496109_0001317
1089 Ga0496110_0004470
1090 Ga0496110_0071333
1091 Ga0496110_0227653
1092 Ga0496111_0015024
1093 Ga0496111_0164648
1094 Ga0496111_0356907
1095 Ga0496112_0000019
1096 Ga0496112_0007446
1097 Ga0496112_0088979
1098 Ga0496112_0090981
1099 Ga0496113_0001503
1100 Ga0496113_0545774
1101 Ga0496115_0001063
1102 Ga0496115_0087423
1103 Ga0496115_0336617
1104 Ga0496115_0524198
1105 Ga0496116_0062603
1106 Ga0496117_0113620
1107 Ga0496117_0173956
1108 Ga0496118_0001109
1109 Ga0496118_0049821
1110 Ga0496118_0049939
1111 Ga0496118_0178197
1112 Ga0496120_0030191
1113 Ga0496120_0064357
1114 Ga0496121_0004585
1115 Ga0496122_0047174
1116 Ga0496123_0028179
1117 Ga0496124_0035884
1118 Ga0496124_0036432
1119 Ga0496125_0101626
1120 Ga0496125_0221675
1121 Ga0501031_0126928
1122 Ga0501032_0180705
1123 Ga0501033_0040655
1124 Ga0501033_0041065
1125 Ga0501033_0195930
1126 Ga0501033_0214561
1127 Ga0501034_0000730
1128 Ga0501034_0518944
1129 Ga0501037_0013662
1130 Ga0501037_0187817
1131 Ga0501038_0083895
1132 Ga0501038_0265701
1133 Ga0501043_0044068
1134 Ga0501043_0052292
1135 Ga0501047_0042513
1136 Ga0501047_0132554
1137 Ga0501070_0001198
1138 Ga0501070_0195616
1139 Ga0501072_0006277
1140 Ga0501080_0008637
1141 Ga0501080_0330473
1142 Ga0501035_0001266
1143 Ga0501035_0099387
1144 Ga0501035_0555019
1145 Ga0501044_0003979
1146 Ga0501044_0043051
1147 Ga0501044_0078100
1148 Ga0501044_0096091
1149 nmdc:mga03683_3235_c1
1150 nmdc:mga03n38_30151_c1
1151 nmdc:mga03n38_9437_c1
1152 nmdc:mga0yw44_162283_c1
1153 nmdc:mga0yw44_360408_c1
1154 nmdc:mga0yw44_44090_c1
1155 nmdc:mga0yw44_51685_c1
1156 nmdc:mga0yw44_8432_c1
1157 nmdc:mga0k408_140267_c1
1158 nmdc:mga0k408_51778_c1
1159 nmdc:mga06z11_333419_c1
1160 nmdc:mga04h51_9256_c1
1161 nmdc:mga05p37_9043_c1
1162 nmdc:mga09592_487_c1
1163 nmdc:mga0qj67_4953_c1
1164 nmdc:mga0qj67_531401_c1
1165 nmdc:mga06r32_26444_c1
1166 nmdc:mga0n895_48557_c1
1167 nmdc:mga0rr50_397711_c1
1168 Ga0500635_0039058
1169 Ga0500635_0046936
1170 Ga0495619_0144611
1171 Ga0500578_0156246
1172 Ga0500643_000091
1173 Ga0500647_0034570
1174 Ga0500566_0000565
1175 Ga0500641_0032316
1176 Ga0500554_000764
1177 Ga0500555_005028
1178 Ga0500557_000028
1179 Ga0500562_021500
1180 Ga0500569_006745
1181 Ga0500572_032557
1182 Ga0500607_041417
1183 Ga0500608_107015
1184 Ga0500642_0000189
1185 Ga0500642_0002517
1186 Ga0500568_0045356
1187 Ga0500577_0038757
1188 Ga0500589_070570
1189 Ga0500603_000264
1190 Ga0500604_0082903
1191 Ga0500616_0101967
1192 Ga0500636_0000246
1193 Ga0500637_0000269
1194 Ga0500637_0077321
1195 Ga0500609_006349
1196 Ga0500599_003473
1197 Ga0500601_000069
1198 Ga0500661_016759
1199 2507504747
1200 2508546099
1201 2508695033
1202 2511397007
1203 2513626677
1204 2513641812
1205 2513648067
1206 2513715595
1207 2513875716
1208 2514016382
1209 2515625964
1210 2517106964
1211 2524435638
1212 2528850291
1213 2617352947
1214 2617374233
1215 2738879239
1216 2745079905
1217 2793063205
1218 2805919392
1219 2818237174
1220 2824608675
1221 2824612752
1222 2824626365
1223 2824632490
1224 2824643644
1225 2824652530
1226 2824659005
1227 2824663558
1228 2824677890
1229 2824687172
1230 2824694608
1231 2824702776
1232 2824713206
1233 2824723308
1234 2824732467
1235 2824736938
1236 2824748230
1237 2824760629
1238 2824772020
1239 2824779869
1240 2838129446
1241 2841944347
1242 2841954476
1243 2841969124
1244 2841979898
1245 2841990921
1246 2842043994
1247 2842052017
1248 2844321724
1249 2847939690
1250 2847941643
1251 2849082566
1252 2857511462
1253 2874594296
1254 2874615554
1255 2874624323
1256 2874634084
1257 2874647722
1258 2876772604
1259 2876819865
1260 2879076371
1261 2879090507
1262 2879101847
1263 2879130674
1264 2879143144
1265 2881364989
1266 2881673622
1267 2885368105
1268 2885410902
1269 2888380075
1270 2888391134
1271 2888420879
1272 2903727730
1273 2904672338
1274 2904717924
1275 2906602784
1276 2906632411
1277 2906645045
1278 2908776708
1279 2922378457
1280 2929622442
1281 2929631341
1282 2932786242
1283 2932794782
1284 2932805408
1285 2932812684
1286 2932823046
1287 2932829480
1288 2933584478
1289 2935615055
1290 2935617998
1291 2935641604
1292 2935651593
1293 2935659639
1294 2935669338
1295 2935678066
1296 2935693615
1297 2935701697
1298 2935707161
1299 2935717004
1300 2935730162
1301 2935738418
1302 2935750206
1303 2935759800
1304 2935764549
1305 2935772871
1306 2935777990
1307 2935787220
1308 2935795992
1309 2935804458
1310 2935817319
1311 2935825907
1312 2935831335
1313 2935841944
1314 2935851526
1315 2935856503
1316 2935870955
1317 2935874471
1318 2935887510
1319 2935910453
1320 2935918253
1321 2935927636
1322 2935936492
1323 2935943955
1324 2935952392
1325 2935964247
1326 2935969232
1327 2935978007
1328 2935984693
1329 2935993932
1330 2936005057
1331 2936014055
1332 2936023036
1333 2936031172
1334 2936044116
1335 2936049294
1336 2936055863
1337 2940565746
1338 2941532257
1339 2941544017
1340 2954772525
1341 3005490986
1342 3005509648
1343 3005594253
1344 3005602073
1345 3005717827
1346 3005724859
1347 8006997111
1348 8016518753
1349 8016526706
1350 8016531790
1351 8016544995
1352 8016565429
1353 8016570071
1354 8016582641
1355 8016585827
1356 8016603064
1357 8016605966
1358 8016617851
1359 8016636189
1360 8017057924
1361 8019531620
1362 8019539914
1363 8019550739
1364 8019595901
1365 8019605854
1366 8019612679
1367 8019622440
1368 8019630674
1369 8019639943
1370 8019651967
1371 8019667498
1372 8019677270
1373 8019678712
1374 8019696804
1375 8055750893
1376 8056975577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

184

263

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

171

211

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9379 166 265
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9182 169 263
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9123 169 253
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9014 159 269
3mkl-assembly1.cif.gz_A crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.8994 162 264
ID Description Score Start End Superfamily
3lsgC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9637 220 263 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9595 220 263 1.10.10.60
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9505 165 218 1.10.10.60
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9463 165 265 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9379 166 265 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7X5ZRN0-F1-model_v4 AraC-like DNA-binding protein 0.9735 161 264 GO:0003700
GO:0043565
AF-A0A7X0Q335-F1-model_v4 deleted 0.9633 161 266
AF-F1TEY5-F1-model_v4 Transcriptional regulator, AraC family 0.9538 161 265 GO:0003700
GO:0043565
AF-A0A7J9ZUH7-F1-model_v4 Helix-turn-helix domain-containing protein 0.9534 165 264 GO:0003700
GO:0043565
AF-R5J228-F1-model_v4 deleted 0.9462 169 269

Map