F475381

General Info

Members Datasets Scaffolds Average Seq Length
689 304 1378 172

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10012250|Ga0105242_100122503
Length 195
Sequence MKGLLKPAVGSTDHILGNANAPLELVQYGDYQCPFCGAAYPIIKNIQYKLGDDLKFVFRNFPLAEIHPNAFNAAVAAEAAALQKKFWKMHDIIYENQEALAWDDLFAYAKAINIDVEQFKKDISKQEVIDKVENDFESGVRSGVNGTPSFYINGKKYNGDYEERIFTRYLKSLLTGDLQEENSKIASTKQTIYSR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
100 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
101 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
102 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
103 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
104 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
188 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
299 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
300 2739367663 Pedobacter sp. YR510 Isolate Unclassified
301 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
302 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
303 2914759650 Rhizosphaericola mali Isolate Rhizosphere
304 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0.29
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 7.11
Rhizosphere 90.13
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10012250 3300009176 Bacteria 6600
2 SwRhRL2b_contig_610777 2162886007 Bacteria 11342
3 rootL2_10283068 3300003322 Bacteria 2801
4 JGI25405J52794_10041439 3300003911 Bacteria 974
5 Ga0065714_10064661 3300005288 Bacteria 25144
6 Ga0070690_100098445 3300005330 Bacteria 1936
7 Ga0070670_100015263 3300005331 Bacteria 6593
8 Ga0070670_100169470 3300005331 Bacteria 1894
9 Ga0070670_100265828 3300005331 Eukaryota 1496
10 Ga0070670_100299193 3300005331 Unclassified 1407
11 Ga0068869_100010811 3300005334 Bacteria 5965
12 Ga0068869_100135849 3300005334 Bacteria 1895
13 Ga0070666_10000627 3300005335 Bacteria 21215
14 Ga0070666_10755368 3300005335 Bacteria 715
15 Ga0070680_100066018 3300005336 Bacteria 2966
16 Ga0070680_100164734 3300005336 Bacteria 1864
17 Ga0070680_100255586 3300005336 Bacteria 1482
18 Ga0070680_101082661 3300005336 Bacteria 693
19 Ga0070682_100009335 3300005337 Bacteria 5553
20 Ga0068868_100060596 3300005338 Bacteria 2997
21 Ga0068868_100147808 3300005338 Bacteria 1933
22 Ga0068868_100167604 3300005338 Bacteria 1817
23 Ga0070660_100114695 3300005339 Bacteria 2146
24 Ga0070689_100445382 3300005340 Bacteria 1101
25 Ga0070689_100668186 3300005340 Bacteria 905
26 Ga0070687_100575893 3300005343 Bacteria 770
27 Ga0070692_10008042 3300005345 Bacteria 4681
28 Ga0070692_10023978 3300005345 Bacteria 2995
29 Ga0070692_10204918 3300005345 Archaea 1157
30 Ga0070668_100042915 3300005347 Bacteria 3466
31 Ga0070668_100365274 3300005347 Bacteria 1225
32 Ga0070668_100692439 3300005347 Unclassified 898
33 Ga0070669_100117350 3300005353 Bacteria 2026
34 Ga0070675_100296046 3300005354 Bacteria 1425
35 Ga0070675_100321005 3300005354 Bacteria 1368
36 Ga0070671_100021517 3300005355 Bacteria 5267
37 Ga0070671_100151177 3300005355 Bacteria 1960
38 Ga0070674_100006045 3300005356 Bacteria 7040
39 Ga0070674_100068028 3300005356 Bacteria 2507
40 Ga0070674_100101225 3300005356 Bacteria 2100
41 Ga0070674_100119951 3300005356 Bacteria 1946
42 Ga0070673_100044733 3300005364 Bacteria 3429
43 Ga0070673_100423277 3300005364 Bacteria 1194
44 Ga0070673_100557247 3300005364 Bacteria 1042
45 Ga0070673_101061049 3300005364 Bacteria 756
46 Ga0070659_100098722 3300005366 Bacteria 2348
47 Ga0070659_100130404 3300005366 Bacteria 2041
48 Ga0070659_100192411 3300005366 Bacteria 1677
49 Ga0070667_100012670 3300005367 Bacteria 6972
50 Ga0070667_100080277 3300005367 Bacteria 2790
51 Ga0070667_100090273 3300005367 Bacteria 2633
52 Ga0070667_100266819 3300005367 Bacteria 1534
53 Ga0070667_100970764 3300005367 Bacteria 792
54 Ga0070703_10066382 3300005406 Bacteria 1193
55 Ga0070703_10215224 3300005406 Bacteria 762
56 Ga0070714_100515365 3300005435 Bacteria 1142
57 Ga0070713_100094499 3300005436 Bacteria 2578
58 Ga0070710_10051478 3300005437 Bacteria 2312
59 Ga0070701_10436103 3300005438 Archaea 838
60 Ga0070711_100039882 3300005439 Bacteria 3164
61 Ga0070711_100260752 3300005439 Bacteria 1363
62 Ga0070705_100294748 3300005440 Bacteria 1159
63 Ga0070705_100335899 3300005440 Bacteria 1096
64 Ga0070705_100491995 3300005440 Bacteria 929
65 Ga0070694_100002930 3300005444 Bacteria 10143
66 Ga0070694_100011408 3300005444 Bacteria 5502
67 Ga0070708_100021079 3300005445 Bacteria 5504
68 Ga0070708_100040336 3300005445 Bacteria 4088
69 Ga0070708_100107460 3300005445 Bacteria 2562
70 Ga0070708_100113763 3300005445 Bacteria 2489
71 Ga0070708_100654735 3300005445 Bacteria 990
72 Ga0070708_101377949 3300005445 Bacteria 658
73 Ga0070663_100017488 3300005455 Bacteria 4681
74 Ga0070663_100067812 3300005455 Bacteria 2589
75 Ga0070663_100102828 3300005455 Bacteria 2135
76 Ga0070678_100045705 3300005456 Bacteria 3134
77 Ga0070662_100128988 3300005457 Bacteria 1947
78 Ga0070662_100226118 3300005457 Bacteria 1495
79 Ga0070662_100351836 3300005457 Bacteria 1207
80 Ga0070662_100359938 3300005457 Bacteria 1194
81 Ga0068867_100056046 3300005459 Bacteria 2915
82 Ga0070685_10153761 3300005466 Unclassified 1460
83 Ga0070706_100005441 3300005467 Bacteria 12129
84 Ga0070706_100084808 3300005467 Bacteria 2935
85 Ga0070706_100165166 3300005467 Bacteria 2067
86 Ga0070706_100337127 3300005467 Bacteria 1406
87 Ga0070706_100998051 3300005467 Unclassified 772
88 Ga0070707_100035086 3300005468 Bacteria 4784
89 Ga0070707_100063372 3300005468 Bacteria 3548
90 Ga0070707_100124819 3300005468 Bacteria 2500
91 Ga0070707_100263494 3300005468 Bacteria 1676
92 Ga0070707_100360185 3300005468 Bacteria 1413
93 Ga0070707_100643133 3300005468 Bacteria 1023
94 Ga0070698_100041209 3300005471 Bacteria 4742
95 Ga0070698_100397155 3300005471 Bacteria 1312
96 Ga0070698_100436636 3300005471 Bacteria 1244
97 Ga0070699_100000140 3300005518 Bacteria 67871
98 Ga0070699_100056719 3300005518 Bacteria 3392
99 Ga0070699_100063115 3300005518 Bacteria 3212
100 Ga0070699_100197019 3300005518 Bacteria 1790
101 Ga0070699_100588993 3300005518 Bacteria 1014
102 Ga0070679_100799881 3300005530 Bacteria 886
103 Ga0070697_100042934 3300005536 Bacteria 3659
104 Ga0070697_100060067 3300005536 Bacteria 3098
105 Ga0068853_100120587 3300005539 Bacteria 2339
106 Ga0070672_100097862 3300005543 Bacteria 2376
107 Ga0070672_100738887 3300005543 Unclassified 863
108 Ga0070686_100011588 3300005544 Bacteria 5004
109 Ga0070686_100165622 3300005544 Bacteria 1559
110 Ga0070695_100062604 3300005545 Bacteria 2416
111 Ga0070695_100232029 3300005545 Bacteria 1334
112 Ga0070695_100242593 3300005545 Archaea 1308
113 Ga0070696_100060799 3300005546 Bacteria 2642
114 Ga0070696_100070798 3300005546 Bacteria 2454
115 Ga0070696_100118998 3300005546 Bacteria 1910
116 Ga0070696_100160219 3300005546 Bacteria 1657
117 Ga0070696_100207632 3300005546 Bacteria 1465
118 Ga0070696_100241937 3300005546 Bacteria 1361
119 Ga0070693_100098804 3300005547 Bacteria 1774
120 Ga0070693_100569390 3300005547 Bacteria 813
121 Ga0070665_100035176 3300005548 Bacteria 5036
122 Ga0070704_100060974 3300005549 Bacteria 2697
123 Ga0070704_100129940 3300005549 Bacteria 1950
124 Ga0070704_100150811 3300005549 Bacteria 1827
125 Ga0070704_100150893 3300005549 Bacteria 1827
126 Ga0070704_100246283 3300005549 Bacteria 1465
127 Ga0070704_101482506 3300005549 Unclassified 624
128 Ga0068855_100086709 3300005563 Bacteria 3620
129 Ga0068855_100152355 3300005563 Bacteria 2628
130 Ga0068855_100159345 3300005563 Bacteria 2563
131 Ga0068854_100263574 3300005578 Bacteria 1380
132 Ga0068856_100199993 3300005614 Bacteria 2013
133 Ga0070702_100048932 3300005615 Bacteria 2408
134 Ga0070702_100072087 3300005615 Bacteria 2043
135 Ga0068852_100102783 3300005616 Bacteria 2583
136 Ga0068859_100000127 3300005617 Bacteria 72136
137 Ga0068859_100286175 3300005617 Bacteria 1741
138 Ga0068859_100388710 3300005617 Bacteria 1491
139 Ga0068859_100953539 3300005617 Bacteria 941
140 Ga0068864_100014831 3300005618 Bacteria 6474
141 Ga0068864_101149429 3300005618 Bacteria 774
142 Ga0068866_10008804 3300005718 Bacteria 4264
143 Ga0068866_10024189 3300005718 Bacteria 2836
144 Ga0068866_10207045 3300005718 Bacteria 1175
145 Ga0068861_100080593 3300005719 Bacteria 2547
146 Ga0068861_100101197 3300005719 Bacteria 2292
147 Ga0068861_100138000 3300005719 Bacteria 1986
148 Ga0068861_100145852 3300005719 Bacteria 1937
149 Ga0068863_100001425 3300005841 Bacteria 23686
150 Ga0068863_100014264 3300005841 Bacteria 7654
151 Ga0068863_100128650 3300005841 Bacteria 2417
152 Ga0068863_100156849 3300005841 Bacteria 2179
153 Ga0068863_100390484 3300005841 Bacteria 1360
154 Ga0068863_100630583 3300005841 Bacteria 1062
155 Ga0068858_100002322 3300005842 Bacteria 19226
156 Ga0068858_100090912 3300005842 Bacteria 2841
157 Ga0068860_100006124 3300005843 Bacteria 12098
158 Ga0068860_100625373 3300005843 Eukaryota 1083
159 Ga0068862_100008495 3300005844 Bacteria 8494
160 Ga0068862_101513255 3300005844 Bacteria 677
161 Ga0081455_10079741 3300005937 Bacteria 2687
162 Ga0081540_1001413 3300005983 Bacteria 20777
163 Ga0081539_10037907 3300005985 Bacteria 2864
164 Ga0070717_10234283 3300006028 Bacteria 1617
165 Ga0070715_10244001 3300006163 Bacteria 935
166 Ga0070716_100023423 3300006173 Bacteria 3275
167 Ga0070716_100032927 3300006173 Bacteria 2831
168 Ga0070712_100037655 3300006175 Bacteria 3299
169 Ga0070712_100262227 3300006175 Bacteria 1385
170 Ga0097621_100001854 3300006237 Bacteria 14499
171 Ga0097621_100011238 3300006237 Bacteria 6592
172 Ga0097621_100102927 3300006237 Bacteria 2405
173 Ga0068871_100009082 3300006358 Bacteria 7183
174 Ga0068871_100033710 3300006358 Bacteria 4057
175 Ga0068871_100174803 3300006358 Unclassified 1843
176 Ga0068871_100589513 3300006358 Bacteria 1010
177 Ga0068871_101188469 3300006358 Eukaryota 715
178 Ga0068871_101420740 3300006358 Bacteria 654
179 Ga0068871_101587851 3300006358 Unclassified 619
180 Ga0075428_100185100 3300006844 Bacteria 2254
181 Ga0075430_100398031 3300006846 Bacteria 1137
182 Ga0075430_100691331 3300006846 Bacteria 841
183 Ga0075430_101036775 3300006846 Bacteria 676
184 Ga0075431_100519930 3300006847 Bacteria 1180
185 Ga0075433_10004820 3300006852 Bacteria 10539
186 Ga0075433_10021649 3300006852 Bacteria 5393
187 Ga0075433_10357553 3300006852 Bacteria 1290
188 Ga0075434_100072498 3300006871 Bacteria 3436
189 Ga0075434_100132074 3300006871 Bacteria 2516
190 Ga0075434_100667629 3300006871 Bacteria 1057
191 Ga0075434_100798459 3300006871 Bacteria 960
192 Ga0075429_100484009 3300006880 Bacteria 1084
193 Ga0075429_100572219 3300006880 Bacteria 990
194 Ga0068865_100167267 3300006881 Bacteria 1682
195 Ga0068865_100170417 3300006881 Bacteria 1668
196 Ga0068865_100875244 3300006881 Bacteria 780
197 Ga0075436_100116217 3300006914 Bacteria 1869
198 Ga0097620_100000127 3300006931 Bacteria 72136
199 Ga0097620_100286195 3300006931 Bacteria 1741
200 Ga0097620_100388642 3300006931 Bacteria 1491
201 Ga0097620_100953747 3300006931 Bacteria 941
202 Ga0075435_100016301 3300007076 Bacteria 5601
203 Ga0075435_100110130 3300007076 Bacteria 2290
204 Ga0075435_100485408 3300007076 Bacteria 1067
205 Ga0099794_10134293 3300007265 Bacteria 1251
206 Ga0105240_10000176 3300009093 Bacteria 130109
207 Ga0105240_10375068 3300009093 Bacteria 1608
208 Ga0105240_10386661 3300009093 Bacteria 1579
209 Ga0111539_10162911 3300009094 Bacteria 2608
210 Ga0105245_10028427 3300009098 Bacteria 4933
211 Ga0105245_10057741 3300009098 Bacteria 3491
212 Ga0105245_10069447 3300009098 Bacteria 3195
213 Ga0105245_10123432 3300009098 Bacteria 2422
214 Ga0105245_10230778 3300009098 Bacteria 1790
215 Ga0105245_11806846 3300009098 Bacteria 664
216 Ga0105247_10037482 3300009101 Bacteria 2959
217 Ga0105247_10108611 3300009101 Bacteria 1783
218 Ga0114129_10048057 3300009147 Bacteria 5995
219 Ga0114129_10108006 3300009147 Bacteria 3843
220 Ga0114129_10275846 3300009147 Bacteria 2248
221 Ga0114129_10369128 3300009147 Bacteria 1897
222 Ga0114129_10547972 3300009147 Unclassified 1504
223 Ga0114129_11837213 3300009147 Bacteria 736
224 Ga0105243_10193111 3300009148 Bacteria 1780
225 Ga0105243_10242740 3300009148 Bacteria 1604
226 Ga0105243_10397454 3300009148 Bacteria 1279
227 Ga0105241_10018098 3300009174 Bacteria 5181
228 Ga0105241_10044024 3300009174 Bacteria 3381
229 Ga0105241_10143315 3300009174 Eukaryota 1948
230 Ga0105241_10199473 3300009174 Bacteria 1670
231 Ga0105242_10011213 3300009176 Bacteria 6887
232 Ga0105242_10341319 3300009176 Bacteria 1380
233 Ga0105242_10480506 3300009176 Bacteria 1177
234 Ga0105248_10039365 3300009177 Bacteria 5293
235 Ga0105248_11136730 3300009177 Bacteria 883
236 Ga0105248_12318684 3300009177 Bacteria 611
237 Ga0105237_10057817 3300009545 Bacteria 3881
238 Ga0105237_10258837 3300009545 Bacteria 1743
239 Ga0105237_10272359 3300009545 Bacteria 1696
240 Ga0105238_10152753 3300009551 Bacteria 2284
241 Ga0105249_10002916 3300009553 Bacteria 14751
242 Ga0105249_10015833 3300009553 Bacteria 6682
243 Ga0105249_10143189 3300009553 Bacteria 2294
244 Ga0105249_10210254 3300009553 Bacteria 1909
245 Ga0105249_10416059 3300009553 Eukaryota 1377
246 Ga0105249_10578025 3300009553 Eukaryota 1177
247 Ga0105239_10001803 3300010375 Bacteria 28139
248 Ga0105239_10022425 3300010375 Bacteria 6960
249 Ga0105239_10236866 3300010375 Bacteria 2049
250 Ga0105239_10631456 3300010375 Bacteria 1223
251 Ga0105246_10035736 3300011119 Bacteria 3323
252 Ga0105246_10104316 3300011119 Bacteria 2070
253 Ga0157343_1005014 3300012488 Bacteria 843
254 Ga0157314_1002441 3300012500 Bacteria 1285
255 Ga0157313_1007398 3300012503 Bacteria 854
256 Ga0157315_1002063 3300012508 Bacteria 1210
257 Ga0157316_1000580 3300012510 Bacteria 1977
258 Ga0157327_1001612 3300012512 Bacteria 1445
259 Ga0157373_10002566 3300013100 Bacteria 13803
260 Ga0157373_10067270 3300013100 Unclassified 2534
261 Ga0157371_10263054 3300013102 Bacteria 1244
262 Ga0157370_10000350 3300013104 Bacteria 58500
263 Ga0157374_10474292 3300013296 Bacteria 1254
264 Ga0157378_10022553 3300013297 Bacteria 5540
265 Ga0157378_10106625 3300013297 Bacteria 2563
266 Ga0157378_10226343 3300013297 Bacteria 1780
267 Ga0157378_10529102 3300013297 Bacteria 1181
268 Ga0157378_10882564 3300013297 Bacteria 924
269 Ga0163162_10003738 3300013306 Bacteria 14578
270 Ga0163162_10036456 3300013306 Bacteria 4902
271 Ga0163162_10061130 3300013306 Bacteria 3805
272 Ga0163162_10063575 3300013306 Bacteria 3734
273 Ga0163162_10079356 3300013306 Bacteria 3349
274 Ga0163162_10142462 3300013306 Bacteria 2511
275 Ga0163162_10466006 3300013306 Bacteria 1395
276 Ga0157372_10135653 3300013307 Bacteria 2834
277 Ga0157372_10194750 3300013307 Bacteria 2348
278 Ga0157372_10709079 3300013307 Bacteria 1171
279 Ga0157375_10000122 3300013308 Bacteria 76245
280 Ga0157375_10001143 3300013308 Bacteria 22951
281 Ga0157375_10024183 3300013308 Bacteria 5619
282 Ga0157375_10211127 3300013308 Bacteria 2099
283 Ga0157375_10573934 3300013308 Bacteria 1288
284 Ga0157375_10983422 3300013308 Bacteria 984
285 Ga0163163_10237514 3300014325 Unclassified 1872
286 Ga0157380_10023312 3300014326 Bacteria 4668
287 Ga0157380_10154804 3300014326 Bacteria 1986
288 Ga0157380_10585900 3300014326 Bacteria 1101
289 Ga0157377_10064258 3300014745 Bacteria 2104
290 Ga0157379_10088615 3300014968 Bacteria 2775
291 Ga0157379_10102720 3300014968 Bacteria 2565
292 Ga0157379_10191154 3300014968 Bacteria 1850
293 Ga0157379_10285249 3300014968 Bacteria 1503
294 Ga0157376_10000068 3300014969 Bacteria 83824
295 Ga0157376_10121511 3300014969 Bacteria 2316
296 Ga0157376_10130180 3300014969 Bacteria 2244
297 Ga0157376_11309416 3300014969 Bacteria 755
298 Ga0163161_10001898 3300017792 Bacteria 15260
299 Ga0163161_10012650 3300017792 Bacteria 5863
300 Ga0163161_10044797 3300017792 Bacteria 3188
301 Ga0163161_10065153 3300017792 Bacteria 2659
302 Ga0163161_11224476 3300017792 Bacteria 650
303 Ga0207697_10155139 3300025315 Bacteria 997
304 Ga0207656_10012285 3300025321 Bacteria 3254
305 Ga0207653_10088211 3300025885 Bacteria 1083
306 Ga0207653_10092238 3300025885 Bacteria 1062
307 Ga0207653_10103378 3300025885 Bacteria 1010
308 Ga0207692_10106922 3300025898 Bacteria 1545
309 Ga0207642_10030225 3300025899 Unclassified 2254
310 Ga0207642_10037405 3300025899 Bacteria 2091
311 Ga0207642_10073591 3300025899 Bacteria 1635
312 Ga0207642_10084212 3300025899 Bacteria 1553
313 Ga0207710_10100357 3300025900 Bacteria 1364
314 Ga0207688_10164911 3300025901 Bacteria 1315
315 Ga0207680_10000277 3300025903 Bacteria 24642
316 Ga0207680_10207574 3300025903 Bacteria 1338
317 Ga0207647_10174995 3300025904 Unclassified 1249
318 Ga0207685_10111290 3300025905 Bacteria 1187
319 Ga0207699_10071871 3300025906 Bacteria 2117
320 Ga0207699_10200023 3300025906 Bacteria 1353
321 Ga0207645_10000616 3300025907 Bacteria 29529
322 Ga0207684_10032107 3300025910 Bacteria 4465
323 Ga0207684_10073408 3300025910 Bacteria 2905
324 Ga0207654_10000739 3300025911 Bacteria 18174
325 Ga0207654_10005289 3300025911 Bacteria 6516
326 Ga0207654_10285077 3300025911 Bacteria 1118
327 Ga0207695_10000102 3300025913 Bacteria 257838
328 Ga0207671_10003903 3300025914 Bacteria 14535
329 Ga0207671_10244864 3300025914 Bacteria 1409
330 Ga0207693_10001218 3300025915 Bacteria 22944
331 Ga0207693_10003568 3300025915 Bacteria 13297
332 Ga0207663_10016221 3300025916 Bacteria 4124
333 Ga0207663_10505700 3300025916 Bacteria 939
334 Ga0207660_10086926 3300025917 Bacteria 2309
335 Ga0207660_10252312 3300025917 Bacteria 1393
336 Ga0207662_10084892 3300025918 Bacteria 1938
337 Ga0207657_10007119 3300025919 Bacteria 11485
338 Ga0207652_10236667 3300025921 Bacteria 1646
339 Ga0207652_10416584 3300025921 Bacteria 1212
340 Ga0207652_10683409 3300025921 Bacteria 916
341 Ga0207646_10004873 3300025922 Bacteria 14383
342 Ga0207646_10135891 3300025922 Bacteria 2214
343 Ga0207646_10164619 3300025922 Bacteria 2002
344 Ga0207646_10466940 3300025922 Bacteria 1138
345 Ga0207646_10556664 3300025922 Bacteria 1031
346 Ga0207646_10874563 3300025922 Bacteria 798
347 Ga0207681_10006230 3300025923 Bacteria 7316
348 Ga0207681_10204256 3300025923 Bacteria 1519
349 Ga0207681_10632025 3300025923 Bacteria 887
350 Ga0207694_11113069 3300025924 Bacteria 668
351 Ga0207650_10165049 3300025925 Bacteria 1757
352 Ga0207659_10117924 3300025926 Bacteria 2029
353 Ga0207687_10090401 3300025927 Bacteria 2231
354 Ga0207687_10393603 3300025927 Bacteria 1138
355 Ga0207700_10671287 3300025928 Bacteria 924
356 Ga0207664_10065627 3300025929 Bacteria 2906
357 Ga0207644_10017673 3300025931 Bacteria 4822
358 Ga0207644_10520838 3300025931 Bacteria 982
359 Ga0207690_10178044 3300025932 Bacteria 1599
360 Ga0207706_10000385 3300025933 Bacteria 48316
361 Ga0207706_10108556 3300025933 Bacteria 2442
362 Ga0207706_10137554 3300025933 Bacteria 2149
363 Ga0207706_10255801 3300025933 Bacteria 1529
364 Ga0207706_10685761 3300025933 Bacteria 876
365 Ga0207686_10001916 3300025934 Bacteria 11515
366 Ga0207686_10062412 3300025934 Bacteria 2366
367 Ga0207686_10082678 3300025934 Unclassified 2100
368 Ga0207686_10800727 3300025934 Bacteria 755
369 Ga0207709_10017918 3300025935 Bacteria 3961
370 Ga0207709_10068540 3300025935 Bacteria 2243
371 Ga0207709_10157847 3300025935 Bacteria 1579
372 Ga0207670_10374364 3300025936 Bacteria 1133
373 Ga0207669_10004098 3300025937 Bacteria 6387
374 Ga0207669_10027490 3300025937 Bacteria 3116
375 Ga0207669_10212021 3300025937 Archaea 1415
376 Ga0207704_10002499 3300025938 Bacteria 8289
377 Ga0207704_10641038 3300025938 Bacteria 874
378 Ga0207691_10021867 3300025940 Bacteria 6037
379 Ga0207691_10102815 3300025940 Bacteria 2548
380 Ga0207691_10184825 3300025940 Unclassified 1820
381 Ga0207691_10555616 3300025940 Bacteria 973
382 Ga0207711_10013800 3300025941 Bacteria 6708
383 Ga0207711_10132563 3300025941 Bacteria 2235
384 Ga0207689_10000482 3300025942 Bacteria 37605
385 Ga0207689_10046772 3300025942 Bacteria 3575
386 Ga0207689_10051173 3300025942 Bacteria 3405
387 Ga0207689_10104822 3300025942 Bacteria 2323
388 Ga0207689_10111482 3300025942 Bacteria 2249
389 Ga0207689_10534732 3300025942 Bacteria 984
390 Ga0207667_10084847 3300025949 Bacteria 3278
391 Ga0207667_10330186 3300025949 Bacteria 1557
392 Ga0207667_10338829 3300025949 Bacteria 1535
393 Ga0207667_10393983 3300025949 Bacteria 1410
394 Ga0207651_10098927 3300025960 Bacteria 2159
395 Ga0207651_10529468 3300025960 Bacteria 1022
396 Ga0207651_10541025 3300025960 Bacteria 1012
397 Ga0207712_10026126 3300025961 Bacteria 3888
398 Ga0207712_10069316 3300025961 Bacteria 2530
399 Ga0207712_10086811 3300025961 Bacteria 2293
400 Ga0207712_10098255 3300025961 Unclassified 2171
401 Ga0207712_10718056 3300025961 Unclassified 873
402 Ga0207668_10011429 3300025972 Bacteria 5395
403 Ga0207668_10034722 3300025972 Bacteria 3351
404 Ga0207668_10121708 3300025972 Bacteria 1977
405 Ga0207668_10141616 3300025972 Bacteria 1850
406 Ga0207668_11094515 3300025972 Eukaryota 714
407 Ga0207640_10016409 3300025981 Bacteria 4308
408 Ga0207640_10096568 3300025981 Bacteria 2060
409 Ga0207658_10111062 3300025986 Bacteria 2167
410 Ga0207658_10465198 3300025986 Bacteria 1122
411 Ga0207658_10507956 3300025986 Unclassified 1074
412 Ga0207677_10169130 3300026023 Bacteria 1707
413 Ga0207703_10009655 3300026035 Bacteria 7575
414 Ga0207703_10065222 3300026035 Bacteria 2992
415 Ga0207703_10189062 3300026035 Bacteria 1822
416 Ga0207639_10048040 3300026041 Bacteria 3228
417 Ga0207678_10018523 3300026067 Bacteria 6115
418 Ga0207678_10147391 3300026067 Bacteria 2009
419 Ga0207708_10037444 3300026075 Bacteria 3695
420 Ga0207641_10000229 3300026088 Bacteria 72315
421 Ga0207641_10010011 3300026088 Bacteria 7799
422 Ga0207641_10479643 3300026088 Bacteria 1205
423 Ga0207648_10000020 3300026089 Bacteria 141759
424 Ga0207648_10000150 3300026089 Bacteria 70019
425 Ga0207648_10014754 3300026089 Bacteria 7210
426 Ga0207648_10231515 3300026089 Bacteria 1643
427 Ga0207648_10271977 3300026089 Bacteria 1514
428 Ga0207648_10292009 3300026089 Bacteria 1460
429 Ga0207676_10065763 3300026095 Bacteria 2888
430 Ga0207675_100012651 3300026118 Bacteria 7884
431 Ga0207675_100030408 3300026118 Bacteria 5030
432 Ga0207675_100104076 3300026118 Bacteria 2675
433 Ga0207675_100107775 3300026118 Bacteria 2627
434 Ga0207675_100178985 3300026118 Bacteria 2030
435 Ga0207683_10000131 3300026121 Bacteria 61423
436 Ga0207683_10001984 3300026121 Bacteria 18111
437 Ga0207683_10068228 3300026121 Bacteria 3139
438 Ga0207698_10029274 3300026142 Bacteria 3942
439 Ga0207698_10535162 3300026142 Bacteria 1146
440 Ga0268266_10057189 3300028379 Bacteria 3356
441 Ga0268265_10071613 3300028380 Bacteria 2701
442 Ga0268265_10112983 3300028380 Bacteria 2221
443 Ga0268264_10012662 3300028381 Bacteria 6944
444 Ga0268264_10026595 3300028381 Bacteria 4729
445 Ga0268264_10350635 3300028381 Bacteria 1405
446 Ga0268264_10376719 3300028381 Bacteria 1358
447 Ga0307517_10467911 3300028786 Bacteria 649
448 Ga0307515_10004330 3300028794 Bacteria 29440
449 Ga0307515_10428396 3300028794 Unclassified 942
450 Ga0307513_10206809 3300031456 Bacteria 1798
451 Ga0307513_10343739 3300031456 Bacteria 1242
452 Ga0307509_10215601 3300031507 Bacteria 1739
453 Ga0307509_10615983 3300031507 Bacteria 757
454 Ga0307516_10002260 3300031730 Bacteria 25992
455 Ga0307416_100436083 3300032002 Bacteria 1359
456 Ga0307415_100408981 3300032126 Bacteria 1161
457 Ga0373930_0002201 3300034816 Bacteria 2999
458 Ga0373950_0159465 3300034818 Bacteria 520
459 Ga0373958_0014970 3300034819 Bacteria 1363
460 Ga0373938_0002212 3300034957 Bacteria 3122
461 Ga0373928_0002672 3300035084 Bacteria 3449
462 Ga0373929_0048279 3300035085 Bacteria 966
463 Ga0373934_0246630 3300035086 Bacteria 738
464 Ga0373940_0002390 3300035088 Bacteria 3642
465 Ga0373949_0022962 3300035090 Bacteria 1441
466 Ga0373951_0016698 3300035091 Bacteria 1657
467 Ga0373952_0002245 3300035092 Bacteria 3484
468 Ga0373939_0006100 3300035114 Bacteria 2896
469 Ga0373941_0023291 3300035115 Bacteria 1766
470 Ga0373954_0021302 3300035118 Bacteria 2934
471 Ga0373956_0176368 3300035119 Bacteria 1009
472 Ga0373960_0067681 3300035121 Bacteria 1097
473 Ga0373943_0018834 3300035170 Bacteria 3174
474 Ga0373943_0443115 3300035170 Bacteria 754
475 Ga0373942_0025666 3300035207 Bacteria 1520
476 Ga0373961_0003361 3300035241 Bacteria 3973
477 Ga0373962_0004835 3300035242 Bacteria 3254
478 Ga0373931_0047655 3300035691 Bacteria 2268
479 Ga0373935_0170402 3300035692 Bacteria 1489
480 Ga0373927_0384997 3300035695 Bacteria 925
481 Ga0373933_0373448 3300035724 Bacteria 928
482 Ga0373947_0001218 3300035725 Bacteria 15844
483 Ga0373937_0139580 3300036401 Bacteria 2267
484 Ga0373937_0231789 3300036401 Bacteria 1739
485 Ga0373925_0051083 3300037068 Bacteria 3085
486 Ga0373925_0173515 3300037068 Bacteria 1703
487 Ga0373925_0475848 3300037068 Unclassified 1024
488 Ga0395899_0005657 3300037312 Bacteria 9701
489 Ga0395899_0008819 3300037312 Bacteria 7761
490 Ga0395899_0026522 3300037312 Bacteria 4373
491 Ga0395899_0107925 3300037312 Bacteria 2003
492 Ga0395899_0147744 3300037312 Bacteria 1668
493 Ga0395899_0190247 3300037312 Bacteria 1436
494 Ga0395899_0249190 3300037312 Bacteria 1219
495 Ga0395899_0396715 3300037312 Bacteria 914
496 Ga0395900_0011104 3300037418 Bacteria 9205
497 Ga0395900_0024874 3300037418 Bacteria 6128
498 Ga0395900_0033610 3300037418 Bacteria 5278
499 Ga0395900_0055654 3300037418 Bacteria 4073
500 Ga0395900_0168457 3300037418 Bacteria 2231
501 Ga0395900_0169378 3300037418 Bacteria 2224
502 Ga0395900_0218635 3300037418 Bacteria 1921
503 Ga0395900_0221935 3300037418 Bacteria 1904
504 Ga0395900_0263100 3300037418 Bacteria 1722
505 Ga0395900_0388587 3300037418 Unclassified 1362
506 Ga0395900_0769722 3300037418 Bacteria 892
507 Ga0395900_1558227 3300037418 Bacteria 572
508 Ga0395898_0018743 3300037466 Bacteria 7053
509 Ga0395898_0031704 3300037466 Bacteria 5279
510 Ga0395898_0034212 3300037466 Bacteria 5066
511 Ga0395898_0056618 3300037466 Bacteria 3821
512 Ga0395898_0247968 3300037466 Bacteria 1698
513 Ga0395898_0282054 3300037466 Bacteria 1585
514 Ga0395898_0422535 3300037466 Bacteria 1270
515 Ga0395898_0821141 3300037466 Bacteria 869
516 Ga0395898_0911483 3300037466 Bacteria 817
517 Ga0395898_1438301 3300037466 Bacteria 616
518 Ga0395905_0009484 3300037471 Bacteria 9511
519 Ga0395905_0020867 3300037471 Bacteria 6203
520 Ga0395905_0026383 3300037471 Bacteria 5478
521 Ga0395905_0060894 3300037471 Bacteria 3530
522 Ga0395905_0086078 3300037471 Bacteria 2945
523 Ga0395905_0090257 3300037471 Bacteria 2872
524 Ga0395905_0287968 3300037471 Bacteria 1529
525 Ga0395901_0010438 3300038443 Bacteria 9409
526 Ga0395901_0012073 3300038443 Bacteria 8763
527 Ga0395901_0013056 3300038443 Bacteria 8432
528 Ga0395901_0027431 3300038443 Bacteria 5851
529 Ga0395901_0029959 3300038443 Bacteria 5605
530 Ga0395901_0037080 3300038443 Bacteria 5042
531 Ga0395901_0106280 3300038443 Bacteria 2946
532 Ga0395901_0226799 3300038443 Bacteria 1951
533 Ga0395901_0305080 3300038443 Bacteria 1650
534 Ga0395901_0319228 3300038443 Bacteria 1607
535 Ga0395901_0849134 3300038443 Bacteria 898
536 Ga0439454_042762 3300042011 Bacteria 746
537 Ga0451577_0399793 3300042876 Bacteria 1247
538 Ga0451577_0886709 3300042876 Bacteria 804
539 Ga0453683_0167130 3300044673 Bacteria 1393
540 Ga0495603_0112114 3300046455 Bacteria 1591
541 Ga0495629_0000904 3300046459 Bacteria 23809
542 Ga0495641_0011641 3300046461 Bacteria 4991
543 Ga0495582_0000767 3300046473 Bacteria 17774
544 Ga0495582_0002417 3300046473 Bacteria 10426
545 Ga0495605_0145571 3300046474 Bacteria 1060
546 Ga0495605_0202150 3300046474 Bacteria 865
547 Ga0495639_0004751 3300046475 Bacteria 5842
548 Ga0495662_0168170 3300046476 Bacteria 1080
549 Ga0495662_0302208 3300046476 Bacteria 787
550 Ga0495584_0059925 3300046491 Bacteria 1914
551 Ga0495584_0068634 3300046491 Bacteria 1781
552 Ga0495584_0149001 3300046491 Bacteria 1189
553 Ga0495594_0016517 3300046499 Bacteria 3889
554 Ga0495596_0102672 3300046500 Bacteria 1111
555 Ga0495607_0189348 3300046501 Bacteria 1026
556 Ga0495616_0109198 3300046513 Bacteria 1287
557 Ga0495630_0036692 3300046517 Bacteria 3664
558 Ga0495631_0106938 3300046518 Bacteria 1203
559 Ga0495632_0044576 3300046519 Bacteria 2213
560 Ga0495663_0019891 3300046525 Unclassified 1925
561 Ga0495663_0032964 3300046525 Bacteria 1545
562 Ga0495663_0033623 3300046525 Bacteria 1532
563 Ga0495642_0487747 3300046528 Bacteria 545
564 Ga0495665_0059985 3300046531 Bacteria 2008
565 Ga0495665_0077519 3300046531 Bacteria 1749
566 Ga0495609_0140738 3300046538 Bacteria 1030
567 Ga0495621_0230642 3300046539 Bacteria 752
568 Ga0495645_0337151 3300046543 Bacteria 975
569 Ga0495633_0000002 3300046558 Bacteria 488754
570 Ga0495633_0007017 3300046558 Bacteria 6569
571 Ga0495633_0299394 3300046558 Bacteria 731
572 Ga0495656_0018377 3300046615 Bacteria 2683
573 Ga0495656_0280388 3300046615 Bacteria 849
574 Ga0495656_0383950 3300046615 Bacteria 732
575 Ga0495656_0410713 3300046615 Bacteria 709
576 Ga0495656_0452374 3300046615 Bacteria 677
577 Ga0495668_0006002 3300046616 Bacteria 8063
578 Ga0495611_0359415 3300046648 Bacteria 668
579 Ga0495625_0046335 3300046660 Bacteria 3138
580 Ga0495659_0173648 3300046664 Bacteria 875
581 Ga0495659_0174472 3300046664 Archaea 873
582 Ga0495588_0040104 3300046674 Bacteria 2387
583 Ga0495588_0086027 3300046674 Bacteria 1644
584 Ga0495647_0088848 3300046681 Bacteria 1264
585 Ga0495647_0097865 3300046681 Bacteria 1211
586 Ga0495647_0152891 3300046681 Unclassified 990
587 Ga0495658_0002631 3300046683 Bacteria 9020
588 Ga0495658_0105351 3300046683 Bacteria 1689
589 Ga0495658_0443731 3300046683 Bacteria 829
590 Ga0495669_0079982 3300046684 Bacteria 1499
591 Ga0495669_0233749 3300046684 Bacteria 882
592 Ga0495613_0002527 3300046689 Bacteria 13762
593 Ga0495613_0059054 3300046689 Bacteria 2813
594 Ga0495624_0198475 3300046690 Bacteria 1219
595 Ga0495581_0000328 3300047315 Bacteria 23476
596 Ga0495581_0010626 3300047315 Bacteria 5322
597 Ga0495581_0046042 3300047315 Unclassified 2521
598 Ga0495636_0030017 3300047318 Bacteria 2221
599 Ga0495672_0050970 3300047320 Bacteria 2440
600 Ga0495676_0037974 3300047321 Bacteria 4004
601 Ga0495676_0152317 3300047321 Bacteria 1644
602 Ga0495677_0054157 3300047445 Bacteria 1480
603 Ga0495679_109844 3300047446 Bacteria 760
604 Ga0496100_0083638 3300048903 Bacteria 2161
605 Ga0496100_0216682 3300048903 Bacteria 1403
606 Ga0496100_0231589 3300048903 Bacteria 1359
607 Ga0496100_0340433 3300048903 Bacteria 1131
608 Ga0496101_0005292 3300048904 Bacteria 8218
609 Ga0496102_0061364 3300048905 Bacteria 3441
610 Ga0496102_0066224 3300048905 Bacteria 3310
611 Ga0496102_0119101 3300048905 Bacteria 2465
612 Ga0496102_1323054 3300048905 Bacteria 640
613 Ga0496103_0062416 3300048906 Bacteria 2319
614 Ga0496103_0093935 3300048906 Bacteria 1894
615 Ga0496103_0583523 3300048906 Bacteria 713
616 Ga0496103_0719386 3300048906 Bacteria 632
617 Ga0496103_0786085 3300048906 Bacteria 601
618 Ga0496104_0014384 3300048907 Bacteria 7149
619 Ga0496104_0061121 3300048907 Bacteria 3570
620 Ga0496104_0515930 3300048907 Bacteria 1106
621 Ga0496105_0012122 3300048908 Bacteria 6825
622 Ga0496105_0019371 3300048908 Bacteria 5488
623 Ga0496105_0293409 3300048908 Bacteria 1309
624 Ga0496106_0034422 3300048909 Bacteria 3782
625 Ga0496106_0036435 3300048909 Bacteria 3680
626 Ga0496106_0075965 3300048909 Bacteria 2574
627 Ga0496106_0656700 3300048909 Unclassified 838
628 Ga0496106_0664870 3300048909 Bacteria 832
629 Ga0496106_0807912 3300048909 Bacteria 744
630 Ga0496107_0020961 3300048910 Bacteria 4619
631 Ga0496107_0128323 3300048910 Bacteria 1871
632 Ga0496107_0317357 3300048910 Bacteria 1160
633 Ga0496108_0014772 3300048911 Bacteria 6373
634 Ga0496108_0172586 3300048911 Bacteria 1871
635 Ga0496108_0274154 3300048911 Bacteria 1468
636 Ga0496109_0011851 3300048912 Bacteria 7506
637 Ga0496109_0041958 3300048912 Bacteria 4143
638 Ga0496110_0008458 3300048913 Bacteria 8283
639 Ga0496110_0181830 3300048913 Bacteria 1909
640 Ga0496111_0363167 3300048914 Bacteria 1071
641 Ga0496111_0539624 3300048914 Bacteria 857
642 Ga0496112_0005429 3300048915 Bacteria 11022
643 Ga0496112_0090392 3300048915 Bacteria 3030
644 Ga0496112_0127996 3300048915 Bacteria 2510
645 Ga0496112_0201948 3300048915 Bacteria 1947
646 Ga0496113_0004015 3300048916 Bacteria 8952
647 Ga0496113_0237593 3300048916 Bacteria 1453
648 Ga0496114_0002384 3300048917 Bacteria 14292
649 Ga0496114_0050087 3300048917 Bacteria 3476
650 Ga0496114_0110728 3300048917 Bacteria 2352
651 Ga0496115_0030547 3300048918 Bacteria 4239
652 Ga0496115_0038641 3300048918 Bacteria 3788
653 Ga0496121_0701366 3300048924 Bacteria 609
654 Ga0496122_0148373 3300048925 Bacteria 1453
655 Ga0496123_0082411 3300048926 Bacteria 1950
656 Ga0496124_0072232 3300048927 Bacteria 2858
657 Ga0496125_0048009 3300048928 Bacteria 3564
658 Ga0496125_0399577 3300048928 Unclassified 804
659 Ga0501047_0002379 3300049581 Bacteria 17992
660 Ga0501070_0035241 3300049586 Bacteria 4183
661 Ga0501075_0727516 3300049591 Bacteria 756
662 Ga0501079_0140569 3300049741 Bacteria 1881
663 Ga0501044_0004693 3300049823 Bacteria 15280
664 nmdc:mga05p37_132378_c1 3300050507 Unclassified 3059
665 nmdc:mga05p37_761427_c1 3300050507 Bacteria 1066
666 nmdc:mga0qj67_678147_c1 3300050509 Bacteria 821
667 nmdc:mga0qj67_894377_c1 3300050509 Bacteria 700
668 nmdc:mga06r32_690936_c1 3300050510 Bacteria 986
669 nmdc:mga06r32_94928_c1 3300050510 Bacteria 2918
670 nmdc:mga08y16_628520_c1 3300050511 Unclassified 1080
671 nmdc:mga0n895_5113_c1 3300050512 Bacteria 10900
672 nmdc:mga0n895_604582_c1 3300050512 Bacteria 1099
673 nmdc:mga0rr50_25768_c1 3300050513 Bacteria 4093
674 nmdc:mga0rr50_446917_c1 3300050513 Bacteria 1096
675 nmdc:mga0rr50_495782_c1 3300050513 Bacteria 1038
676 nmdc:mga08x19_58342_c1 3300050514 Bacteria 2497
677 nmdc:mga0a205_43365_c1 3300050515 Bacteria 4338
678 nmdc:mga0a205_52695_c1 3300050515 Bacteria 3927
679 nmdc:mga0a205_643575_c1 3300050515 Bacteria 912
680 Ga0500559_0048394 3300053136 Bacteria 1870
681 Ga0587098_001124 3300059604 Bacteria 1953
682 Ga0587119_001432 3300059658 Bacteria 1966
683 2587941804 2585428115 Bacteria 4420269
684 2588234444 2585428187 Bacteria 4629388
685 2739644171 2739367663 Bacteria 5040914
686 2819680857 2818991460 Bacteria 7595395
687 2857631055 2857627736 Bacteria 5625397
688 2914762957 2914759650 Bacteria 4701441
689 2993484613 2993480792 Bacteria 4022225
690 Ga0105242_10012250
691 SwRhRL2b_contig_610777
692 rootL2_10283068
693 JGI25405J52794_10041439
694 Ga0065714_10064661
695 Ga0070690_100098445
696 Ga0070670_100015263
697 Ga0070670_100169470
698 Ga0070670_100265828
699 Ga0070670_100299193
700 Ga0068869_100010811
701 Ga0068869_100135849
702 Ga0070666_10000627
703 Ga0070666_10755368
704 Ga0070680_100066018
705 Ga0070680_100164734
706 Ga0070680_100255586
707 Ga0070680_101082661
708 Ga0070682_100009335
709 Ga0068868_100060596
710 Ga0068868_100147808
711 Ga0068868_100167604
712 Ga0070660_100114695
713 Ga0070689_100445382
714 Ga0070689_100668186
715 Ga0070687_100575893
716 Ga0070692_10008042
717 Ga0070692_10023978
718 Ga0070692_10204918
719 Ga0070668_100042915
720 Ga0070668_100365274
721 Ga0070668_100692439
722 Ga0070669_100117350
723 Ga0070675_100296046
724 Ga0070675_100321005
725 Ga0070671_100021517
726 Ga0070671_100151177
727 Ga0070674_100006045
728 Ga0070674_100068028
729 Ga0070674_100101225
730 Ga0070674_100119951
731 Ga0070673_100044733
732 Ga0070673_100423277
733 Ga0070673_100557247
734 Ga0070673_101061049
735 Ga0070659_100098722
736 Ga0070659_100130404
737 Ga0070659_100192411
738 Ga0070667_100012670
739 Ga0070667_100080277
740 Ga0070667_100090273
741 Ga0070667_100266819
742 Ga0070667_100970764
743 Ga0070703_10066382
744 Ga0070703_10215224
745 Ga0070714_100515365
746 Ga0070713_100094499
747 Ga0070710_10051478
748 Ga0070701_10436103
749 Ga0070711_100039882
750 Ga0070711_100260752
751 Ga0070705_100294748
752 Ga0070705_100335899
753 Ga0070705_100491995
754 Ga0070694_100002930
755 Ga0070694_100011408
756 Ga0070708_100021079
757 Ga0070708_100040336
758 Ga0070708_100107460
759 Ga0070708_100113763
760 Ga0070708_100654735
761 Ga0070708_101377949
762 Ga0070663_100017488
763 Ga0070663_100067812
764 Ga0070663_100102828
765 Ga0070678_100045705
766 Ga0070662_100128988
767 Ga0070662_100226118
768 Ga0070662_100351836
769 Ga0070662_100359938
770 Ga0068867_100056046
771 Ga0070685_10153761
772 Ga0070706_100005441
773 Ga0070706_100084808
774 Ga0070706_100165166
775 Ga0070706_100337127
776 Ga0070706_100998051
777 Ga0070707_100035086
778 Ga0070707_100063372
779 Ga0070707_100124819
780 Ga0070707_100263494
781 Ga0070707_100360185
782 Ga0070707_100643133
783 Ga0070698_100041209
784 Ga0070698_100397155
785 Ga0070698_100436636
786 Ga0070699_100000140
787 Ga0070699_100056719
788 Ga0070699_100063115
789 Ga0070699_100197019
790 Ga0070699_100588993
791 Ga0070679_100799881
792 Ga0070697_100042934
793 Ga0070697_100060067
794 Ga0068853_100120587
795 Ga0070672_100097862
796 Ga0070672_100738887
797 Ga0070686_100011588
798 Ga0070686_100165622
799 Ga0070695_100062604
800 Ga0070695_100232029
801 Ga0070695_100242593
802 Ga0070696_100060799
803 Ga0070696_100070798
804 Ga0070696_100118998
805 Ga0070696_100160219
806 Ga0070696_100207632
807 Ga0070696_100241937
808 Ga0070693_100098804
809 Ga0070693_100569390
810 Ga0070665_100035176
811 Ga0070704_100060974
812 Ga0070704_100129940
813 Ga0070704_100150811
814 Ga0070704_100150893
815 Ga0070704_100246283
816 Ga0070704_101482506
817 Ga0068855_100086709
818 Ga0068855_100152355
819 Ga0068855_100159345
820 Ga0068854_100263574
821 Ga0068856_100199993
822 Ga0070702_100048932
823 Ga0070702_100072087
824 Ga0068852_100102783
825 Ga0068859_100000127
826 Ga0068859_100286175
827 Ga0068859_100388710
828 Ga0068859_100953539
829 Ga0068864_100014831
830 Ga0068864_101149429
831 Ga0068866_10008804
832 Ga0068866_10024189
833 Ga0068866_10207045
834 Ga0068861_100080593
835 Ga0068861_100101197
836 Ga0068861_100138000
837 Ga0068861_100145852
838 Ga0068863_100001425
839 Ga0068863_100014264
840 Ga0068863_100128650
841 Ga0068863_100156849
842 Ga0068863_100390484
843 Ga0068863_100630583
844 Ga0068858_100002322
845 Ga0068858_100090912
846 Ga0068860_100006124
847 Ga0068860_100625373
848 Ga0068862_100008495
849 Ga0068862_101513255
850 Ga0081455_10079741
851 Ga0081540_1001413
852 Ga0081539_10037907
853 Ga0070717_10234283
854 Ga0070715_10244001
855 Ga0070716_100023423
856 Ga0070716_100032927
857 Ga0070712_100037655
858 Ga0070712_100262227
859 Ga0097621_100001854
860 Ga0097621_100011238
861 Ga0097621_100102927
862 Ga0068871_100009082
863 Ga0068871_100033710
864 Ga0068871_100174803
865 Ga0068871_100589513
866 Ga0068871_101188469
867 Ga0068871_101420740
868 Ga0068871_101587851
869 Ga0075428_100185100
870 Ga0075430_100398031
871 Ga0075430_100691331
872 Ga0075430_101036775
873 Ga0075431_100519930
874 Ga0075433_10004820
875 Ga0075433_10021649
876 Ga0075433_10357553
877 Ga0075434_100072498
878 Ga0075434_100132074
879 Ga0075434_100667629
880 Ga0075434_100798459
881 Ga0075429_100484009
882 Ga0075429_100572219
883 Ga0068865_100167267
884 Ga0068865_100170417
885 Ga0068865_100875244
886 Ga0075436_100116217
887 Ga0097620_100000127
888 Ga0097620_100286195
889 Ga0097620_100388642
890 Ga0097620_100953747
891 Ga0075435_100016301
892 Ga0075435_100110130
893 Ga0075435_100485408
894 Ga0099794_10134293
895 Ga0105240_10000176
896 Ga0105240_10375068
897 Ga0105240_10386661
898 Ga0111539_10162911
899 Ga0105245_10028427
900 Ga0105245_10057741
901 Ga0105245_10069447
902 Ga0105245_10123432
903 Ga0105245_10230778
904 Ga0105245_11806846
905 Ga0105247_10037482
906 Ga0105247_10108611
907 Ga0114129_10048057
908 Ga0114129_10108006
909 Ga0114129_10275846
910 Ga0114129_10369128
911 Ga0114129_10547972
912 Ga0114129_11837213
913 Ga0105243_10193111
914 Ga0105243_10242740
915 Ga0105243_10397454
916 Ga0105241_10018098
917 Ga0105241_10044024
918 Ga0105241_10143315
919 Ga0105241_10199473
920 Ga0105242_10011213
921 Ga0105242_10341319
922 Ga0105242_10480506
923 Ga0105248_10039365
924 Ga0105248_11136730
925 Ga0105248_12318684
926 Ga0105237_10057817
927 Ga0105237_10258837
928 Ga0105237_10272359
929 Ga0105238_10152753
930 Ga0105249_10002916
931 Ga0105249_10015833
932 Ga0105249_10143189
933 Ga0105249_10210254
934 Ga0105249_10416059
935 Ga0105249_10578025
936 Ga0105239_10001803
937 Ga0105239_10022425
938 Ga0105239_10236866
939 Ga0105239_10631456
940 Ga0105246_10035736
941 Ga0105246_10104316
942 Ga0157343_1005014
943 Ga0157314_1002441
944 Ga0157313_1007398
945 Ga0157315_1002063
946 Ga0157316_1000580
947 Ga0157327_1001612
948 Ga0157373_10002566
949 Ga0157373_10067270
950 Ga0157371_10263054
951 Ga0157370_10000350
952 Ga0157374_10474292
953 Ga0157378_10022553
954 Ga0157378_10106625
955 Ga0157378_10226343
956 Ga0157378_10529102
957 Ga0157378_10882564
958 Ga0163162_10003738
959 Ga0163162_10036456
960 Ga0163162_10061130
961 Ga0163162_10063575
962 Ga0163162_10079356
963 Ga0163162_10142462
964 Ga0163162_10466006
965 Ga0157372_10135653
966 Ga0157372_10194750
967 Ga0157372_10709079
968 Ga0157375_10000122
969 Ga0157375_10001143
970 Ga0157375_10024183
971 Ga0157375_10211127
972 Ga0157375_10573934
973 Ga0157375_10983422
974 Ga0163163_10237514
975 Ga0157380_10023312
976 Ga0157380_10154804
977 Ga0157380_10585900
978 Ga0157377_10064258
979 Ga0157379_10088615
980 Ga0157379_10102720
981 Ga0157379_10191154
982 Ga0157379_10285249
983 Ga0157376_10000068
984 Ga0157376_10121511
985 Ga0157376_10130180
986 Ga0157376_11309416
987 Ga0163161_10001898
988 Ga0163161_10012650
989 Ga0163161_10044797
990 Ga0163161_10065153
991 Ga0163161_11224476
992 Ga0207697_10155139
993 Ga0207656_10012285
994 Ga0207653_10088211
995 Ga0207653_10092238
996 Ga0207653_10103378
997 Ga0207692_10106922
998 Ga0207642_10030225
999 Ga0207642_10037405
1000 Ga0207642_10073591
1001 Ga0207642_10084212
1002 Ga0207710_10100357
1003 Ga0207688_10164911
1004 Ga0207680_10000277
1005 Ga0207680_10207574
1006 Ga0207647_10174995
1007 Ga0207685_10111290
1008 Ga0207699_10071871
1009 Ga0207699_10200023
1010 Ga0207645_10000616
1011 Ga0207684_10032107
1012 Ga0207684_10073408
1013 Ga0207654_10000739
1014 Ga0207654_10005289
1015 Ga0207654_10285077
1016 Ga0207695_10000102
1017 Ga0207671_10003903
1018 Ga0207671_10244864
1019 Ga0207693_10001218
1020 Ga0207693_10003568
1021 Ga0207663_10016221
1022 Ga0207663_10505700
1023 Ga0207660_10086926
1024 Ga0207660_10252312
1025 Ga0207662_10084892
1026 Ga0207657_10007119
1027 Ga0207652_10236667
1028 Ga0207652_10416584
1029 Ga0207652_10683409
1030 Ga0207646_10004873
1031 Ga0207646_10135891
1032 Ga0207646_10164619
1033 Ga0207646_10466940
1034 Ga0207646_10556664
1035 Ga0207646_10874563
1036 Ga0207681_10006230
1037 Ga0207681_10204256
1038 Ga0207681_10632025
1039 Ga0207694_11113069
1040 Ga0207650_10165049
1041 Ga0207659_10117924
1042 Ga0207687_10090401
1043 Ga0207687_10393603
1044 Ga0207700_10671287
1045 Ga0207664_10065627
1046 Ga0207644_10017673
1047 Ga0207644_10520838
1048 Ga0207690_10178044
1049 Ga0207706_10000385
1050 Ga0207706_10108556
1051 Ga0207706_10137554
1052 Ga0207706_10255801
1053 Ga0207706_10685761
1054 Ga0207686_10001916
1055 Ga0207686_10062412
1056 Ga0207686_10082678
1057 Ga0207686_10800727
1058 Ga0207709_10017918
1059 Ga0207709_10068540
1060 Ga0207709_10157847
1061 Ga0207670_10374364
1062 Ga0207669_10004098
1063 Ga0207669_10027490
1064 Ga0207669_10212021
1065 Ga0207704_10002499
1066 Ga0207704_10641038
1067 Ga0207691_10021867
1068 Ga0207691_10102815
1069 Ga0207691_10184825
1070 Ga0207691_10555616
1071 Ga0207711_10013800
1072 Ga0207711_10132563
1073 Ga0207689_10000482
1074 Ga0207689_10046772
1075 Ga0207689_10051173
1076 Ga0207689_10104822
1077 Ga0207689_10111482
1078 Ga0207689_10534732
1079 Ga0207667_10084847
1080 Ga0207667_10330186
1081 Ga0207667_10338829
1082 Ga0207667_10393983
1083 Ga0207651_10098927
1084 Ga0207651_10529468
1085 Ga0207651_10541025
1086 Ga0207712_10026126
1087 Ga0207712_10069316
1088 Ga0207712_10086811
1089 Ga0207712_10098255
1090 Ga0207712_10718056
1091 Ga0207668_10011429
1092 Ga0207668_10034722
1093 Ga0207668_10121708
1094 Ga0207668_10141616
1095 Ga0207668_11094515
1096 Ga0207640_10016409
1097 Ga0207640_10096568
1098 Ga0207658_10111062
1099 Ga0207658_10465198
1100 Ga0207658_10507956
1101 Ga0207677_10169130
1102 Ga0207703_10009655
1103 Ga0207703_10065222
1104 Ga0207703_10189062
1105 Ga0207639_10048040
1106 Ga0207678_10018523
1107 Ga0207678_10147391
1108 Ga0207708_10037444
1109 Ga0207641_10000229
1110 Ga0207641_10010011
1111 Ga0207641_10479643
1112 Ga0207648_10000020
1113 Ga0207648_10000150
1114 Ga0207648_10014754
1115 Ga0207648_10231515
1116 Ga0207648_10271977
1117 Ga0207648_10292009
1118 Ga0207676_10065763
1119 Ga0207675_100012651
1120 Ga0207675_100030408
1121 Ga0207675_100104076
1122 Ga0207675_100107775
1123 Ga0207675_100178985
1124 Ga0207683_10000131
1125 Ga0207683_10001984
1126 Ga0207683_10068228
1127 Ga0207698_10029274
1128 Ga0207698_10535162
1129 Ga0268266_10057189
1130 Ga0268265_10071613
1131 Ga0268265_10112983
1132 Ga0268264_10012662
1133 Ga0268264_10026595
1134 Ga0268264_10350635
1135 Ga0268264_10376719
1136 Ga0307517_10467911
1137 Ga0307515_10004330
1138 Ga0307515_10428396
1139 Ga0307513_10206809
1140 Ga0307513_10343739
1141 Ga0307509_10215601
1142 Ga0307509_10615983
1143 Ga0307516_10002260
1144 Ga0307416_100436083
1145 Ga0307415_100408981
1146 Ga0373930_0002201
1147 Ga0373950_0159465
1148 Ga0373958_0014970
1149 Ga0373938_0002212
1150 Ga0373928_0002672
1151 Ga0373929_0048279
1152 Ga0373934_0246630
1153 Ga0373940_0002390
1154 Ga0373949_0022962
1155 Ga0373951_0016698
1156 Ga0373952_0002245
1157 Ga0373939_0006100
1158 Ga0373941_0023291
1159 Ga0373954_0021302
1160 Ga0373956_0176368
1161 Ga0373960_0067681
1162 Ga0373943_0018834
1163 Ga0373943_0443115
1164 Ga0373942_0025666
1165 Ga0373961_0003361
1166 Ga0373962_0004835
1167 Ga0373931_0047655
1168 Ga0373935_0170402
1169 Ga0373927_0384997
1170 Ga0373933_0373448
1171 Ga0373947_0001218
1172 Ga0373937_0139580
1173 Ga0373937_0231789
1174 Ga0373925_0051083
1175 Ga0373925_0173515
1176 Ga0373925_0475848
1177 Ga0395899_0005657
1178 Ga0395899_0008819
1179 Ga0395899_0026522
1180 Ga0395899_0107925
1181 Ga0395899_0147744
1182 Ga0395899_0190247
1183 Ga0395899_0249190
1184 Ga0395899_0396715
1185 Ga0395900_0011104
1186 Ga0395900_0024874
1187 Ga0395900_0033610
1188 Ga0395900_0055654
1189 Ga0395900_0168457
1190 Ga0395900_0169378
1191 Ga0395900_0218635
1192 Ga0395900_0221935
1193 Ga0395900_0263100
1194 Ga0395900_0388587
1195 Ga0395900_0769722
1196 Ga0395900_1558227
1197 Ga0395898_0018743
1198 Ga0395898_0031704
1199 Ga0395898_0034212
1200 Ga0395898_0056618
1201 Ga0395898_0247968
1202 Ga0395898_0282054
1203 Ga0395898_0422535
1204 Ga0395898_0821141
1205 Ga0395898_0911483
1206 Ga0395898_1438301
1207 Ga0395905_0009484
1208 Ga0395905_0020867
1209 Ga0395905_0026383
1210 Ga0395905_0060894
1211 Ga0395905_0086078
1212 Ga0395905_0090257
1213 Ga0395905_0287968
1214 Ga0395901_0010438
1215 Ga0395901_0012073
1216 Ga0395901_0013056
1217 Ga0395901_0027431
1218 Ga0395901_0029959
1219 Ga0395901_0037080
1220 Ga0395901_0106280
1221 Ga0395901_0226799
1222 Ga0395901_0305080
1223 Ga0395901_0319228
1224 Ga0395901_0849134
1225 Ga0439454_042762
1226 Ga0451577_0399793
1227 Ga0451577_0886709
1228 Ga0453683_0167130
1229 Ga0495603_0112114
1230 Ga0495629_0000904
1231 Ga0495641_0011641
1232 Ga0495582_0000767
1233 Ga0495582_0002417
1234 Ga0495605_0145571
1235 Ga0495605_0202150
1236 Ga0495639_0004751
1237 Ga0495662_0168170
1238 Ga0495662_0302208
1239 Ga0495584_0059925
1240 Ga0495584_0068634
1241 Ga0495584_0149001
1242 Ga0495594_0016517
1243 Ga0495596_0102672
1244 Ga0495607_0189348
1245 Ga0495616_0109198
1246 Ga0495630_0036692
1247 Ga0495631_0106938
1248 Ga0495632_0044576
1249 Ga0495663_0019891
1250 Ga0495663_0032964
1251 Ga0495663_0033623
1252 Ga0495642_0487747
1253 Ga0495665_0059985
1254 Ga0495665_0077519
1255 Ga0495609_0140738
1256 Ga0495621_0230642
1257 Ga0495645_0337151
1258 Ga0495633_0000002
1259 Ga0495633_0007017
1260 Ga0495633_0299394
1261 Ga0495656_0018377
1262 Ga0495656_0280388
1263 Ga0495656_0383950
1264 Ga0495656_0410713
1265 Ga0495656_0452374
1266 Ga0495668_0006002
1267 Ga0495611_0359415
1268 Ga0495625_0046335
1269 Ga0495659_0173648
1270 Ga0495659_0174472
1271 Ga0495588_0040104
1272 Ga0495588_0086027
1273 Ga0495647_0088848
1274 Ga0495647_0097865
1275 Ga0495647_0152891
1276 Ga0495658_0002631
1277 Ga0495658_0105351
1278 Ga0495658_0443731
1279 Ga0495669_0079982
1280 Ga0495669_0233749
1281 Ga0495613_0002527
1282 Ga0495613_0059054
1283 Ga0495624_0198475
1284 Ga0495581_0000328
1285 Ga0495581_0010626
1286 Ga0495581_0046042
1287 Ga0495636_0030017
1288 Ga0495672_0050970
1289 Ga0495676_0037974
1290 Ga0495676_0152317
1291 Ga0495677_0054157
1292 Ga0495679_109844
1293 Ga0496100_0083638
1294 Ga0496100_0216682
1295 Ga0496100_0231589
1296 Ga0496100_0340433
1297 Ga0496101_0005292
1298 Ga0496102_0061364
1299 Ga0496102_0066224
1300 Ga0496102_0119101
1301 Ga0496102_1323054
1302 Ga0496103_0062416
1303 Ga0496103_0093935
1304 Ga0496103_0583523
1305 Ga0496103_0719386
1306 Ga0496103_0786085
1307 Ga0496104_0014384
1308 Ga0496104_0061121
1309 Ga0496104_0515930
1310 Ga0496105_0012122
1311 Ga0496105_0019371
1312 Ga0496105_0293409
1313 Ga0496106_0034422
1314 Ga0496106_0036435
1315 Ga0496106_0075965
1316 Ga0496106_0656700
1317 Ga0496106_0664870
1318 Ga0496106_0807912
1319 Ga0496107_0020961
1320 Ga0496107_0128323
1321 Ga0496107_0317357
1322 Ga0496108_0014772
1323 Ga0496108_0172586
1324 Ga0496108_0274154
1325 Ga0496109_0011851
1326 Ga0496109_0041958
1327 Ga0496110_0008458
1328 Ga0496110_0181830
1329 Ga0496111_0363167
1330 Ga0496111_0539624
1331 Ga0496112_0005429
1332 Ga0496112_0090392
1333 Ga0496112_0127996
1334 Ga0496112_0201948
1335 Ga0496113_0004015
1336 Ga0496113_0237593
1337 Ga0496114_0002384
1338 Ga0496114_0050087
1339 Ga0496114_0110728
1340 Ga0496115_0030547
1341 Ga0496115_0038641
1342 Ga0496121_0701366
1343 Ga0496122_0148373
1344 Ga0496123_0082411
1345 Ga0496124_0072232
1346 Ga0496125_0048009
1347 Ga0496125_0399577
1348 Ga0501047_0002379
1349 Ga0501070_0035241
1350 Ga0501075_0727516
1351 Ga0501079_0140569
1352 Ga0501044_0004693
1353 nmdc:mga05p37_132378_c1
1354 nmdc:mga05p37_761427_c1
1355 nmdc:mga0qj67_678147_c1
1356 nmdc:mga0qj67_894377_c1
1357 nmdc:mga06r32_690936_c1
1358 nmdc:mga06r32_94928_c1
1359 nmdc:mga08y16_628520_c1
1360 nmdc:mga0n895_5113_c1
1361 nmdc:mga0n895_604582_c1
1362 nmdc:mga0rr50_25768_c1
1363 nmdc:mga0rr50_446917_c1
1364 nmdc:mga0rr50_495782_c1
1365 nmdc:mga08x19_58342_c1
1366 nmdc:mga0a205_43365_c1
1367 nmdc:mga0a205_52695_c1
1368 nmdc:mga0a205_643575_c1
1369 Ga0500559_0048394
1370 Ga0587098_001124
1371 Ga0587119_001432
1372 2587941804
1373 2588234444
1374 2739644171
1375 2819680857
1376 2857631055
1377 2914762957
1378 2993484613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

24

171

0.9

PF13462

Thioredoxin_4

Thioredoxin

10

172

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eez-assembly1.cif.gz_A crystal structure of the thiol-disulfide exchange protein alpha-dsba2 from wolbachia pipientis 0.8932 8 169
7rgv-assembly1.cif.gz_A structure of caulobacter crescentus suppressor of copper sensitivity protein c 0.8829 8 169
4pwo-assembly1.cif.gz_A crystal structure of dsba from the gram positive bacterium corynebacterium diphtheriae 0.8827 13 169
7unn-assembly1.cif.gz_A thiol-disulfide oxidoreductase tsda from corynebacterium diphtheriae 0.8757 13 169
7uno-assembly1.cif.gz_A thiol-disulfide oxidoreductase tsda, c129s mutant, from corynebacterium diphtheriae 0.8722 13 169
ID Description Score Start End Superfamily
af_Q655X0_59_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9006 21 58 3.40.30.10
af_E9QGM3_60_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8917 21 59 3.40.30.10
af_Q8K2W3_103_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8867 18 58 3.40.30.10
af_A0A1D6J430_47_125_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8863 22 95 3.40.30.10
af_Q9U1X7_126_242_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8825 21 58 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6I3MW41-F1-model_v4 Thioredoxin domain-containing protein 0.9968 1 169
AF-A0A520A228-F1-model_v4 DsbA family protein 0.9892 28 169 GO:0016491
AF-A0A6I3MW41-F1-model_v4 Thioredoxin domain-containing protein 0.9852 1 169
AF-A0A563U4Q9-F1-model_v4 DsbA family protein 0.9776 2 169
AF-A0A2M7XFZ9-F1-model_v4 Thioredoxin domain-containing protein 0.9742 5 123

Map