F475356

General Info

Members Datasets Scaffolds Average Seq Length
688 494 1374 342

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2802429606|2805932902
Length 393
Sequence DISISHIGFLTPGNYSGDDPLSGLEQALQELHYGEKLGFDSAWVRQRHLEPGISSASAFLAAATQRTSRIELGTAVIPIGYESPYRLAEDLATVDVLSRGRLNIGVSAGRPLHAELIGPLAFDGDWTSYDFSHDRVLRFADNLRGTYLGDDETFIKTPFGPQRPRLQPYAKGLIDRIWYGGGSQRSAGWAGRNGFNLLTGNVITGEGTDDFFVAQSRLIKTYRDSGTQRRVALGRVIVPFDSADAATRRRYRDYADGRHQRTLSPQGERRTLFARDIVGTSEEILERLFADPILPDVSELRLELPYEFEHEEYRQILHDFVTRIAPGARMESAAGNSGRFLRGRRQTTSPIRHQTIILAGAFVSDQIGGIFLFDRLALVPHRLRCLYRTGGEE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
57 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
70 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
116 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
117 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
125 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
126 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
127 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
195 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
196 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
197 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
198 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
199 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
200 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
208 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
213 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
214 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
215 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
216 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
217 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
218 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
219 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
220 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
221 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
222 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
223 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
224 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
225 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
226 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
227 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
228 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
229 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
230 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
231 2519899620 Rhizobium sp. Pop5 Isolate Nodule
232 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
233 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
234 2547132424 Nocardia nova SH22a Isolate Unclassified
235 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
236 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
237 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
238 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
239 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
240 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
241 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
242 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
243 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
244 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
245 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
246 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
247 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
248 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
249 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
250 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
251 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
252 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
253 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
254 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
255 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
256 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
257 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
258 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
259 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
260 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
261 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
262 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
263 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
264 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
265 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
266 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
267 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
268 2643221582 Rhizobium sp. Root651 Isolate Unclassified
269 2643221618 Ensifer sp. Root231 Isolate Unclassified
270 2643221626 Ensifer sp. Root31 Isolate Unclassified
271 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
272 2643221655 Ensifer sp. Root1252 Isolate Unclassified
273 2643221659 Ensifer sp. Root127 Isolate Unclassified
274 2643221672 Variovorax sp. Root434 Isolate Unclassified
275 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
276 2643221692 Nocardia sp. Root136 Isolate Unclassified
277 2643221693 Rhizobium sp. Root491 Isolate Unclassified
278 2643221698 Ensifer sp. Root142 Isolate Unclassified
279 2643221712 Ensifer sp. Root258 Isolate Unclassified
280 2643221718 Rhizobium sp. Root268 Isolate Unclassified
281 2643221723 Ensifer sp. Root278 Isolate Unclassified
282 2643221736 Bosea sp. Root483D1 Isolate Unclassified
283 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
284 2718217882 Rhizobium sp. N741 Isolate Nodule
285 2718217927 Rhizobium sp. N324 Isolate Nodule
286 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
287 2718218009 Rhizobium sp. N561 Isolate Nodule
288 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
289 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
290 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
291 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
292 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
293 2718218363 Rhizobium sp. N113 Isolate Nodule
294 2718218365 Rhizobium sp. N731 Isolate Nodule
295 2718218366 Rhizobium sp. N621 Isolate Nodule
296 2718218423 Rhizobium sp. N941 Isolate Nodule
297 2721755514 Rhizobium sp. N6212 Isolate Nodule
298 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
299 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
300 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
301 2721755809 Rhizobium sp. N541 Isolate Nodule
302 2721755810 Rhizobium sp. N871 Isolate Nodule
303 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
304 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
305 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
306 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
307 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
308 2728369365 Rhizobium sp. N1341 Isolate Nodule
309 2728369397 Rhizobium sp. N1314 Isolate Nodule
310 2738541307 Variovorax sp. GV008 Isolate Unclassified
311 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
312 2751185800 Brucella pituitosa AA2 Isolate Unclassified
313 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
314 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
315 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
316 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
317 2791355256 Rhizobium sp. M10 Isolate Nodule
318 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
319 2791355260 Rhizobium sp. L9 Isolate Nodule
320 2791355262 Rhizobium sp. M1 Isolate Nodule
321 2791355263 Rhizobium chutanense C5 Isolate Nodule
322 2791355264 Rhizobium sp. S9 Isolate Nodule
323 2791355267 Rhizobium sp. L18 Isolate Nodule
324 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
325 2802429633 Rhizobium anhuiense J3 Isolate Nodule
326 2802429634 Rhizobium anhuiense S10 Isolate Nodule
327 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
328 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
329 2802429637 Rhizobium anhuiense C15 Isolate Nodule
330 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
331 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
332 2818991446 Variovorax sp. 1180 Isolate Unclassified
333 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
334 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
335 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
336 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
337 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
338 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
339 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
340 2838061910 Rhizobium phaseoli L15 Isolate Nodule
341 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
342 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
343 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
344 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
345 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
346 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
347 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
348 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
349 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
350 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
351 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
352 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
353 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
354 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
355 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
356 2841760612 Bosea sp. Tri-49 Isolate Nodule
357 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
358 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
359 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
360 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
361 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
362 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
363 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
364 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
365 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
366 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
367 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
368 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
369 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
370 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
371 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
372 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
373 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
374 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
375 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
376 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
377 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
378 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
379 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
380 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
381 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
382 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
383 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
384 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
385 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
386 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
387 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
388 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
389 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
390 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
391 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
392 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
393 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
394 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
395 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
396 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
397 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
398 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
399 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
400 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
401 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
402 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
403 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
404 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
405 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
406 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
407 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
408 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
409 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
410 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
411 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
412 2844104063 Bosea sp. Tri-39 Isolate Nodule
413 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
414 2851182111 Bosea sp. Tri-44 Isolate Nodule
415 2851246043 Bosea sp. Tri-54 Isolate Nodule
416 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
417 2854911287 Brucella lupini LUP21 Isolate Unclassified
418 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
419 2885198086 Variovorax sp. 679 Isolate Unclassified
420 2885211737 Variovorax sp. 553 Isolate Unclassified
421 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
422 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
423 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
424 2899924645 Variovorax sp. 369 Isolate Unclassified
425 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
426 2909042592 Labrys sp. LIt4 Isolate Nodule
427 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
428 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
429 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
430 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
431 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
432 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
433 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
434 2928037797 Variovorax sp. 1126 Isolate Unclassified
435 2928044640 Variovorax sp. 1128 Isolate Unclassified
436 2928051484 Variovorax sp. 1133 Isolate Unclassified
437 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
438 2928070936 Variovorax gossypii 1167 Isolate Unclassified
439 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
440 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
441 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
442 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
443 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
444 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
445 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
446 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
447 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
448 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
449 2936381700 Rhizobium chutanense C16 Isolate Unclassified
450 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
451 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
452 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
453 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
454 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
455 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
456 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
457 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
458 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
459 2996893221 Rhizobium sp. R635 Isolate Nodule
460 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
461 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
462 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
463 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
464 8005258706 Rhizobium sp. R693 Isolate Nodule
465 8005275841 Rhizobium sp. N4311 Isolate Nodule
466 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
467 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
468 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
469 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
470 8005382845 Rhizobium sp. R634 Isolate Nodule
471 8005395548 Rhizobium sp. R339 Isolate Nodule
472 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
473 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
474 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
475 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
476 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
477 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
478 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
479 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
480 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
481 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
482 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
483 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
484 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
485 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
486 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
487 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
488 8018176218 Rhizobium sp. N122 Isolate Nodule
489 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
490 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
491 8024501048 Rhizobium sp. H4 Isolate Nodule
492 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
493 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
494 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.87
Metatranscriptomes 0
Isolates 41.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 28.05
Nodule 26.16
Rhizoplane 2.62
Rhizosphere 24.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004429 3300001979 Bacteria 6040
2 JGI25155J39150_1000015 3300002704 Bacteria 178839
3 JGI25156J39149_1000007 3300002705 Bacteria 252108
4 JGI25162J39368_1000285 3300002737 Bacteria 47453
5 JGI25154J39366_1000051 3300002738 Bacteria 123608
6 JGI25157J39369_1000012 3300002741 Bacteria 205167
7 JGI25152J39213_1001255 3300002773 Bacteria 11515
8 JGI25150J39212_1001782 3300002774 Bacteria 5731
9 JGI25159J45721_1000012 3300002987 Bacteria 149808
10 JGI25159J45721_1000354 3300002987 Bacteria 21222
11 JGI25159J45721_1001088 3300002987 Bacteria 11584
12 JGI25159J45721_1008601 3300002987 Bacteria 2786
13 JGI25151J46595_10000341 3300003187 Bacteria 50002
14 JGI25151J46595_10000540 3300003187 Bacteria 35010
15 JGI25151J46595_10002343 3300003187 Bacteria 11515
16 JGI25165J46597_1000102 3300003214 Bacteria 155002
17 JGI25165J46597_1000198 3300003214 Bacteria 88888
18 JGI25165J46597_1006636 3300003214 Bacteria 2027
19 JGI25153J46596_10002155 3300003215 Bacteria 11515
20 rootH1_10072180 3300003316 Bacteria 4888
21 rootH1_10077486 3300003316 Bacteria 2557
22 rootL2_10016804 3300003322 Bacteria 37660
23 rootH1_10035402 3300003323 Bacteria 10091
24 rootH1_10097577 3300003323 Bacteria 5324
25 JGI25160J50197_1000026 3300003354 Bacteria 184693
26 JGI25160J50197_1000042 3300003354 Bacteria 149808
27 JGI25160J50197_1001503 3300003354 Bacteria 11584
28 JGI25160J50197_1001783 3300003354 Bacteria 10417
29 JGI25161J50226_1000014 3300003374 Bacteria 191109
30 JGI25161J50226_1000210 3300003374 Bacteria 37233
31 JGI25161J50226_1001923 3300003374 Bacteria 5742
32 JGI25161J50226_1004520 3300003374 Bacteria 2897
33 Ga0055535_1000348 3300003761 Bacteria 45946
34 Ga0055542_1000021 3300003762 Bacteria 331499
35 Ga0055526_1000400 3300003771 Bacteria 35032
36 Ga0055526_1000834 3300003771 Bacteria 23036
37 Ga0055526_1002782 3300003771 Bacteria 11584
38 Ga0055526_1005132 3300003771 Bacteria 7635
39 Ga0055537_1000538 3300003773 Bacteria 21974
40 Ga0055524_1000470 3300003775 Bacteria 32352
41 Ga0055524_1001852 3300003775 Bacteria 11584
42 Ga0055524_1002050 3300003775 Bacteria 10712
43 Ga0055524_1002393 3300003775 Bacteria 9723
44 Ga0055524_1013055 3300003775 Bacteria 3155
45 Ga0055536_1000740 3300003781 Bacteria 21867
46 Ga0055536_1003099 3300003781 Bacteria 9041
47 Ga0055536_1005332 3300003781 Bacteria 6316
48 Ga0055534_1005516 3300003784 Bacteria 3369
49 Ga0055534_1006100 3300003784 Bacteria 3095
50 Ga0055528_1000034 3300003790 Bacteria 118577
51 Ga0055528_1000273 3300003790 Bacteria 43784
52 Ga0055528_1000790 3300003790 Bacteria 21974
53 Ga0055528_1001168 3300003790 Bacteria 16988
54 Ga0055528_1004274 3300003790 Bacteria 6910
55 Ga0055530_10007026 3300003791 Bacteria 4846
56 Ga0055530_10013473 3300003791 Bacteria 2790
57 Ga0055540_1001205 3300003792 Bacteria 15914
58 Ga0055540_1002741 3300003792 Bacteria 9057
59 Ga0055531_10000815 3300003794 Bacteria 25853
60 Ga0055531_10036331 3300003794 Bacteria 1522
61 Ga0058692_1004276 3300003856 Bacteria 4253
62 Ga0055543_1000052 3300004625 Bacteria 104887
63 Ga0055543_1000123 3300004625 Bacteria 64977
64 Ga0055543_1001022 3300004625 Bacteria 12438
65 Ga0055543_1004437 3300004625 Bacteria 3832
66 Ga0065165_1000073 3300005262 Bacteria 164910
67 Ga0065165_1000174 3300005262 Bacteria 113769
68 Ga0065165_1000545 3300005262 Bacteria 56973
69 Ga0065165_1008598 3300005262 Bacteria 4743
70 Ga0070668_100043111 3300005347 Bacteria 3460
71 Ga0070659_100041562 3300005366 Bacteria 3595
72 Ga0070662_100023355 3300005457 Bacteria 4246
73 Ga0068853_100008938 3300005539 Bacteria 8066
74 Ga0070665_100261653 3300005548 Bacteria 1731
75 Ga0070664_100132737 3300005564 Bacteria 2188
76 Ga0068857_100284354 3300005577 Bacteria 1522
77 Ga0068854_100300572 3300005578 Bacteria 1298
78 Ga0068856_100058153 3300005614 Bacteria 3818
79 Ga0068852_100158459 3300005616 Bacteria 2111
80 Ga0075365_10000709 3300006038 Bacteria 13425
81 Ga0075368_10004779 3300006042 Bacteria 4614
82 Ga0075368_10057065 3300006042 Bacteria 1558
83 Ga0075363_100121218 3300006048 Bacteria 1461
84 Ga0075367_10001059 3300006178 Bacteria 11353
85 Ga0075369_10015733 3300006186 Bacteria 3041
86 Ga0075369_10128655 3300006186 Bacteria 1149
87 Ga0075366_10009687 3300006195 Bacteria 5384
88 Ga0075370_10000218 3300006353 Bacteria 20437
89 Ga0075370_10005596 3300006353 Bacteria 6265
90 Ga0075370_10014569 3300006353 Bacteria 4197
91 Ga0075370_10077712 3300006353 Bacteria 1905
92 Ga0099826_10000080 3300006948 Bacteria 48855
93 Ga0099826_10010722 3300006948 Bacteria 6875
94 Ga0105244_10004015 3300009036 Bacteria 10290
95 Ga0105240_10000216 3300009093 Bacteria 115800
96 Ga0105240_10261387 3300009093 Bacteria 1997
97 Ga0105243_10000385 3300009148 Bacteria 47177
98 Ga0105243_10000645 3300009148 Bacteria 34585
99 Ga0105241_10089999 3300009174 Bacteria 2419
100 Ga0105237_10000536 3300009545 Bacteria 53573
101 Ga0105238_10390887 3300009551 Bacteria 1383
102 Ga0123341_1000031 3300009765 Bacteria 64454
103 Ga0123341_1009876 3300009765 Bacteria 8726
104 Ga0123342_1026367 3300009766 Bacteria 3384
105 Ga0105239_10076989 3300010375 Bacteria 3670
106 Ga0105246_10002250 3300011119 Bacteria 11646
107 Ga0157347_1002166 3300012502 Bacteria 1650
108 Ga0157373_10014068 3300013100 Bacteria 5866
109 Ga0157371_10000002 3300013102 Bacteria 665040
110 Ga0157370_10000143 3300013104 Bacteria 87289
111 Ga0157370_10000183 3300013104 Bacteria 78649
112 Ga0157370_10011289 3300013104 Bacteria 9364
113 Ga0157370_10354823 3300013104 Bacteria 1351
114 Ga0171463_1002 3300013249 Bacteria 1274851
115 Ga0182008_10001837 3300014497 Bacteria 13822
116 Ga0182008_10004807 3300014497 Bacteria 7814
117 Ga0182008_10013241 3300014497 Bacteria 4336
118 Ga0182008_10137145 3300014497 Bacteria 1222
119 Ga0182006_1003343 3300015261 Bacteria 8260
120 Ga0182007_10000335 3300015262 Bacteria 29829
121 Ga0182007_10005641 3300015262 Bacteria 5463
122 Ga0182005_1006674 3300015265 Bacteria 3505
123 Ga0183365_10483 3300015684 Bacteria 1306
124 Ga0183363_1341 3300015690 Bacteria 5644
125 Ga0163161_10000117 3300017792 Bacteria 75699
126 Ga0163161_10011330 3300017792 Bacteria 6181
127 Ga0213872_10000097 3300021361 Bacteria 80834
128 Ga0209435_100006 3300025206 Bacteria 542459
129 Ga0209436_100140 3300025208 Bacteria 35032
130 Ga0209436_101914 3300025208 Bacteria 6706
131 Ga0209672_107446 3300025228 Bacteria 1686
132 Ga0209147_103930 3300025229 Bacteria 2658
133 Ga0209437_100042 3300025233 Bacteria 444095
134 Ga0209437_100062 3300025233 Bacteria 336900
135 Ga0209258_100058 3300025242 Bacteria 331567
136 Ga0207425_1000142 3300025245 Bacteria 63527
137 Ga0207425_1015426 3300025245 Bacteria 1715
138 Ga0209646_1000015 3300025246 Bacteria 542459
139 Ga0209026_1000046 3300025250 Bacteria 262031
140 Ga0209677_100216 3300025253 Bacteria 42627
141 Ga0209148_1000071 3300025254 Bacteria 331551
142 Ga0209759_1000005 3300025256 Bacteria 542459
143 Ga0209129_1000007 3300025258 Bacteria 771325
144 Ga0209129_1000182 3300025258 Bacteria 87739
145 Ga0209129_1000618 3300025258 Bacteria 23861
146 Ga0209129_1006107 3300025258 Bacteria 4019
147 Ga0209129_1013201 3300025258 Bacteria 1835
148 Ga0209233_1000082 3300025261 Bacteria 336320
149 Ga0209233_1000103 3300025261 Bacteria 284123
150 Ga0209233_1000428 3300025261 Bacteria 30724
151 Ga0209565_1000038 3300025263 Bacteria 286433
152 Ga0209673_1000020 3300025273 Bacteria 430653
153 Ga0209673_1000080 3300025273 Bacteria 223503
154 Ga0209673_1000607 3300025273 Bacteria 55095
155 Ga0209673_1000691 3300025273 Bacteria 48251
156 Ga0209130_1000075 3300025284 Bacteria 171698
157 Ga0209130_1000076 3300025284 Bacteria 170259
158 Ga0209130_1000121 3300025284 Bacteria 127462
159 Ga0209130_1000702 3300025284 Bacteria 29997
160 Ga0209675_1000256 3300025291 Bacteria 52565
161 Ga0209675_1008818 3300025291 Bacteria 3645
162 Ga0209676_1000139 3300025292 Bacteria 177886
163 Ga0209676_1000383 3300025292 Bacteria 81259
164 Ga0209676_1003221 3300025292 Bacteria 10310
165 Ga0209676_1003965 3300025292 Bacteria 8556
166 Ga0209025_1000056 3300025294 Bacteria 316188
167 Ga0209025_1000081 3300025294 Bacteria 265899
168 Ga0209025_1000104 3300025294 Bacteria 226895
169 Ga0209025_1000461 3300025294 Bacteria 79418
170 Ga0209025_1000478 3300025294 Bacteria 77516
171 Ga0209025_1003803 3300025294 Bacteria 13796
172 Ga0209025_1006981 3300025294 Bacteria 8577
173 Ga0209564_1000073 3300025295 Bacteria 288080
174 Ga0209564_1000205 3300025295 Bacteria 135901
175 Ga0209564_1000278 3300025295 Bacteria 105405
176 Ga0209564_1001643 3300025295 Bacteria 21576
177 Ga0209564_1018835 3300025295 Bacteria 2608
178 Ga0209564_1030840 3300025295 Bacteria 1653
179 Ga0209758_1000044 3300025297 Bacteria 398448
180 Ga0209758_1000076 3300025297 Bacteria 270615
181 Ga0209758_1011122 3300025297 Bacteria 5258
182 Ga0209758_1028095 3300025297 Bacteria 2388
183 Ga0209050_1000811 3300025298 Bacteria 43739
184 Ga0209050_1003053 3300025298 Bacteria 12906
185 Ga0209050_1028805 3300025298 Bacteria 1793
186 Ga0209256_1000020 3300025299 Bacteria 542402
187 Ga0209256_1000411 3300025299 Bacteria 67351
188 Ga0209256_1000524 3300025299 Bacteria 55735
189 Ga0209256_1000648 3300025299 Bacteria 47343
190 Ga0209256_1001460 3300025299 Bacteria 24301
191 Ga0209256_1002307 3300025299 Bacteria 15985
192 Ga0209256_1009419 3300025299 Bacteria 4287
193 Ga0207426_1000001 3300025302 Bacteria 1341301
194 Ga0207426_1000075 3300025302 Bacteria 321337
195 Ga0207426_1000163 3300025302 Bacteria 171698
196 Ga0207426_1000169 3300025302 Bacteria 164859
197 Ga0209051_1000257 3300025303 Bacteria 88842
198 Ga0209051_1000259 3300025303 Bacteria 88311
199 Ga0209051_1002814 3300025303 Bacteria 12001
200 Ga0209051_1015330 3300025303 Bacteria 3530
201 Ga0209051_1015562 3300025303 Bacteria 3491
202 Ga0209051_1016535 3300025303 Bacteria 3331
203 Ga0209257_1000116 3300025304 Bacteria 228733
204 Ga0209257_1000222 3300025304 Bacteria 134717
205 Ga0209257_1008629 3300025304 Bacteria 5720
206 Ga0209257_1008754 3300025304 Bacteria 5632
207 Ga0207655_1001237 3300025728 Bacteria 24472
208 Ga0207695_10000319 3300025913 Bacteria 116116
209 Ga0207695_10222602 3300025913 Bacteria 1794
210 Ga0207671_10000078 3300025914 Bacteria 150705
211 Ga0207681_10061607 3300025923 Bacteria 2580
212 Ga0207706_10089438 3300025933 Bacteria 2707
213 Ga0207709_10000292 3300025935 Bacteria 56565
214 Ga0207709_10000908 3300025935 Bacteria 22289
215 Ga0207709_10010496 3300025935 Bacteria 5099
216 Ga0207679_10126919 3300025945 Bacteria 2040
217 Ga0207668_10030029 3300025972 Bacteria 3569
218 Ga0207702_10039041 3300026078 Bacteria 3977
219 Ga0207674_10047029 3300026116 Bacteria 4426
220 Ga0207698_10019559 3300026142 Bacteria 4639
221 Ga0207698_10183092 3300026142 Bacteria 1858
222 Ga0209371_1000003 3300027312 Bacteria 1122971
223 Ga0209371_1000373 3300027312 Bacteria 48218
224 Ga0209371_1016200 3300027312 Bacteria 1975
225 Ga0209813_10012638 3300027866 Bacteria 2237
226 Ga0268266_10366498 3300028379 Bacteria 1356
227 Ga0268265_10065104 3300028380 Bacteria 2811
228 Ga0268256_1000004 3300030500 Bacteria 1122967
229 Ga0268256_1005781 3300030500 Bacteria 4761
230 Ga0268256_1017999 3300030500 Bacteria 1975
231 Ga0307512_10118118 3300030522 Bacteria 1716
232 Ga0316181_1210191 3300030744 Bacteria 3410
233 Ga0265327_10063261 3300031251 Bacteria 1879
234 Ga0307405_10007654 3300031731 Bacteria 5421
235 Ga0307412_10009952 3300031911 Bacteria 5470
236 Ga0307510_10000171 3300033180 Bacteria 54868
237 Ga0436361_0212275 3300039447 Bacteria 78927
238 Ga0439465_0051964 3300041413 Bacteria 1344
239 Ga0451806_490553 3300041462 Bacteria 1732
240 Ga0451845_0112994 3300041501 Bacteria 3125
241 Ga0451845_0374148 3300041501 Bacteria 1283
242 Ga0451849_0167718 3300041505 Bacteria 2361
243 Ga0451843_0095872 3300041509 Bacteria 2160
244 Ga0466970_0000711 3300044765 Bacteria 16299
245 Ga0466957_0050682 3300044842 Bacteria 2526
246 Ga0466959_0228926 3300045049 Bacteria 1287
247 Ga0466958_0148566 3300045836 Bacteria 1478
248 Ga0495617_042195 3300046452 Bacteria 1525
249 Ga0495638_0000524 3300046460 Bacteria 44781
250 Ga0495605_0004431 3300046474 Bacteria 8254
251 Ga0495585_0013223 3300046492 Bacteria 4835
252 Ga0495606_0079201 3300046507 Bacteria 2047
253 Ga0495610_0000609 3300046512 Bacteria 35431
254 Ga0495610_0006809 3300046512 Bacteria 7754
255 Ga0495610_0014900 3300046512 Bacteria 4545
256 Ga0495616_0000211 3300046513 Bacteria 48566
257 Ga0495616_0014728 3300046513 Bacteria 4368
258 Ga0495620_0006400 3300046515 Bacteria 6474
259 Ga0495631_0000311 3300046518 Bacteria 33638
260 Ga0495631_0002715 3300046518 Bacteria 9816
261 Ga0495632_0013724 3300046519 Bacteria 4611
262 Ga0495632_0014403 3300046519 Bacteria 4476
263 Ga0495637_0002590 3300046520 Bacteria 9933
264 Ga0495637_0049679 3300046520 Bacteria 1761
265 Ga0495643_0020176 3300046522 Bacteria 3848
266 Ga0495643_0024854 3300046522 Bacteria 3395
267 Ga0495643_0108644 3300046522 Bacteria 1413
268 Ga0495654_0005909 3300046530 Bacteria 7038
269 Ga0495609_0050926 3300046538 Bacteria 1845
270 Ga0495633_0093390 3300046558 Bacteria 1398
271 Ga0495611_0064445 3300046648 Bacteria 1669
272 Ga0495625_0005601 3300046660 Bacteria 11386
273 Ga0495625_0014508 3300046660 Bacteria 6280
274 Ga0495625_0030156 3300046660 Bacteria 4049
275 Ga0495625_0051290 3300046660 Bacteria 2958
276 Ga0495625_0120279 3300046660 Bacteria 1788
277 Ga0495588_0012368 3300046674 Bacteria 4033
278 Ga0495670_0090357 3300046691 Bacteria 1567
279 Ga0495670_0094926 3300046691 Bacteria 1530
280 Ga0495671_0002554 3300046692 Bacteria 11443
281 Ga0495671_0012624 3300046692 Bacteria 4608
282 Ga0495649_0011291 3300046694 Bacteria 5246
283 Ga0495649_0021010 3300046694 Bacteria 3660
284 Ga0495660_0047752 3300046810 Bacteria 2343
285 Ga0495672_0005527 3300047320 Bacteria 10004
286 Ga0495683_0009349 3300047323 Bacteria 5222
287 Ga0495687_003982 3300047443 Bacteria 10291
288 Ga0495681_0000990 3300047470 Bacteria 21739
289 Ga0495686_0023447 3300047472 Bacteria 4070
290 Ga0495686_0030746 3300047472 Bacteria 3486
291 Ga0495686_0094143 3300047472 Bacteria 1816
292 Ga0496100_0002935 3300048903 Bacteria 8766
293 Ga0496101_0052753 3300048904 Bacteria 2933
294 Ga0496102_0004495 3300048905 Bacteria 11774
295 Ga0496103_0005804 3300048906 Bacteria 7372
296 Ga0496104_0177504 3300048907 Bacteria 2040
297 Ga0496106_0000494 3300048909 Bacteria 27913
298 Ga0496112_0369113 3300048915 Bacteria 1377
299 Ga0496113_0078983 3300048916 Bacteria 2518
300 Ga0496113_0086832 3300048916 Bacteria 2404
301 Ga0496116_0023178 3300048919 Bacteria 4630
302 Ga0496116_0025116 3300048919 Bacteria 4388
303 Ga0496116_0156849 3300048919 Bacteria 1255
304 Ga0496117_0000016 3300048920 Bacteria 523642
305 Ga0496117_0001125 3300048920 Bacteria 40300
306 Ga0496117_0012189 3300048920 Bacteria 7607
307 Ga0496117_0014509 3300048920 Bacteria 6782
308 Ga0496117_0087756 3300048920 Bacteria 2015
309 Ga0496117_0159557 3300048920 Bacteria 1323
310 Ga0496118_0000153 3300048921 Bacteria 122419
311 Ga0496118_0000844 3300048921 Bacteria 48654
312 Ga0496118_0001526 3300048921 Bacteria 34471
313 Ga0496118_0009414 3300048921 Bacteria 9866
314 Ga0496118_0020755 3300048921 Bacteria 5816
315 Ga0496118_0029894 3300048921 Bacteria 4559
316 Ga0496118_0053851 3300048921 Bacteria 3053
317 Ga0496118_0089181 3300048921 Bacteria 2130
318 Ga0496119_0005626 3300048922 Bacteria 11914
319 Ga0496119_0008309 3300048922 Bacteria 9150
320 Ga0496119_0010000 3300048922 Bacteria 8033
321 Ga0496120_0000423 3300048923 Bacteria 67509
322 Ga0496121_0014507 3300048924 Bacteria 8354
323 Ga0496121_0015484 3300048924 Bacteria 7986
324 Ga0496121_0025037 3300048924 Bacteria 5681
325 Ga0496121_0034848 3300048924 Bacteria 4521
326 Ga0496121_0209183 3300048924 Bacteria 1383
327 Ga0496122_0000002 3300048925 Bacteria 905834
328 Ga0496122_0004823 3300048925 Bacteria 16442
329 Ga0496122_0010739 3300048925 Bacteria 9393
330 Ga0496122_0016190 3300048925 Bacteria 7081
331 Ga0496122_0017147 3300048925 Bacteria 6791
332 Ga0496122_0019188 3300048925 Bacteria 6262
333 Ga0496123_0000002 3300048926 Bacteria 1811682
334 Ga0496123_0004010 3300048926 Bacteria 15918
335 Ga0496123_0040552 3300048926 Bacteria 3240
336 Ga0496123_0101770 3300048926 Bacteria 1669
337 Ga0496124_0000094 3300048927 Bacteria 189147
338 Ga0496124_0012132 3300048927 Bacteria 8538
339 Ga0496124_0019012 3300048927 Bacteria 6412
340 Ga0496124_0029697 3300048927 Bacteria 4864
341 Ga0496124_0065890 3300048927 Bacteria 3018
342 Ga0496124_0071040 3300048927 Bacteria 2887
343 Ga0496124_0146533 3300048927 Bacteria 1857
344 Ga0496124_0160886 3300048927 Bacteria 1750
345 Ga0496125_0007773 3300048928 Bacteria 11344
346 Ga0496125_0008081 3300048928 Bacteria 11088
347 Ga0496125_0031955 3300048928 Bacteria 4682
348 Ga0496125_0037969 3300048928 Bacteria 4179
349 Ga0496125_0042810 3300048928 Bacteria 3851
350 Ga0496125_0069242 3300048928 Bacteria 2770
351 Ga0496125_0136285 3300048928 Bacteria 1716
352 Ga0496126_0045887 3300048929 Bacteria 4013
353 Ga0496126_0063807 3300048929 Bacteria 3301
354 Ga0495678_050005 3300049459 Bacteria 1622
355 Ga0495682_0068237 3300049460 Bacteria 1281
356 Ga0501033_0075350 3300049570 Bacteria 2476
357 Ga0501042_0000073 3300049578 Bacteria 37226
358 Ga0501083_0000028 3300049744 Bacteria 115481
359 nmdc:mga03683_41174_c1 3300050489 Bacteria 1897
360 nmdc:mga00v17_53_c1 3300050491 Bacteria 72424
361 nmdc:mga0yw44_3659_c1 3300050492 Bacteria 6872
362 nmdc:mga0yw44_943_c1 3300050492 Bacteria 11041
363 nmdc:mga0k408_32434_c2 3300050493 Bacteria 2606
364 nmdc:mga0k408_6618_c1 3300050493 Bacteria 6176
365 nmdc:mga06z11_162720_c1 3300050494 Bacteria 1276
366 nmdc:mga04h51_25802_c1 3300050495 Bacteria 1812
367 nmdc:mga07m45_2880_c1 3300050496 Bacteria 8153
368 nmdc:mga07m45_506_c1 3300050496 Bacteria 16504
369 nmdc:mga07m45_57117_c1 3300050496 Bacteria 2207
370 nmdc:mga0sz30_7069_c1 3300050516 Bacteria 4197
371 Ga0500610_0010501 3300053079 Bacteria 4168
372 Ga0500610_0091649 3300053079 Bacteria 1578
373 Ga0500578_0044322 3300053086 Bacteria 2855
374 Ga0500651_0000015 3300053093 Bacteria 161416
375 Ga0500651_0055977 3300053093 Bacteria 2470
376 Ga0500560_000090 3300053107 Bacteria 9077
377 Ga0500572_000986 3300053111 Bacteria 8624
378 Ga0500593_009847 3300053117 Bacteria 3986
379 Ga0500594_0000799 3300053118 Bacteria 6706
380 Ga0500594_0001286 3300053118 Bacteria 5452
381 Ga0500607_000393 3300053121 Bacteria 41936
382 Ga0500607_014088 3300053121 Bacteria 4649
383 Ga0500618_003647 3300053125 Bacteria 5209
384 Ga0500618_008662 3300053125 Bacteria 2823
385 Ga0500655_000179 3300053133 Bacteria 15339
386 Ga0500658_0000371 3300053134 Bacteria 19748
387 Ga0500658_0000395 3300053134 Bacteria 18986
388 Ga0500658_0001219 3300053134 Bacteria 10450
389 Ga0500658_0010513 3300053134 Bacteria 3413
390 Ga0500561_0000022 3300053137 Bacteria 35723
391 Ga0500568_0001291 3300053139 Bacteria 16442
392 Ga0500568_0001498 3300053139 Bacteria 14919
393 Ga0500568_0004887 3300053139 Bacteria 7061
394 Ga0500588_0023402 3300053146 Bacteria 1693
395 Ga0500616_0002543 3300053153 Bacteria 15044
396 Ga0500616_0009127 3300053153 Bacteria 6060
397 Ga0500622_0000343 3300053156 Bacteria 45668
398 Ga0500624_001002 3300053157 Bacteria 5690
399 Ga0500627_0000241 3300053158 Bacteria 15573
400 Ga0500627_0035563 3300053158 Bacteria 2117
401 Ga0500633_0023428 3300053160 Bacteria 1905
402 Ga0500634_0019993 3300053161 Bacteria 3615
403 Ga0500636_0000113 3300053177 Bacteria 41913
404 Ga0500636_0109816 3300053177 Bacteria 1560
405 2805932902 2802429606 Bacteria 6346811
406 2509390792 2509276021 Bacteria 7634384
407 2509442027 2509276033 Bacteria 7180565
408 2510137405 2510065019 Bacteria 6903379
409 2510893798 2510461076 Bacteria 8618824
410 2511135671 2510917022 Bacteria 6504556
411 2511199464 2510917030 Bacteria 7460662
412 2513228632 2513020051 Bacteria 6053213
413 2513572021 2513237084 Bacteria 7231967
414 2513575799 2513237085 Bacteria 7695351
415 2513633500 2513237093 Bacteria 7545552
416 2513712348 2513237103 Bacteria 7647401
417 2513998687 2513237159 Bacteria 6810126
418 2514024482 2513237162 Bacteria 7468464
419 2515644157 2515154114 Bacteria 7848616
420 2515657794 2515154116 Bacteria 7552979
421 2515743813 2515154134 Bacteria 7220242
422 2517081254 2516653085 Bacteria 7346596
423 2517100357 2517093000 Bacteria 7412387
424 2520375426 2519899620 Bacteria 6499161
425 2530648891 2529292951 Bacteria 6916614
426 2537877534 2537561587 Bacteria 5425293
427 2548696982 2547132424 Bacteria 8348532
428 2554245439 2554235003 Bacteria 5877155
429 2559296731 2558860242 Bacteria 5568029
430 2585222301 2582581298 Bacteria 7315509
431 2585269573 2582581306 Bacteria 6450535
432 2585272746 2582581307 Bacteria 6597605
433 2585281396 2582581308 Bacteria 7413247
434 2585327713 2582581315 Bacteria 7318924
435 2585332418 2582581316 Bacteria 7774528
436 2585396338 2582581866 Bacteria 6859583
437 2585405243 2582581867 Bacteria 7184437
438 2585526346 2585427526 Bacteria 7258840
439 2585535618 2585427527 Bacteria 7273426
440 2585538901 2585427528 Bacteria 6842387
441 2585544746 2585427529 Bacteria 7395659
442 2585556021 2585427530 Bacteria 7383882
443 2585562414 2585427531 Bacteria 6992870
444 2585823449 2585427590 Bacteria 6824633
445 2585836852 2585427593 Bacteria 7141551
446 2585896860 2585427608 Bacteria 6544331
447 2585906419 2585427609 Bacteria 6667127
448 2587981841 2585428125 Bacteria 6662905
449 2599602777 2599185210 Bacteria 5624189
450 2599623891 2599185214 Bacteria 8209958
451 2599671490 2599185226 Bacteria 8233575
452 2599681497 2599185227 Bacteria 8246414
453 2599693100 2599185229 Bacteria 8216126
454 2600194539 2599185352 Bacteria 7228948
455 2601610398 2600255279 Bacteria 5605316
456 2601747272 2600255308 Bacteria 5611129
457 2616294237 2615840624 Bacteria 6557588
458 2616310508 2615840626 Bacteria 7921970
459 2616552003 2615840698 Bacteria 7319877
460 2617386604 2617270742 Bacteria 6808054
461 2643917287 2643221582 Bacteria 5804683
462 2644104377 2643221618 Bacteria 7717186
463 2644147527 2643221626 Bacteria 8069654
464 2644210125 2643221637 Bacteria 5345260
465 2644313370 2643221655 Bacteria 7722067
466 2644331625 2643221659 Bacteria 7890716
467 2644400429 2643221672 Bacteria 6322190
468 2644501443 2643221689 Bacteria 6042950
469 2644511969 2643221692 Bacteria 7282860
470 2644520859 2643221693 Bacteria 5513853
471 2644541788 2643221698 Bacteria 7756764
472 2644612995 2643221712 Bacteria 7729434
473 2644653677 2643221718 Bacteria 5345506
474 2644672430 2643221723 Bacteria 7095460
475 2644744015 2643221736 Bacteria 6608466
476 2671114495 2667528174 Bacteria 6435400
477 2719183983 2718217882 Bacteria 6556348
478 2719389728 2718217927 Bacteria 6972593
479 2719669283 2718217997 Bacteria 6740740
480 2719729556 2718218009 Bacteria 6478651
481 2720494299 2718218199 Bacteria 6740745
482 2720610633 2718218232 Bacteria 6720332
483 2720616521 2718218233 Bacteria 6662049
484 2720627866 2718218235 Bacteria 6630699
485 2720771449 2718218269 Bacteria 6906114
486 2721143806 2718218363 Bacteria 6524337
487 2721156481 2718218365 Bacteria 6274507
488 2721161181 2718218366 Bacteria 6425255
489 2721403371 2718218423 Bacteria 6438183
490 2722837134 2721755514 Bacteria 6424414
491 2723030710 2721755556 Bacteria 6745503
492 2723563209 2721755684 Bacteria 6859907
493 2723571203 2721755685 Bacteria 6704835
494 2724034947 2721755809 Bacteria 6438790
495 2724040710 2721755810 Bacteria 6479005
496 2724086998 2721755819 Bacteria 6906405
497 2724100709 2721755822 Bacteria 6726041
498 2724107961 2721755823 Bacteria 6752556
499 2725951848 2724679232 Bacteria 7646494
500 2730105176 2728369352 Bacteria 6745171
501 2730162123 2728369365 Bacteria 6555560
502 2730295242 2728369397 Bacteria 6274511
503 2738879504 2738541307 Bacteria 8606193
504 2739034320 2738541333 Bacteria 7106503
505 2753358316 2751185800 Bacteria 5467370
506 2753459216 2751185821 Bacteria 6189929
507 2758638914 2758568016 Bacteria 5645291
508 2766068072 2765235942 Bacteria 7445910
509 2778175205 2775507266 Bacteria 7392367
510 2793295949 2791355256 Bacteria 6798008
511 2793312638 2791355259 Bacteria 7254731
512 2793321820 2791355260 Bacteria 6598818
513 2793336336 2791355262 Bacteria 6774204
514 2793340591 2791355263 Bacteria 6872478
515 2793348519 2791355264 Bacteria 6429314
516 2793367483 2791355267 Bacteria 7222458
517 2805930870 2802429605 Bacteria 6875453
518 2806043120 2802429633 Bacteria 7341974
519 2806051072 2802429634 Bacteria 7083200
520 2806057756 2802429635 Bacteria 7650140
521 2806065526 2802429636 Bacteria 7597525
522 2806075236 2802429637 Bacteria 7067217
523 2808987184 2808606387 Bacteria 5697198
524 2819557478 2818991439 Bacteria 6907412
525 2819597361 2818991446 Bacteria 7757362
526 2819607630 2818991448 Bacteria 6772224
527 2819641631 2818991453 Bacteria 7181617
528 2821129046 2821123053 Bacteria 7836056
529 2835313160 2835312727 Bacteria 7413381
530 2838019692 2838016132 Bacteria 6577831
531 2838027100 2838022645 Bacteria 6494267
532 2838032119 2838029111 Bacteria 6603031
533 2838067033 2838061910 Bacteria 6794874
534 2838072560 2838068647 Bacteria 6208656
535 2838662427 2838661181 Bacteria 7385261
536 2838669137 2838668709 Bacteria 6671819
537 2838678015 2838675328 Bacteria 4909118
538 2838686394 2838680041 Bacteria 6545511
539 2838688273 2838686498 Bacteria 7807632
540 2838700813 2838694306 Bacteria 6853137
541 2838701202 2838701080 Bacteria 6669771
542 2838714029 2838707686 Bacteria 6619912
543 2838717079 2838714209 Bacteria 5525906
544 2838722310 2838719591 Bacteria 5523910
545 2838727828 2838724970 Bacteria 4908691
546 2838732452 2838729681 Bacteria 7400765
547 2838741369 2838736955 Bacteria 5760694
548 2838745130 2838742623 Bacteria 7396178
549 2841764306 2841760612 Bacteria 6454112
550 2841845227 2841840854 Bacteria 5761912
551 2841849485 2841846520 Bacteria 5345850
552 2841852013 2841851746 Bacteria 7532261
553 2841861472 2841859092 Bacteria 5436171
554 2841865894 2841864319 Bacteria 6742987
555 2842083501 2842077413 Bacteria 6508645
556 2842111741 2842110456 Bacteria 7656360
557 2842124463 2842118031 Bacteria 7033875
558 2842127766 2842124991 Bacteria 5346824
559 2842132908 2842130223 Bacteria 4909145
560 2842144930 2842140634 Bacteria 5759631
561 2842146733 2842146304 Bacteria 5957337
562 2842154901 2842152218 Bacteria 4908957
563 2842158911 2842156927 Bacteria 6894975
564 2842166342 2842163707 Bacteria 6916235
565 2842173400 2842170452 Bacteria 5525737
566 2842178522 2842175837 Bacteria 4908771
567 2842182525 2842180545 Bacteria 6888678
568 2842190187 2842187318 Bacteria 5524014
569 2842200574 2842198810 Bacteria 6608673
570 2842208450 2842205361 Bacteria 6340321
571 2842214501 2842211629 Bacteria 5523832
572 2842227220 2842224351 Bacteria 5524473
573 2842232888 2842229732 Bacteria 7475766
574 2842243442 2842237096 Bacteria 6620661
575 2842247304 2842243621 Bacteria 7421798
576 2842251037 2842250916 Bacteria 6579627
577 2842261605 2842257432 Bacteria 7401195
578 2842272777 2842271015 Bacteria 7807131
579 2842282204 2842278818 Bacteria 6340002
580 2842289234 2842285085 Bacteria 6011953
581 2842297682 2842291075 Bacteria 7076806
582 2842307780 2842304105 Bacteria 7023636
583 2842313283 2842311132 Bacteria 6616990
584 2842323163 2842317721 Bacteria 6793725
585 2842347746 2842341865 Bacteria 7003929
586 2842364137 2842363717 Bacteria 6844742
587 2842376954 2842370503 Bacteria 7038661
588 2842384018 2842377471 Bacteria 7140707
589 2842391235 2842384541 Bacteria 7057858
590 2842407440 2842402390 Bacteria 6681310
591 2842413311 2842409023 Bacteria 6687331
592 2842419954 2842415677 Bacteria 6596907
593 2842426342 2842422224 Bacteria 6239196
594 2842430138 2842428310 Bacteria 6767288
595 2842442910 2842441272 Bacteria 6769273
596 2842453566 2842447887 Bacteria 6754142
597 2842464497 2842462802 Bacteria 6588055
598 2842471135 2842469257 Bacteria 6752936
599 2842478851 2842475841 Bacteria 6603183
600 2842486919 2842482326 Bacteria 7212537
601 2842498957 2842495871 Bacteria 6820686
602 2842505830 2842502639 Bacteria 6604161
603 2842518261 2842515876 Bacteria 5436280
604 2842523903 2842521101 Bacteria 6569494
605 2844108239 2844104063 Bacteria 6440972
606 2844461675 2844454524 Bacteria 7952546
607 2851185583 2851182111 Bacteria 6047226
608 2851250741 2851246043 Bacteria 6439203
609 2852395234 2852387548 Bacteria 8025568
610 2854915669 2854911287 Bacteria 5582813
611 2857520759 2857516855 Bacteria 7787325
612 2885204623 2885198086 Bacteria 7212419
613 2885218276 2885211737 Bacteria 7212420
614 2894237493 2894232714 Bacteria 8834183
615 2899796515 2899792073 Bacteria 4926588
616 2899850039 2899845264 Bacteria 5672268
617 2899924869 2899924645 Bacteria 7487985
618 2908673389 2908669403 Bacteria 5740494
619 2909048119 2909042592 Bacteria 6499737
620 2917699199 2917699015 Bacteria 7043791
621 2919102867 2919100787 Bacteria 7710546
622 2919117337 2919114240 Bacteria 5700270
623 2919413218 2919408235 Bacteria 6149349
624 2919717358 2919713450 Bacteria 7431245
625 2926758784 2926754445 Bacteria 5964435
626 2926763685 2926760298 Bacteria 5505990
627 2928039007 2928037797 Bacteria 7273642
628 2928045388 2928044640 Bacteria 7271509
629 2928058285 2928051484 Bacteria 7773759
630 2928064134 2928064002 Bacteria 7419480
631 2928071551 2928070936 Bacteria 8062541
632 2928084492 2928084124 Bacteria 7159212
633 2933009716 2933006813 Bacteria 4912075
634 2933013890 2933011516 Bacteria 5439334
635 2933017774 2933016740 Bacteria 6355406
636 2933574231 2933570622 Bacteria 7023390
637 2933590947 2933586486 Bacteria 7667493
638 2933595703 2933594066 Bacteria 5594265
639 2935901142 2935894831 Bacteria 6620579
640 2935908292 2935901341 Bacteria 7341747
641 2936370654 2936367885 Bacteria 7324495
642 2936382621 2936381700 Bacteria 7006523
643 2945912074 2945909444 Bacteria 7065066
644 2945985645 2945984333 Bacteria 7358892
645 2979091274 2979089926 Bacteria 5670289
646 2979096798 2979095461 Bacteria 5669583
647 2979102519 2979100975 Bacteria 5423623
648 2984509596 2984509177 Bacteria 5274802
649 2984519706 2984518228 Bacteria 5277463
650 2984537933 2984537506 Bacteria 5277481
651 2984604676 2984601300 Bacteria 5455244
652 2996894762 2996893221 Bacteria 5823108
653 3005422038 3005416602 Bacteria 7064308
654 639650825 639633055 Bacteria 7751309
655 650843153 650716007 Bacteria 5573770
656 8003572733 8003570095 Bacteria 5747666
657 8005260528 8005258706 Bacteria 6184835
658 8005275850 8005275841 Bacteria 6929066
659 8005287384 8005282627 Bacteria 6675747
660 8005307428 8005301065 Bacteria 6614431
661 8005311854 8005307578 Bacteria 7395396
662 8005321319 8005314921 Bacteria 7072929
663 8005389236 8005382845 Bacteria 6732062
664 8005396668 8005395548 Bacteria 6806915
665 8005435781 8005430974 Bacteria 6689030
666 8005489917 8005484373 Bacteria 6297373
667 8005503525 8005497431 Bacteria 6477605
668 8005563206 8005556819 Bacteria 6908598
669 8005564755 8005563573 Bacteria 7153261
670 8005575977 8005570704 Bacteria 6957481
671 8005625828 8005619151 Bacteria 7030230
672 8005632083 8005626139 Bacteria 6534237
673 8005650801 8005645114 Bacteria 6950293
674 8005675403 8005668836 Bacteria 6953162
675 8005684438 8005682033 Bacteria 6726518
676 8005688717 8005688590 Bacteria 6610080
677 8005695256 8005695170 Bacteria 6912330
678 8018134549 8018127388 Bacteria 7351159
679 8018154570 8018150411 Bacteria 5549903
680 8018169839 8018163183 Bacteria 7277977
681 8018180733 8018176218 Bacteria 6896178
682 8023685861 8023680758 Bacteria 7729763
683 8024492874 8024486573 Bacteria 6540512
684 8024506926 8024501048 Bacteria 6427847
685 8056381703 8056375014 Bacteria 7006639
686 8057533631 8057529695 Bacteria 6306553
687 8057576503 8057575449 Bacteria 7367519
688 JGI24740J21852_10004429
689 JGI25155J39150_1000015
690 JGI25156J39149_1000007
691 JGI25162J39368_1000285
692 JGI25154J39366_1000051
693 JGI25157J39369_1000012
694 JGI25152J39213_1001255
695 JGI25150J39212_1001782
696 JGI25159J45721_1000012
697 JGI25159J45721_1000354
698 JGI25159J45721_1001088
699 JGI25159J45721_1008601
700 JGI25151J46595_10000341
701 JGI25151J46595_10000540
702 JGI25151J46595_10002343
703 JGI25165J46597_1000102
704 JGI25165J46597_1000198
705 JGI25165J46597_1006636
706 JGI25153J46596_10002155
707 rootH1_10072180
708 rootH1_10077486
709 rootL2_10016804
710 rootH1_10035402
711 rootH1_10097577
712 JGI25160J50197_1000026
713 JGI25160J50197_1000042
714 JGI25160J50197_1001503
715 JGI25160J50197_1001783
716 JGI25161J50226_1000014
717 JGI25161J50226_1000210
718 JGI25161J50226_1001923
719 JGI25161J50226_1004520
720 Ga0055535_1000348
721 Ga0055542_1000021
722 Ga0055526_1000400
723 Ga0055526_1000834
724 Ga0055526_1002782
725 Ga0055526_1005132
726 Ga0055537_1000538
727 Ga0055524_1000470
728 Ga0055524_1001852
729 Ga0055524_1002050
730 Ga0055524_1002393
731 Ga0055524_1013055
732 Ga0055536_1000740
733 Ga0055536_1003099
734 Ga0055536_1005332
735 Ga0055534_1005516
736 Ga0055534_1006100
737 Ga0055528_1000034
738 Ga0055528_1000273
739 Ga0055528_1000790
740 Ga0055528_1001168
741 Ga0055528_1004274
742 Ga0055530_10007026
743 Ga0055530_10013473
744 Ga0055540_1001205
745 Ga0055540_1002741
746 Ga0055531_10000815
747 Ga0055531_10036331
748 Ga0058692_1004276
749 Ga0055543_1000052
750 Ga0055543_1000123
751 Ga0055543_1001022
752 Ga0055543_1004437
753 Ga0065165_1000073
754 Ga0065165_1000174
755 Ga0065165_1000545
756 Ga0065165_1008598
757 Ga0070668_100043111
758 Ga0070659_100041562
759 Ga0070662_100023355
760 Ga0068853_100008938
761 Ga0070665_100261653
762 Ga0070664_100132737
763 Ga0068857_100284354
764 Ga0068854_100300572
765 Ga0068856_100058153
766 Ga0068852_100158459
767 Ga0075365_10000709
768 Ga0075368_10004779
769 Ga0075368_10057065
770 Ga0075363_100121218
771 Ga0075367_10001059
772 Ga0075369_10015733
773 Ga0075369_10128655
774 Ga0075366_10009687
775 Ga0075370_10000218
776 Ga0075370_10005596
777 Ga0075370_10014569
778 Ga0075370_10077712
779 Ga0099826_10000080
780 Ga0099826_10010722
781 Ga0105244_10004015
782 Ga0105240_10000216
783 Ga0105240_10261387
784 Ga0105243_10000385
785 Ga0105243_10000645
786 Ga0105241_10089999
787 Ga0105237_10000536
788 Ga0105238_10390887
789 Ga0123341_1000031
790 Ga0123341_1009876
791 Ga0123342_1026367
792 Ga0105239_10076989
793 Ga0105246_10002250
794 Ga0157347_1002166
795 Ga0157373_10014068
796 Ga0157371_10000002
797 Ga0157370_10000143
798 Ga0157370_10000183
799 Ga0157370_10011289
800 Ga0157370_10354823
801 Ga0171463_1002
802 Ga0182008_10001837
803 Ga0182008_10004807
804 Ga0182008_10013241
805 Ga0182008_10137145
806 Ga0182006_1003343
807 Ga0182007_10000335
808 Ga0182007_10005641
809 Ga0182005_1006674
810 Ga0183365_10483
811 Ga0183363_1341
812 Ga0163161_10000117
813 Ga0163161_10011330
814 Ga0213872_10000097
815 Ga0209435_100006
816 Ga0209436_100140
817 Ga0209436_101914
818 Ga0209672_107446
819 Ga0209147_103930
820 Ga0209437_100042
821 Ga0209437_100062
822 Ga0209258_100058
823 Ga0207425_1000142
824 Ga0207425_1015426
825 Ga0209646_1000015
826 Ga0209026_1000046
827 Ga0209677_100216
828 Ga0209148_1000071
829 Ga0209759_1000005
830 Ga0209129_1000007
831 Ga0209129_1000182
832 Ga0209129_1000618
833 Ga0209129_1006107
834 Ga0209129_1013201
835 Ga0209233_1000082
836 Ga0209233_1000103
837 Ga0209233_1000428
838 Ga0209565_1000038
839 Ga0209673_1000020
840 Ga0209673_1000080
841 Ga0209673_1000607
842 Ga0209673_1000691
843 Ga0209130_1000075
844 Ga0209130_1000076
845 Ga0209130_1000121
846 Ga0209130_1000702
847 Ga0209675_1000256
848 Ga0209675_1008818
849 Ga0209676_1000139
850 Ga0209676_1000383
851 Ga0209676_1003221
852 Ga0209676_1003965
853 Ga0209025_1000056
854 Ga0209025_1000081
855 Ga0209025_1000104
856 Ga0209025_1000461
857 Ga0209025_1000478
858 Ga0209025_1003803
859 Ga0209025_1006981
860 Ga0209564_1000073
861 Ga0209564_1000205
862 Ga0209564_1000278
863 Ga0209564_1001643
864 Ga0209564_1018835
865 Ga0209564_1030840
866 Ga0209758_1000044
867 Ga0209758_1000076
868 Ga0209758_1011122
869 Ga0209758_1028095
870 Ga0209050_1000811
871 Ga0209050_1003053
872 Ga0209050_1028805
873 Ga0209256_1000020
874 Ga0209256_1000411
875 Ga0209256_1000524
876 Ga0209256_1000648
877 Ga0209256_1001460
878 Ga0209256_1002307
879 Ga0209256_1009419
880 Ga0207426_1000001
881 Ga0207426_1000075
882 Ga0207426_1000163
883 Ga0207426_1000169
884 Ga0209051_1000257
885 Ga0209051_1000259
886 Ga0209051_1002814
887 Ga0209051_1015330
888 Ga0209051_1015562
889 Ga0209051_1016535
890 Ga0209257_1000116
891 Ga0209257_1000222
892 Ga0209257_1008629
893 Ga0209257_1008754
894 Ga0207655_1001237
895 Ga0207695_10000319
896 Ga0207695_10222602
897 Ga0207671_10000078
898 Ga0207681_10061607
899 Ga0207706_10089438
900 Ga0207709_10000292
901 Ga0207709_10000908
902 Ga0207709_10010496
903 Ga0207679_10126919
904 Ga0207668_10030029
905 Ga0207702_10039041
906 Ga0207674_10047029
907 Ga0207698_10019559
908 Ga0207698_10183092
909 Ga0209371_1000003
910 Ga0209371_1000373
911 Ga0209371_1016200
912 Ga0209813_10012638
913 Ga0268266_10366498
914 Ga0268265_10065104
915 Ga0268256_1000004
916 Ga0268256_1005781
917 Ga0268256_1017999
918 Ga0307512_10118118
919 Ga0316181_1210191
920 Ga0265327_10063261
921 Ga0307405_10007654
922 Ga0307412_10009952
923 Ga0307510_10000171
924 Ga0436361_0212275
925 Ga0439465_0051964
926 Ga0451806_490553
927 Ga0451845_0112994
928 Ga0451845_0374148
929 Ga0451849_0167718
930 Ga0451843_0095872
931 Ga0466970_0000711
932 Ga0466957_0050682
933 Ga0466959_0228926
934 Ga0466958_0148566
935 Ga0495617_042195
936 Ga0495638_0000524
937 Ga0495605_0004431
938 Ga0495585_0013223
939 Ga0495606_0079201
940 Ga0495610_0000609
941 Ga0495610_0006809
942 Ga0495610_0014900
943 Ga0495616_0000211
944 Ga0495616_0014728
945 Ga0495620_0006400
946 Ga0495631_0000311
947 Ga0495631_0002715
948 Ga0495632_0013724
949 Ga0495632_0014403
950 Ga0495637_0002590
951 Ga0495637_0049679
952 Ga0495643_0020176
953 Ga0495643_0024854
954 Ga0495643_0108644
955 Ga0495654_0005909
956 Ga0495609_0050926
957 Ga0495633_0093390
958 Ga0495611_0064445
959 Ga0495625_0005601
960 Ga0495625_0014508
961 Ga0495625_0030156
962 Ga0495625_0051290
963 Ga0495625_0120279
964 Ga0495588_0012368
965 Ga0495670_0090357
966 Ga0495670_0094926
967 Ga0495671_0002554
968 Ga0495671_0012624
969 Ga0495649_0011291
970 Ga0495649_0021010
971 Ga0495660_0047752
972 Ga0495672_0005527
973 Ga0495683_0009349
974 Ga0495687_003982
975 Ga0495681_0000990
976 Ga0495686_0023447
977 Ga0495686_0030746
978 Ga0495686_0094143
979 Ga0496100_0002935
980 Ga0496101_0052753
981 Ga0496102_0004495
982 Ga0496103_0005804
983 Ga0496104_0177504
984 Ga0496106_0000494
985 Ga0496112_0369113
986 Ga0496113_0078983
987 Ga0496113_0086832
988 Ga0496116_0023178
989 Ga0496116_0025116
990 Ga0496116_0156849
991 Ga0496117_0000016
992 Ga0496117_0001125
993 Ga0496117_0012189
994 Ga0496117_0014509
995 Ga0496117_0087756
996 Ga0496117_0159557
997 Ga0496118_0000153
998 Ga0496118_0000844
999 Ga0496118_0001526
1000 Ga0496118_0009414
1001 Ga0496118_0020755
1002 Ga0496118_0029894
1003 Ga0496118_0053851
1004 Ga0496118_0089181
1005 Ga0496119_0005626
1006 Ga0496119_0008309
1007 Ga0496119_0010000
1008 Ga0496120_0000423
1009 Ga0496121_0014507
1010 Ga0496121_0015484
1011 Ga0496121_0025037
1012 Ga0496121_0034848
1013 Ga0496121_0209183
1014 Ga0496122_0000002
1015 Ga0496122_0004823
1016 Ga0496122_0010739
1017 Ga0496122_0016190
1018 Ga0496122_0017147
1019 Ga0496122_0019188
1020 Ga0496123_0000002
1021 Ga0496123_0004010
1022 Ga0496123_0040552
1023 Ga0496123_0101770
1024 Ga0496124_0000094
1025 Ga0496124_0012132
1026 Ga0496124_0019012
1027 Ga0496124_0029697
1028 Ga0496124_0065890
1029 Ga0496124_0071040
1030 Ga0496124_0146533
1031 Ga0496124_0160886
1032 Ga0496125_0007773
1033 Ga0496125_0008081
1034 Ga0496125_0031955
1035 Ga0496125_0037969
1036 Ga0496125_0042810
1037 Ga0496125_0069242
1038 Ga0496125_0136285
1039 Ga0496126_0045887
1040 Ga0496126_0063807
1041 Ga0495678_050005
1042 Ga0495682_0068237
1043 Ga0501033_0075350
1044 Ga0501042_0000073
1045 Ga0501083_0000028
1046 nmdc:mga03683_41174_c1
1047 nmdc:mga00v17_53_c1
1048 nmdc:mga0yw44_3659_c1
1049 nmdc:mga0yw44_943_c1
1050 nmdc:mga0k408_32434_c2
1051 nmdc:mga0k408_6618_c1
1052 nmdc:mga06z11_162720_c1
1053 nmdc:mga04h51_25802_c1
1054 nmdc:mga07m45_2880_c1
1055 nmdc:mga07m45_506_c1
1056 nmdc:mga07m45_57117_c1
1057 nmdc:mga0sz30_7069_c1
1058 Ga0500610_0010501
1059 Ga0500610_0091649
1060 Ga0500578_0044322
1061 Ga0500651_0000015
1062 Ga0500651_0055977
1063 Ga0500560_000090
1064 Ga0500572_000986
1065 Ga0500593_009847
1066 Ga0500594_0000799
1067 Ga0500594_0001286
1068 Ga0500607_000393
1069 Ga0500607_014088
1070 Ga0500618_003647
1071 Ga0500618_008662
1072 Ga0500655_000179
1073 Ga0500658_0000371
1074 Ga0500658_0000395
1075 Ga0500658_0001219
1076 Ga0500658_0010513
1077 Ga0500561_0000022
1078 Ga0500568_0001291
1079 Ga0500568_0001498
1080 Ga0500568_0004887
1081 Ga0500588_0023402
1082 Ga0500616_0002543
1083 Ga0500616_0009127
1084 Ga0500622_0000343
1085 Ga0500624_001002
1086 Ga0500627_0000241
1087 Ga0500627_0035563
1088 Ga0500633_0023428
1089 Ga0500634_0019993
1090 Ga0500636_0000113
1091 Ga0500636_0109816
1092 2805932902
1093 2509390792
1094 2509442027
1095 2510137405
1096 2510893798
1097 2511135671
1098 2511199464
1099 2513228632
1100 2513572021
1101 2513575799
1102 2513633500
1103 2513712348
1104 2513998687
1105 2514024482
1106 2515644157
1107 2515657794
1108 2515743813
1109 2517081254
1110 2517100357
1111 2520375426
1112 2530648891
1113 2537877534
1114 2548696982
1115 2554245439
1116 2559296731
1117 2585222301
1118 2585269573
1119 2585272746
1120 2585281396
1121 2585327713
1122 2585332418
1123 2585396338
1124 2585405243
1125 2585526346
1126 2585535618
1127 2585538901
1128 2585544746
1129 2585556021
1130 2585562414
1131 2585823449
1132 2585836852
1133 2585896860
1134 2585906419
1135 2587981841
1136 2599602777
1137 2599623891
1138 2599671490
1139 2599681497
1140 2599693100
1141 2600194539
1142 2601610398
1143 2601747272
1144 2616294237
1145 2616310508
1146 2616552003
1147 2617386604
1148 2643917287
1149 2644104377
1150 2644147527
1151 2644210125
1152 2644313370
1153 2644331625
1154 2644400429
1155 2644501443
1156 2644511969
1157 2644520859
1158 2644541788
1159 2644612995
1160 2644653677
1161 2644672430
1162 2644744015
1163 2671114495
1164 2719183983
1165 2719389728
1166 2719669283
1167 2719729556
1168 2720494299
1169 2720610633
1170 2720616521
1171 2720627866
1172 2720771449
1173 2721143806
1174 2721156481
1175 2721161181
1176 2721403371
1177 2722837134
1178 2723030710
1179 2723563209
1180 2723571203
1181 2724034947
1182 2724040710
1183 2724086998
1184 2724100709
1185 2724107961
1186 2725951848
1187 2730105176
1188 2730162123
1189 2730295242
1190 2738879504
1191 2739034320
1192 2753358316
1193 2753459216
1194 2758638914
1195 2766068072
1196 2778175205
1197 2793295949
1198 2793312638
1199 2793321820
1200 2793336336
1201 2793340591
1202 2793348519
1203 2793367483
1204 2805930870
1205 2806043120
1206 2806051072
1207 2806057756
1208 2806065526
1209 2806075236
1210 2808987184
1211 2819557478
1212 2819597361
1213 2819607630
1214 2819641631
1215 2821129046
1216 2835313160
1217 2838019692
1218 2838027100
1219 2838032119
1220 2838067033
1221 2838072560
1222 2838662427
1223 2838669137
1224 2838678015
1225 2838686394
1226 2838688273
1227 2838700813
1228 2838701202
1229 2838714029
1230 2838717079
1231 2838722310
1232 2838727828
1233 2838732452
1234 2838741369
1235 2838745130
1236 2841764306
1237 2841845227
1238 2841849485
1239 2841852013
1240 2841861472
1241 2841865894
1242 2842083501
1243 2842111741
1244 2842124463
1245 2842127766
1246 2842132908
1247 2842144930
1248 2842146733
1249 2842154901
1250 2842158911
1251 2842166342
1252 2842173400
1253 2842178522
1254 2842182525
1255 2842190187
1256 2842200574
1257 2842208450
1258 2842214501
1259 2842227220
1260 2842232888
1261 2842243442
1262 2842247304
1263 2842251037
1264 2842261605
1265 2842272777
1266 2842282204
1267 2842289234
1268 2842297682
1269 2842307780
1270 2842313283
1271 2842323163
1272 2842347746
1273 2842364137
1274 2842376954
1275 2842384018
1276 2842391235
1277 2842407440
1278 2842413311
1279 2842419954
1280 2842426342
1281 2842430138
1282 2842442910
1283 2842453566
1284 2842464497
1285 2842471135
1286 2842478851
1287 2842486919
1288 2842498957
1289 2842505830
1290 2842518261
1291 2842523903
1292 2844108239
1293 2844461675
1294 2851185583
1295 2851250741
1296 2852395234
1297 2854915669
1298 2857520759
1299 2885204623
1300 2885218276
1301 2894237493
1302 2899796515
1303 2899850039
1304 2899924869
1305 2908673389
1306 2909048119
1307 2917699199
1308 2919102867
1309 2919117337
1310 2919413218
1311 2919717358
1312 2926758784
1313 2926763685
1314 2928039007
1315 2928045388
1316 2928058285
1317 2928064134
1318 2928071551
1319 2928084492
1320 2933009716
1321 2933013890
1322 2933017774
1323 2933574231
1324 2933590947
1325 2933595703
1326 2935901142
1327 2935908292
1328 2936370654
1329 2936382621
1330 2945912074
1331 2945985645
1332 2979091274
1333 2979096798
1334 2979102519
1335 2984509596
1336 2984519706
1337 2984537933
1338 2984604676
1339 2996894762
1340 3005422038
1341 639650825
1342 650843153
1343 8003572733
1344 8005260528
1345 8005275850
1346 8005287384
1347 8005307428
1348 8005311854
1349 8005321319
1350 8005389236
1351 8005396668
1352 8005435781
1353 8005489917
1354 8005503525
1355 8005563206
1356 8005564755
1357 8005575977
1358 8005625828
1359 8005632083
1360 8005650801
1361 8005675403
1362 8005684438
1363 8005688717
1364 8005695256
1365 8018134549
1366 8018154570
1367 8018169839
1368 8018180733
1369 8023685861
1370 8024492874
1371 8024506926
1372 8056381703
1373 8057533631
1374 8057576503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

5

292

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ket-assembly1.cif.gz_B flavin-utilizing monooxygenase (ox) domain of hybrid polyketide/non-ribosomal peptide synthetase 0.8024 10 229
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.7842 10 238
1luc-assembly1.cif.gz_A bacterial luciferase 0.7789 10 230
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.7788 10 238
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.7756 10 238
ID Description Score Start End Superfamily
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8359 10 238 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7857 10 238 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.782 10 238 3.20.20.30
3fgcC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7756 10 238 3.20.20.30
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7664 10 238 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A420ZVA5-F1-model_v4 deleted 0.9767 6 239
AF-G8SIV2-F1-model_v4 Alkanal monooxygenase beta chain (EC 1.14.14.3) 0.9602 74 239 GO:0047646
AF-A0A7H8XIK0-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.949 10 239 GO:0005829
GO:0016705
AF-A0A259S580-F1-model_v4 Luciferase-like domain-containing protein 0.9421 29 238 GO:0005829
GO:0016705
AF-A0A3S3JAU4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9229 116 239 GO:0016705

Map