F475388
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 689 | 274 | 689 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300026035|Ga0207703_10735447|Ga0207703_107354472 |
| Length | 175 |
| Sequence | MHRHPRCFATVWQTTGFTIEVGRLIIRAMLSRRDAVASFALFADLVASGRHLDALAQTTPAAPGTPPPPISRHDLPRVTMDDWEVTVSYVDYPPGRVGAAHHHAGFVLAYVLEGAVVTKISGQGEEKTYTVGQMFYEQPGATHEVSKNASQTQPARLLAMIFAKKGSTLTMPGPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 164 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 167 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 195 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 196 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 2.03 |
| Rhizosphere | 97.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11332999 | 3300004799 | Bacteria | 713 |
| 2 | Ga0065704_10304040 | 3300005289 | Unclassified | 880 |
| 3 | Ga0065712_10267094 | 3300005290 | Unclassified | 924 |
| 4 | Ga0065715_10014205 | 3300005293 | Bacteria | 2165 |
| 5 | Ga0065715_10105377 | 3300005293 | Bacteria | 2876 |
| 6 | Ga0065715_10382837 | 3300005293 | Bacteria | 893 |
| 7 | Ga0065715_11013547 | 3300005293 | Bacteria | 542 |
| 8 | Ga0065715_11157041 | 3300005293 | Unclassified | 507 |
| 9 | Ga0065707_10017938 | 3300005295 | Bacteria | 3349 |
| 10 | Ga0065707_10298169 | 3300005295 | Unclassified | 1009 |
| 11 | Ga0070676_10019922 | 3300005328 | Unclassified | 3738 |
| 12 | Ga0070690_100044608 | 3300005330 | Bacteria | 2815 |
| 13 | Ga0070690_100077917 | 3300005330 | Bacteria | 2165 |
| 14 | Ga0070690_100098152 | 3300005330 | Bacteria | 1939 |
| 15 | Ga0070690_100887440 | 3300005330 | Unclassified | 697 |
| 16 | Ga0070670_100056545 | 3300005331 | Bacteria | 3367 |
| 17 | Ga0070670_100192322 | 3300005331 | Bacteria | 1773 |
| 18 | Ga0068869_100184698 | 3300005334 | Unclassified | 1636 |
| 19 | Ga0068869_101051464 | 3300005334 | Unclassified | 711 |
| 20 | Ga0070666_10005197 | 3300005335 | Bacteria | 7974 |
| 21 | Ga0070666_10236424 | 3300005335 | Unclassified | 1291 |
| 22 | Ga0068868_100447393 | 3300005338 | Unclassified | 1123 |
| 23 | Ga0068868_100497558 | 3300005338 | Bacteria | 1067 |
| 24 | Ga0068868_101236384 | 3300005338 | Unclassified | 692 |
| 25 | Ga0070660_100116064 | 3300005339 | Bacteria | 2134 |
| 26 | Ga0070660_100409308 | 3300005339 | Bacteria | 1122 |
| 27 | Ga0070660_100776742 | 3300005339 | Unclassified | 805 |
| 28 | Ga0070689_100004437 | 3300005340 | Bacteria | 9479 |
| 29 | Ga0070689_100007594 | 3300005340 | Bacteria | 7596 |
| 30 | Ga0070689_100064840 | 3300005340 | Bacteria | 2844 |
| 31 | Ga0070689_100157305 | 3300005340 | Bacteria | 1835 |
| 32 | Ga0070689_100176984 | 3300005340 | Bacteria | 1731 |
| 33 | Ga0070689_100527183 | 3300005340 | Bacteria | 1015 |
| 34 | Ga0070691_10197266 | 3300005341 | Unclassified | 1056 |
| 35 | Ga0070691_10365503 | 3300005341 | Unclassified | 805 |
| 36 | Ga0070687_100018069 | 3300005343 | Bacteria | 3254 |
| 37 | Ga0070687_100339225 | 3300005343 | Bacteria | 966 |
| 38 | Ga0070692_10069121 | 3300005345 | Bacteria | 1878 |
| 39 | Ga0070692_10548435 | 3300005345 | Bacteria | 757 |
| 40 | Ga0070692_10844625 | 3300005345 | Unclassified | 629 |
| 41 | Ga0070692_11090658 | 3300005345 | Unclassified | 563 |
| 42 | Ga0070668_100051959 | 3300005347 | Bacteria | 3159 |
| 43 | Ga0070668_100537392 | 3300005347 | Bacteria | 1016 |
| 44 | Ga0070668_100746430 | 3300005347 | Bacteria | 866 |
| 45 | Ga0070669_100003956 | 3300005353 | Bacteria | 10716 |
| 46 | Ga0070669_100013215 | 3300005353 | Bacteria | 5870 |
| 47 | Ga0070669_100067210 | 3300005353 | Unclassified | 2644 |
| 48 | Ga0070669_100129337 | 3300005353 | Bacteria | 1935 |
| 49 | Ga0070669_100236595 | 3300005353 | Unclassified | 1449 |
| 50 | Ga0070675_100000420 | 3300005354 | Bacteria | 28958 |
| 51 | Ga0070675_100015160 | 3300005354 | Bacteria | 6087 |
| 52 | Ga0070675_100149811 | 3300005354 | Unclassified | 2000 |
| 53 | Ga0070675_100681561 | 3300005354 | Bacteria | 935 |
| 54 | Ga0070675_100903125 | 3300005354 | Unclassified | 810 |
| 55 | Ga0070671_100052813 | 3300005355 | Bacteria | 3379 |
| 56 | Ga0070671_101453163 | 3300005355 | Bacteria | 606 |
| 57 | Ga0070674_100034274 | 3300005356 | Unclassified | 3389 |
| 58 | Ga0070674_100837878 | 3300005356 | Bacteria | 797 |
| 59 | Ga0070673_100063095 | 3300005364 | Bacteria | 2947 |
| 60 | Ga0070673_100151129 | 3300005364 | Unclassified | 1966 |
| 61 | Ga0070688_100021695 | 3300005365 | Bacteria | 3754 |
| 62 | Ga0070688_100025850 | 3300005365 | Bacteria | 3481 |
| 63 | Ga0070688_100480872 | 3300005365 | Bacteria | 934 |
| 64 | Ga0070659_100104759 | 3300005366 | Bacteria | 2279 |
| 65 | Ga0070659_100914461 | 3300005366 | Bacteria | 767 |
| 66 | Ga0070667_100006576 | 3300005367 | Bacteria | 9665 |
| 67 | Ga0070667_101562284 | 3300005367 | Bacteria | 620 |
| 68 | Ga0070703_10102669 | 3300005406 | Unclassified | 1010 |
| 69 | Ga0070709_10097681 | 3300005434 | Bacteria | 1950 |
| 70 | Ga0070713_100016406 | 3300005436 | Bacteria | 5569 |
| 71 | Ga0070713_100851994 | 3300005436 | Unclassified | 875 |
| 72 | Ga0070713_102043692 | 3300005436 | Unclassified | 556 |
| 73 | Ga0070701_10006396 | 3300005438 | Bacteria | 4955 |
| 74 | Ga0070701_10116861 | 3300005438 | Unclassified | 1497 |
| 75 | Ga0070701_10248486 | 3300005438 | Bacteria | 1073 |
| 76 | Ga0070701_10706231 | 3300005438 | Bacteria | 679 |
| 77 | Ga0070711_100323950 | 3300005439 | Bacteria | 1232 |
| 78 | Ga0070705_100000037 | 3300005440 | Bacteria | 66783 |
| 79 | Ga0070705_100013278 | 3300005440 | Bacteria | 4209 |
| 80 | Ga0070705_100035978 | 3300005440 | Bacteria | 2780 |
| 81 | Ga0070705_100141952 | 3300005440 | Bacteria | 1582 |
| 82 | Ga0070700_100021963 | 3300005441 | Bacteria | 3715 |
| 83 | Ga0070700_100073743 | 3300005441 | Bacteria | 2185 |
| 84 | Ga0070700_100161970 | 3300005441 | Bacteria | 1541 |
| 85 | Ga0070700_100320739 | 3300005441 | Bacteria | 1138 |
| 86 | Ga0070694_100001204 | 3300005444 | Bacteria | 14924 |
| 87 | Ga0070694_100001228 | 3300005444 | Bacteria | 14815 |
| 88 | Ga0070694_100010891 | 3300005444 | Bacteria | 5627 |
| 89 | Ga0070694_100020555 | 3300005444 | Bacteria | 4211 |
| 90 | Ga0070694_100188676 | 3300005444 | Bacteria | 1529 |
| 91 | Ga0070694_100720437 | 3300005444 | Bacteria | 813 |
| 92 | Ga0070694_100932405 | 3300005444 | Bacteria | 718 |
| 93 | Ga0070708_100036000 | 3300005445 | Unclassified | 4316 |
| 94 | Ga0070708_100581769 | 3300005445 | Bacteria | 1056 |
| 95 | Ga0070708_101184080 | 3300005445 | Bacteria | 715 |
| 96 | Ga0070678_100290418 | 3300005456 | Bacteria | 1386 |
| 97 | Ga0070662_100024350 | 3300005457 | Bacteria | 4170 |
| 98 | Ga0070662_100090590 | 3300005457 | Bacteria | 2296 |
| 99 | Ga0070662_100121692 | 3300005457 | Bacteria | 2001 |
| 100 | Ga0070662_100261771 | 3300005457 | Unclassified | 1394 |
| 101 | Ga0070662_100912737 | 3300005457 | Unclassified | 750 |
| 102 | Ga0070681_10020213 | 3300005458 | Bacteria | 6675 |
| 103 | Ga0068867_100011482 | 3300005459 | Bacteria | 6252 |
| 104 | Ga0068867_100048878 | 3300005459 | Bacteria | 3113 |
| 105 | Ga0068867_101157175 | 3300005459 | Bacteria | 709 |
| 106 | Ga0068867_101680530 | 3300005459 | Bacteria | 595 |
| 107 | Ga0070706_100418119 | 3300005467 | Bacteria | 1248 |
| 108 | Ga0070707_100083186 | 3300005468 | Archaea | 3092 |
| 109 | Ga0070707_100132105 | 3300005468 | Unclassified | 2428 |
| 110 | Ga0070707_100322630 | 3300005468 | Unclassified | 1501 |
| 111 | Ga0070707_100836009 | 3300005468 | Bacteria | 885 |
| 112 | Ga0070698_100000929 | 3300005471 | Bacteria | 32009 |
| 113 | Ga0070698_100052702 | 3300005471 | Bacteria | 4137 |
| 114 | Ga0070698_100354222 | 3300005471 | Bacteria | 1399 |
| 115 | Ga0070698_101219248 | 3300005471 | Unclassified | 702 |
| 116 | Ga0070699_100002294 | 3300005518 | Bacteria | 17216 |
| 117 | Ga0070699_100019455 | 3300005518 | Bacteria | 5846 |
| 118 | Ga0070699_100077668 | 3300005518 | Unclassified | 2891 |
| 119 | Ga0070699_100088560 | 3300005518 | Bacteria | 2704 |
| 120 | Ga0070699_101163483 | 3300005518 | Bacteria | 707 |
| 121 | Ga0070679_100031839 | 3300005530 | Bacteria | 5214 |
| 122 | Ga0070684_100581855 | 3300005535 | Bacteria | 1040 |
| 123 | Ga0070697_100077672 | 3300005536 | Archaea | 2731 |
| 124 | Ga0070697_100608516 | 3300005536 | Unclassified | 961 |
| 125 | Ga0070697_101257660 | 3300005536 | Bacteria | 660 |
| 126 | Ga0070672_100045709 | 3300005543 | Unclassified | 3389 |
| 127 | Ga0070672_100060990 | 3300005543 | Unclassified | 2972 |
| 128 | Ga0070672_100264523 | 3300005543 | Bacteria | 1451 |
| 129 | Ga0070672_101258152 | 3300005543 | Unclassified | 660 |
| 130 | Ga0070672_101484802 | 3300005543 | Bacteria | 607 |
| 131 | Ga0070686_100678182 | 3300005544 | Unclassified | 820 |
| 132 | Ga0070695_100000085 | 3300005545 | Bacteria | 39151 |
| 133 | Ga0070695_100298064 | 3300005545 | Bacteria | 1191 |
| 134 | Ga0070695_101123743 | 3300005545 | Bacteria | 644 |
| 135 | Ga0070696_100000139 | 3300005546 | Bacteria | 39687 |
| 136 | Ga0070696_100008917 | 3300005546 | Bacteria | 6712 |
| 137 | Ga0070696_100207392 | 3300005546 | Bacteria | 1466 |
| 138 | Ga0070696_100350568 | 3300005546 | Bacteria | 1143 |
| 139 | Ga0070665_100007666 | 3300005548 | Bacteria | 10967 |
| 140 | Ga0070665_100171575 | 3300005548 | Bacteria | 2170 |
| 141 | Ga0070704_100000453 | 3300005549 | Bacteria | 19337 |
| 142 | Ga0070704_100002706 | 3300005549 | Bacteria | 10021 |
| 143 | Ga0070704_100025028 | 3300005549 | Bacteria | 3925 |
| 144 | Ga0070704_100040294 | 3300005549 | Bacteria | 3214 |
| 145 | Ga0070704_100042174 | 3300005549 | Unclassified | 3155 |
| 146 | Ga0070704_100444049 | 3300005549 | Bacteria | 1116 |
| 147 | Ga0070704_100533901 | 3300005549 | Bacteria | 1023 |
| 148 | Ga0068855_100287927 | 3300005563 | Bacteria | 1822 |
| 149 | Ga0068855_101133831 | 3300005563 | Bacteria | 816 |
| 150 | Ga0070664_100422475 | 3300005564 | Bacteria | 1221 |
| 151 | Ga0070664_101084422 | 3300005564 | Unclassified | 754 |
| 152 | Ga0068857_100001266 | 3300005577 | Bacteria | 19807 |
| 153 | Ga0068857_100181290 | 3300005577 | Unclassified | 1917 |
| 154 | Ga0068857_101259772 | 3300005577 | Bacteria | 717 |
| 155 | Ga0068854_100016621 | 3300005578 | Bacteria | 4909 |
| 156 | Ga0068854_101153624 | 3300005578 | Bacteria | 692 |
| 157 | Ga0070702_100030815 | 3300005615 | Bacteria | 2928 |
| 158 | Ga0068852_100870742 | 3300005616 | Unclassified | 917 |
| 159 | Ga0068859_100004813 | 3300005617 | Bacteria | 13744 |
| 160 | Ga0068859_100005036 | 3300005617 | Bacteria | 13407 |
| 161 | Ga0068859_100011030 | 3300005617 | Bacteria | 9092 |
| 162 | Ga0068859_100013716 | 3300005617 | Bacteria | 8125 |
| 163 | Ga0068859_100196467 | 3300005617 | Unclassified | 2102 |
| 164 | Ga0068859_101539761 | 3300005617 | Unclassified | 734 |
| 165 | Ga0068864_100097966 | 3300005618 | Unclassified | 2597 |
| 166 | Ga0068864_100237196 | 3300005618 | Unclassified | 1689 |
| 167 | Ga0068864_100479442 | 3300005618 | Bacteria | 1194 |
| 168 | Ga0068866_10056148 | 3300005718 | Unclassified | 2025 |
| 169 | Ga0068866_10159885 | 3300005718 | Unclassified | 1312 |
| 170 | Ga0068866_10378931 | 3300005718 | Unclassified | 907 |
| 171 | Ga0068866_11155705 | 3300005718 | Unclassified | 557 |
| 172 | Ga0068861_100031278 | 3300005719 | Unclassified | 3909 |
| 173 | Ga0068861_100096934 | 3300005719 | Unclassified | 2338 |
| 174 | Ga0068861_100129069 | 3300005719 | Bacteria | 2050 |
| 175 | Ga0068861_100243105 | 3300005719 | Bacteria | 1532 |
| 176 | Ga0068861_100728803 | 3300005719 | Bacteria | 924 |
| 177 | Ga0068870_10007388 | 3300005840 | Bacteria | 4894 |
| 178 | Ga0068870_10009645 | 3300005840 | Bacteria | 4399 |
| 179 | Ga0068863_100030531 | 3300005841 | Bacteria | 5145 |
| 180 | Ga0068863_100657128 | 3300005841 | Bacteria | 1040 |
| 181 | Ga0068858_100033758 | 3300005842 | Bacteria | 4745 |
| 182 | Ga0068858_100037321 | 3300005842 | Unclassified | 4506 |
| 183 | Ga0068858_100086239 | 3300005842 | Bacteria | 2921 |
| 184 | Ga0068858_100097790 | 3300005842 | Bacteria | 2736 |
| 185 | Ga0068858_100534659 | 3300005842 | Bacteria | 1134 |
| 186 | Ga0068860_100008710 | 3300005843 | Bacteria | 10104 |
| 187 | Ga0068860_100151514 | 3300005843 | Unclassified | 2233 |
| 188 | Ga0068860_100452577 | 3300005843 | Unclassified | 1277 |
| 189 | Ga0068860_100465341 | 3300005843 | Bacteria | 1259 |
| 190 | Ga0068860_101878042 | 3300005843 | Unclassified | 621 |
| 191 | Ga0068862_100006051 | 3300005844 | Bacteria | 10077 |
| 192 | Ga0068862_100014260 | 3300005844 | Bacteria | 6591 |
| 193 | Ga0068862_100078254 | 3300005844 | Bacteria | 2865 |
| 194 | Ga0068862_100727062 | 3300005844 | Bacteria | 964 |
| 195 | Ga0070717_10406113 | 3300006028 | Unclassified | 1224 |
| 196 | Ga0070717_11372256 | 3300006028 | Unclassified | 642 |
| 197 | Ga0075432_10070913 | 3300006058 | Unclassified | 1252 |
| 198 | Ga0070715_10210119 | 3300006163 | Unclassified | 994 |
| 199 | Ga0070715_10657774 | 3300006163 | Unclassified | 621 |
| 200 | Ga0070716_100336903 | 3300006173 | Unclassified | 1063 |
| 201 | Ga0070716_100638241 | 3300006173 | Bacteria | 806 |
| 202 | Ga0070716_100754377 | 3300006173 | Unclassified | 749 |
| 203 | Ga0070712_101009227 | 3300006175 | Unclassified | 720 |
| 204 | Ga0097621_100036808 | 3300006237 | Bacteria | 3916 |
| 205 | Ga0097621_101092074 | 3300006237 | Bacteria | 749 |
| 206 | Ga0068871_100055583 | 3300006358 | Unclassified | 3214 |
| 207 | Ga0068871_100148282 | 3300006358 | Bacteria | 1999 |
| 208 | Ga0068871_100989659 | 3300006358 | Unclassified | 783 |
| 209 | Ga0075428_100000056 | 3300006844 | Bacteria | 89990 |
| 210 | Ga0075428_100002585 | 3300006844 | Bacteria | 19667 |
| 211 | Ga0075428_100093273 | 3300006844 | Bacteria | 3282 |
| 212 | Ga0075428_100236343 | 3300006844 | Unclassified | 1972 |
| 213 | Ga0075428_100531833 | 3300006844 | Unclassified | 1257 |
| 214 | Ga0075428_100740949 | 3300006844 | Bacteria | 1046 |
| 215 | Ga0075428_100825542 | 3300006844 | Unclassified | 985 |
| 216 | Ga0075428_100871365 | 3300006844 | Unclassified | 956 |
| 217 | Ga0075428_101042020 | 3300006844 | Bacteria | 865 |
| 218 | Ga0075428_101205477 | 3300006844 | Unclassified | 798 |
| 219 | Ga0075430_100000072 | 3300006846 | Bacteria | 55365 |
| 220 | Ga0075430_100242321 | 3300006846 | Bacteria | 1494 |
| 221 | Ga0075430_100479450 | 3300006846 | Bacteria | 1026 |
| 222 | Ga0075431_100013452 | 3300006847 | Bacteria | 8265 |
| 223 | Ga0075431_100110346 | 3300006847 | Bacteria | 2839 |
| 224 | Ga0075431_100364473 | 3300006847 | Bacteria | 1451 |
| 225 | Ga0075431_101088522 | 3300006847 | Unclassified | 764 |
| 226 | Ga0075433_10181092 | 3300006852 | Bacteria | 1875 |
| 227 | Ga0075433_10186648 | 3300006852 | Bacteria | 1845 |
| 228 | Ga0075433_10573214 | 3300006852 | Unclassified | 991 |
| 229 | Ga0075434_100040479 | 3300006871 | Bacteria | 4614 |
| 230 | Ga0075434_100043057 | 3300006871 | Bacteria | 4476 |
| 231 | Ga0075434_100151091 | 3300006871 | Unclassified | 2343 |
| 232 | Ga0075434_100155144 | 3300006871 | Bacteria | 2309 |
| 233 | Ga0075434_100184004 | 3300006871 | Bacteria | 2110 |
| 234 | Ga0075434_100217520 | 3300006871 | Bacteria | 1930 |
| 235 | Ga0075434_100672911 | 3300006871 | Bacteria | 1053 |
| 236 | Ga0075434_100761387 | 3300006871 | Bacteria | 985 |
| 237 | Ga0075434_101207774 | 3300006871 | Bacteria | 768 |
| 238 | Ga0075429_100019241 | 3300006880 | Bacteria | 5915 |
| 239 | Ga0075429_100094158 | 3300006880 | Bacteria | 2613 |
| 240 | Ga0075429_100670107 | 3300006880 | Unclassified | 909 |
| 241 | Ga0075429_101039023 | 3300006880 | Unclassified | 716 |
| 242 | Ga0075429_101556021 | 3300006880 | Bacteria | 575 |
| 243 | Ga0068865_100250478 | 3300006881 | Bacteria | 1398 |
| 244 | Ga0068865_100256718 | 3300006881 | Unclassified | 1382 |
| 245 | Ga0075436_100017364 | 3300006914 | Bacteria | 4926 |
| 246 | Ga0075436_100142621 | 3300006914 | Bacteria | 1684 |
| 247 | Ga0097620_100004814 | 3300006931 | Bacteria | 13744 |
| 248 | Ga0097620_100005036 | 3300006931 | Bacteria | 13407 |
| 249 | Ga0097620_100011030 | 3300006931 | Bacteria | 9092 |
| 250 | Ga0097620_100013716 | 3300006931 | Bacteria | 8125 |
| 251 | Ga0097620_100025646 | 3300006931 | Bacteria | 5912 |
| 252 | Ga0097620_100196467 | 3300006931 | Unclassified | 2102 |
| 253 | Ga0097620_101539729 | 3300006931 | Unclassified | 734 |
| 254 | Ga0075435_100000028 | 3300007076 | Bacteria | 82360 |
| 255 | Ga0075435_100000962 | 3300007076 | Bacteria | 18187 |
| 256 | Ga0075435_100031431 | 3300007076 | Bacteria | 4182 |
| 257 | Ga0075435_100052058 | 3300007076 | Bacteria | 3299 |
| 258 | Ga0075435_100292109 | 3300007076 | Unclassified | 1393 |
| 259 | Ga0075435_100316552 | 3300007076 | Bacteria | 1335 |
| 260 | Ga0075435_100476530 | 3300007076 | Unclassified | 1078 |
| 261 | Ga0075435_100517469 | 3300007076 | Unclassified | 1032 |
| 262 | Ga0111539_10000002 | 3300009094 | Bacteria | 983359 |
| 263 | Ga0111539_10008678 | 3300009094 | Bacteria | 12900 |
| 264 | Ga0111539_10020340 | 3300009094 | Bacteria | 8176 |
| 265 | Ga0111539_10021656 | 3300009094 | Bacteria | 7907 |
| 266 | Ga0111539_10043711 | 3300009094 | Bacteria | 5370 |
| 267 | Ga0105245_10173726 | 3300009098 | Bacteria | 2053 |
| 268 | Ga0105245_10216535 | 3300009098 | Bacteria | 1845 |
| 269 | Ga0105245_10344157 | 3300009098 | Bacteria | 1475 |
| 270 | Ga0105245_11026190 | 3300009098 | Bacteria | 870 |
| 271 | Ga0105247_10009886 | 3300009101 | Bacteria | 5779 |
| 272 | Ga0105247_10048684 | 3300009101 | Bacteria | 2604 |
| 273 | Ga0114129_10001718 | 3300009147 | Bacteria | 29903 |
| 274 | Ga0114129_10012031 | 3300009147 | Bacteria | 12307 |
| 275 | Ga0114129_10022700 | 3300009147 | Bacteria | 8899 |
| 276 | Ga0114129_10086253 | 3300009147 | Bacteria | 4354 |
| 277 | Ga0114129_10207764 | 3300009147 | Bacteria | 2649 |
| 278 | Ga0114129_10208473 | 3300009147 | Bacteria | 2643 |
| 279 | Ga0114129_10284660 | 3300009147 | Bacteria | 2208 |
| 280 | Ga0114129_10341257 | 3300009147 | Unclassified | 1987 |
| 281 | Ga0114129_10601186 | 3300009147 | Bacteria | 1425 |
| 282 | Ga0114129_10678885 | 3300009147 | Unclassified | 1326 |
| 283 | Ga0114129_11329851 | 3300009147 | Unclassified | 889 |
| 284 | Ga0114129_12322984 | 3300009147 | Bacteria | 643 |
| 285 | Ga0105243_10145046 | 3300009148 | Bacteria | 2030 |
| 286 | Ga0105243_10182668 | 3300009148 | Bacteria | 1825 |
| 287 | Ga0105243_10545627 | 3300009148 | Bacteria | 1107 |
| 288 | Ga0105243_11149257 | 3300009148 | Unclassified | 787 |
| 289 | Ga0105243_11205774 | 3300009148 | Unclassified | 770 |
| 290 | Ga0105241_10799240 | 3300009174 | Bacteria | 869 |
| 291 | Ga0105242_10003405 | 3300009176 | Bacteria | 12367 |
| 292 | Ga0105242_10142350 | 3300009176 | Bacteria | 2082 |
| 293 | Ga0105242_10246450 | 3300009176 | Bacteria | 1608 |
| 294 | Ga0105242_10263971 | 3300009176 | Bacteria | 1557 |
| 295 | Ga0105242_10459796 | 3300009176 | Bacteria | 1202 |
| 296 | Ga0105248_10036273 | 3300009177 | Bacteria | 5514 |
| 297 | Ga0105248_10203524 | 3300009177 | Bacteria | 2231 |
| 298 | Ga0105248_10252430 | 3300009177 | Bacteria | 1985 |
| 299 | Ga0105248_10370785 | 3300009177 | Unclassified | 1612 |
| 300 | Ga0105248_10466773 | 3300009177 | Bacteria | 1423 |
| 301 | Ga0105248_10967486 | 3300009177 | Bacteria | 961 |
| 302 | Ga0105248_11285264 | 3300009177 | Bacteria | 828 |
| 303 | Ga0105248_12072581 | 3300009177 | Unclassified | 647 |
| 304 | Ga0105249_10012175 | 3300009553 | Bacteria | 7575 |
| 305 | Ga0105249_10345122 | 3300009553 | Bacteria | 1507 |
| 306 | Ga0105249_12636839 | 3300009553 | Unclassified | 575 |
| 307 | Ga0099796_10082764 | 3300010159 | Bacteria | 1180 |
| 308 | Ga0105239_12002347 | 3300010375 | Bacteria | 672 |
| 309 | Ga0105246_10505143 | 3300011119 | Bacteria | 1027 |
| 310 | Ga0157378_10239618 | 3300013297 | Bacteria | 1732 |
| 311 | Ga0157378_10243400 | 3300013297 | Bacteria | 1719 |
| 312 | Ga0157378_11828923 | 3300013297 | Unclassified | 656 |
| 313 | Ga0157378_12157689 | 3300013297 | Bacteria | 608 |
| 314 | Ga0157378_12462910 | 3300013297 | Unclassified | 572 |
| 315 | Ga0163162_10096350 | 3300013306 | Bacteria | 3047 |
| 316 | Ga0163162_10179210 | 3300013306 | Bacteria | 2245 |
| 317 | Ga0157372_10227110 | 3300013307 | Bacteria | 2164 |
| 318 | Ga0157372_11734364 | 3300013307 | Bacteria | 718 |
| 319 | Ga0157375_10002605 | 3300013308 | Bacteria | 15654 |
| 320 | Ga0157375_10171475 | 3300013308 | Bacteria | 2317 |
| 321 | Ga0157375_10359266 | 3300013308 | Bacteria | 1622 |
| 322 | Ga0157375_10377499 | 3300013308 | Bacteria | 1584 |
| 323 | Ga0163163_10037770 | 3300014325 | Bacteria | 4699 |
| 324 | Ga0163163_10616231 | 3300014325 | Bacteria | 1149 |
| 325 | Ga0157380_10037251 | 3300014326 | Bacteria | 3767 |
| 326 | Ga0157380_10467495 | 3300014326 | Unclassified | 1216 |
| 327 | Ga0157380_10958032 | 3300014326 | Unclassified | 886 |
| 328 | Ga0157377_10058158 | 3300014745 | Bacteria | 2201 |
| 329 | Ga0157379_10012294 | 3300014968 | Bacteria | 7477 |
| 330 | Ga0157379_10412566 | 3300014968 | Bacteria | 1243 |
| 331 | Ga0157379_11489864 | 3300014968 | Bacteria | 658 |
| 332 | Ga0157376_10034851 | 3300014969 | Bacteria | 4067 |
| 333 | Ga0157376_10141916 | 3300014969 | Unclassified | 2156 |
| 334 | Ga0157376_10484951 | 3300014969 | Bacteria | 1212 |
| 335 | Ga0182005_1148521 | 3300015265 | Bacteria | 681 |
| 336 | Ga0207642_10372977 | 3300025899 | Unclassified | 847 |
| 337 | Ga0207642_10739692 | 3300025899 | Unclassified | 622 |
| 338 | Ga0207710_10078992 | 3300025900 | Bacteria | 1523 |
| 339 | Ga0207710_10223050 | 3300025900 | Bacteria | 936 |
| 340 | Ga0207688_10100206 | 3300025901 | Bacteria | 1672 |
| 341 | Ga0207680_10003047 | 3300025903 | Bacteria | 7864 |
| 342 | Ga0207680_10184829 | 3300025903 | Unclassified | 1412 |
| 343 | Ga0207685_10663284 | 3300025905 | Unclassified | 565 |
| 344 | Ga0207699_10056845 | 3300025906 | Bacteria | 2334 |
| 345 | Ga0207699_10236969 | 3300025906 | Bacteria | 1252 |
| 346 | Ga0207645_10015012 | 3300025907 | Bacteria | 5162 |
| 347 | Ga0207643_10003059 | 3300025908 | Bacteria | 8994 |
| 348 | Ga0207643_10003533 | 3300025908 | Bacteria | 8410 |
| 349 | Ga0207654_10160375 | 3300025911 | Unclassified | 1452 |
| 350 | Ga0207707_10158528 | 3300025912 | Bacteria | 1979 |
| 351 | Ga0207693_10810326 | 3300025915 | Unclassified | 721 |
| 352 | Ga0207660_10540977 | 3300025917 | Unclassified | 947 |
| 353 | Ga0207662_10076280 | 3300025918 | Bacteria | 2037 |
| 354 | Ga0207662_10160184 | 3300025918 | Bacteria | 1437 |
| 355 | Ga0207662_11139563 | 3300025918 | Unclassified | 554 |
| 356 | Ga0207657_10026590 | 3300025919 | Bacteria | 5313 |
| 357 | Ga0207652_10044836 | 3300025921 | Bacteria | 3769 |
| 358 | Ga0207646_10232911 | 3300025922 | Bacteria | 1664 |
| 359 | Ga0207646_10761597 | 3300025922 | Unclassified | 864 |
| 360 | Ga0207681_10001613 | 3300025923 | Bacteria | 14545 |
| 361 | Ga0207681_10006385 | 3300025923 | Bacteria | 7238 |
| 362 | Ga0207681_10020770 | 3300025923 | Unclassified | 4166 |
| 363 | Ga0207681_10221754 | 3300025923 | Unclassified | 1463 |
| 364 | Ga0207681_10562880 | 3300025923 | Bacteria | 939 |
| 365 | Ga0207681_10605508 | 3300025923 | Unclassified | 906 |
| 366 | Ga0207650_10105381 | 3300025925 | Unclassified | 2177 |
| 367 | Ga0207650_10306765 | 3300025925 | Bacteria | 1297 |
| 368 | Ga0207650_10865767 | 3300025925 | Bacteria | 767 |
| 369 | Ga0207659_10177169 | 3300025926 | Unclassified | 1686 |
| 370 | Ga0207659_11710316 | 3300025926 | Unclassified | 536 |
| 371 | Ga0207687_10071059 | 3300025927 | Unclassified | 2486 |
| 372 | Ga0207687_10344747 | 3300025927 | Bacteria | 1212 |
| 373 | Ga0207700_10012994 | 3300025928 | Bacteria | 5396 |
| 374 | Ga0207664_10271190 | 3300025929 | Bacteria | 1486 |
| 375 | Ga0207644_10215835 | 3300025931 | Bacteria | 1518 |
| 376 | Ga0207644_10578671 | 3300025931 | Bacteria | 931 |
| 377 | Ga0207706_10043015 | 3300025933 | Bacteria | 4003 |
| 378 | Ga0207706_10088280 | 3300025933 | Bacteria | 2726 |
| 379 | Ga0207706_10140474 | 3300025933 | Unclassified | 2125 |
| 380 | Ga0207706_10277433 | 3300025933 | Bacteria | 1462 |
| 381 | Ga0207686_10060080 | 3300025934 | Unclassified | 2404 |
| 382 | Ga0207709_10117223 | 3300025935 | Bacteria | 1791 |
| 383 | Ga0207709_10433268 | 3300025935 | Bacteria | 1012 |
| 384 | Ga0207670_10008405 | 3300025936 | Bacteria | 5827 |
| 385 | Ga0207670_10012794 | 3300025936 | Unclassified | 4923 |
| 386 | Ga0207670_10037370 | 3300025936 | Bacteria | 3164 |
| 387 | Ga0207669_10442722 | 3300025937 | Bacteria | 1028 |
| 388 | Ga0207669_10504017 | 3300025937 | Bacteria | 969 |
| 389 | Ga0207669_11080888 | 3300025937 | Bacteria | 677 |
| 390 | Ga0207704_10038785 | 3300025938 | Unclassified | 2767 |
| 391 | Ga0207704_10113790 | 3300025938 | Unclassified | 1835 |
| 392 | Ga0207704_10921979 | 3300025938 | Unclassified | 735 |
| 393 | Ga0207665_10101987 | 3300025939 | Bacteria | 2005 |
| 394 | Ga0207665_10353429 | 3300025939 | Unclassified | 1110 |
| 395 | Ga0207665_10451880 | 3300025939 | Bacteria | 986 |
| 396 | Ga0207691_10003774 | 3300025940 | Bacteria | 14711 |
| 397 | Ga0207691_10060219 | 3300025940 | Unclassified | 3450 |
| 398 | Ga0207691_10189119 | 3300025940 | Bacteria | 1796 |
| 399 | Ga0207691_10863845 | 3300025940 | Unclassified | 758 |
| 400 | Ga0207711_10033096 | 3300025941 | Bacteria | 4372 |
| 401 | Ga0207711_10152869 | 3300025941 | Unclassified | 2084 |
| 402 | Ga0207711_10779599 | 3300025941 | Bacteria | 891 |
| 403 | Ga0207711_11277702 | 3300025941 | Bacteria | 676 |
| 404 | Ga0207689_10279317 | 3300025942 | Unclassified | 1383 |
| 405 | Ga0207679_10081320 | 3300025945 | Unclassified | 2477 |
| 406 | Ga0207679_10790464 | 3300025945 | Unclassified | 865 |
| 407 | Ga0207667_10133590 | 3300025949 | Unclassified | 2556 |
| 408 | Ga0207651_10023303 | 3300025960 | Bacteria | 3805 |
| 409 | Ga0207651_10223638 | 3300025960 | Bacteria | 1523 |
| 410 | Ga0207712_10007323 | 3300025961 | Bacteria | 6966 |
| 411 | Ga0207668_10014395 | 3300025972 | Bacteria | 4895 |
| 412 | Ga0207668_10049380 | 3300025972 | Bacteria | 2892 |
| 413 | Ga0207668_10080879 | 3300025972 | Unclassified | 2355 |
| 414 | Ga0207668_10632155 | 3300025972 | Bacteria | 935 |
| 415 | Ga0207640_10092137 | 3300025981 | Bacteria | 2101 |
| 416 | Ga0207640_10418534 | 3300025981 | Unclassified | 1096 |
| 417 | Ga0207658_10117457 | 3300025986 | Bacteria | 2114 |
| 418 | Ga0207677_10295702 | 3300026023 | Bacteria | 1336 |
| 419 | Ga0207677_10297655 | 3300026023 | Bacteria | 1332 |
| 420 | Ga0207677_10468657 | 3300026023 | Bacteria | 1083 |
| 421 | Ga0207703_10184501 | 3300026035 | Bacteria | 1843 |
| 422 | Ga0207703_10190728 | 3300026035 | Bacteria | 1815 |
| 423 | Ga0207703_10244652 | 3300026035 | Bacteria | 1614 |
| 424 | Ga0207703_10465325 | 3300026035 | Unclassified | 1183 |
| 425 | Ga0207703_10735447 | 3300026035 | Bacteria | 939 |
| 426 | Ga0207703_11056503 | 3300026035 | Bacteria | 780 |
| 427 | Ga0207678_10559844 | 3300026067 | Bacteria | 1000 |
| 428 | Ga0207678_11499239 | 3300026067 | Bacteria | 595 |
| 429 | Ga0207708_10035033 | 3300026075 | Bacteria | 3820 |
| 430 | Ga0207708_10091229 | 3300026075 | Unclassified | 2349 |
| 431 | Ga0207708_10105502 | 3300026075 | Unclassified | 2184 |
| 432 | Ga0207708_11050039 | 3300026075 | Bacteria | 709 |
| 433 | Ga0207708_11142270 | 3300026075 | Bacteria | 680 |
| 434 | Ga0207641_10003478 | 3300026088 | Bacteria | 13952 |
| 435 | Ga0207641_10199516 | 3300026088 | Bacteria | 1844 |
| 436 | Ga0207648_10001866 | 3300026089 | Bacteria | 23037 |
| 437 | Ga0207648_10025117 | 3300026089 | Bacteria | 5312 |
| 438 | Ga0207648_10057452 | 3300026089 | Unclassified | 3395 |
| 439 | Ga0207648_10817522 | 3300026089 | Bacteria | 868 |
| 440 | Ga0207648_10881518 | 3300026089 | Bacteria | 835 |
| 441 | Ga0207676_10078620 | 3300026095 | Unclassified | 2672 |
| 442 | Ga0207674_10019158 | 3300026116 | Bacteria | 7420 |
| 443 | Ga0207674_10062222 | 3300026116 | Bacteria | 3770 |
| 444 | Ga0207674_10084419 | 3300026116 | Bacteria | 3174 |
| 445 | Ga0207674_10193538 | 3300026116 | Bacteria | 1983 |
| 446 | Ga0207674_10777553 | 3300026116 | Bacteria | 924 |
| 447 | Ga0207675_100015632 | 3300026118 | Bacteria | 7078 |
| 448 | Ga0207675_100048433 | 3300026118 | Unclassified | 3967 |
| 449 | Ga0207675_100061265 | 3300026118 | Unclassified | 3513 |
| 450 | Ga0207675_100084976 | 3300026118 | Bacteria | 2970 |
| 451 | Ga0207675_100167340 | 3300026118 | Bacteria | 2100 |
| 452 | Ga0207675_100169087 | 3300026118 | Bacteria | 2089 |
| 453 | Ga0207675_100181116 | 3300026118 | Bacteria | 2018 |
| 454 | Ga0207675_100275563 | 3300026118 | Unclassified | 1633 |
| 455 | Ga0207683_10707836 | 3300026121 | Bacteria | 934 |
| 456 | Ga0207698_10744277 | 3300026142 | Unclassified | 979 |
| 457 | Ga0207428_10000004 | 3300027907 | Bacteria | 727800 |
| 458 | Ga0207428_10003716 | 3300027907 | Bacteria | 14661 |
| 459 | Ga0207428_10015331 | 3300027907 | Bacteria | 6632 |
| 460 | Ga0207428_10084357 | 3300027907 | Bacteria | 2476 |
| 461 | Ga0207428_10334440 | 3300027907 | Unclassified | 1116 |
| 462 | Ga0207428_10347250 | 3300027907 | Bacteria | 1092 |
| 463 | Ga0207428_11010378 | 3300027907 | Bacteria | 584 |
| 464 | Ga0268266_10007524 | 3300028379 | Bacteria | 9815 |
| 465 | Ga0268266_10347288 | 3300028379 | Bacteria | 1394 |
| 466 | Ga0268265_10000421 | 3300028380 | Bacteria | 45504 |
| 467 | Ga0268265_10019315 | 3300028380 | Bacteria | 4734 |
| 468 | Ga0268265_10043652 | 3300028380 | Unclassified | 3334 |
| 469 | Ga0268265_10129348 | 3300028380 | Bacteria | 2095 |
| 470 | Ga0268265_10324891 | 3300028380 | Bacteria | 1395 |
| 471 | Ga0268265_10411584 | 3300028380 | Bacteria | 1253 |
| 472 | Ga0268265_10966190 | 3300028380 | Bacteria | 840 |
| 473 | Ga0268265_11214484 | 3300028380 | Bacteria | 752 |
| 474 | Ga0268264_10078655 | 3300028381 | Bacteria | 2812 |
| 475 | Ga0268264_10103080 | 3300028381 | Unclassified | 2484 |
| 476 | Ga0268264_10205267 | 3300028381 | Bacteria | 1805 |
| 477 | Ga0268264_10421067 | 3300028381 | Bacteria | 1288 |
| 478 | Ga0268264_10775127 | 3300028381 | Bacteria | 957 |
| 479 | Ga0268264_11278527 | 3300028381 | Unclassified | 744 |
| 480 | Ga0307406_10296600 | 3300031901 | Bacteria | 1240 |
| 481 | Ga0373930_0004773 | 3300034816 | Bacteria | 2223 |
| 482 | Ga0373950_0032529 | 3300034818 | Bacteria | 971 |
| 483 | Ga0373959_0000414 | 3300034820 | Bacteria | 8214 |
| 484 | Ga0373959_0075424 | 3300034820 | Bacteria | 769 |
| 485 | Ga0373928_0001753 | 3300035084 | Bacteria | 4223 |
| 486 | Ga0373929_0000819 | 3300035085 | Bacteria | 6060 |
| 487 | Ga0373940_0000568 | 3300035088 | Bacteria | 5844 |
| 488 | Ga0373940_0045565 | 3300035088 | Bacteria | 1218 |
| 489 | Ga0373949_0001899 | 3300035090 | Bacteria | 5653 |
| 490 | Ga0373951_0001057 | 3300035091 | Bacteria | 7396 |
| 491 | Ga0373952_0001303 | 3300035092 | Bacteria | 4561 |
| 492 | Ga0373952_0056544 | 3300035092 | Unclassified | 949 |
| 493 | Ga0373923_0025960 | 3300035111 | Bacteria | 2327 |
| 494 | Ga0373923_0030845 | 3300035111 | Bacteria | 2158 |
| 495 | Ga0373932_0001327 | 3300035112 | Bacteria | 6946 |
| 496 | Ga0373939_0002741 | 3300035114 | Bacteria | 4133 |
| 497 | Ga0373941_0001420 | 3300035115 | Bacteria | 5054 |
| 498 | Ga0373945_0074619 | 3300035116 | Unclassified | 1290 |
| 499 | Ga0373953_0034209 | 3300035117 | Bacteria | 1991 |
| 500 | Ga0373954_0105903 | 3300035118 | Unclassified | 1358 |
| 501 | Ga0373954_0257278 | 3300035118 | Unclassified | 860 |
| 502 | Ga0373954_0409771 | 3300035118 | Unclassified | 670 |
| 503 | Ga0373956_0074960 | 3300035119 | Bacteria | 1547 |
| 504 | Ga0373960_0000111 | 3300035121 | Bacteria | 13140 |
| 505 | Ga0373960_0240367 | 3300035121 | Bacteria | 654 |
| 506 | Ga0373943_0327640 | 3300035170 | Unclassified | 874 |
| 507 | Ga0373946_0011756 | 3300035171 | Bacteria | 3273 |
| 508 | Ga0373955_0038971 | 3300035172 | Bacteria | 2534 |
| 509 | Ga0373955_0297689 | 3300035172 | Bacteria | 972 |
| 510 | Ga0373942_0000209 | 3300035207 | Bacteria | 15209 |
| 511 | Ga0373961_0002181 | 3300035241 | Bacteria | 5194 |
| 512 | Ga0373962_0011729 | 3300035242 | Bacteria | 2200 |
| 513 | Ga0373962_0069060 | 3300035242 | Bacteria | 1052 |
| 514 | Ga0373924_0131436 | 3300035410 | Bacteria | 1089 |
| 515 | Ga0373931_0002316 | 3300035691 | Bacteria | 8414 |
| 516 | Ga0373935_0047950 | 3300035692 | Bacteria | 2703 |
| 517 | Ga0373935_0060735 | 3300035692 | Unclassified | 2418 |
| 518 | Ga0373935_0150129 | 3300035692 | Bacteria | 1581 |
| 519 | Ga0373935_0366690 | 3300035692 | Bacteria | 1029 |
| 520 | Ga0373935_0772090 | 3300035692 | Unclassified | 709 |
| 521 | Ga0373927_0003122 | 3300035695 | Bacteria | 11979 |
| 522 | Ga0373927_0161115 | 3300035695 | Bacteria | 1470 |
| 523 | Ga0373927_0303384 | 3300035695 | Bacteria | 1051 |
| 524 | Ga0373947_0203911 | 3300035725 | Bacteria | 1295 |
| 525 | Ga0373947_0361599 | 3300035725 | Bacteria | 975 |
| 526 | Ga0373947_0582128 | 3300035725 | Unclassified | 762 |
| 527 | Ga0373937_0024576 | 3300036401 | Bacteria | 5436 |
| 528 | Ga0373937_0024622 | 3300036401 | Bacteria | 5430 |
| 529 | Ga0373937_0649532 | 3300036401 | Bacteria | 1000 |
| 530 | Ga0373925_0007400 | 3300037068 | Bacteria | 8011 |
| 531 | Ga0373925_1352407 | 3300037068 | Bacteria | 584 |
| 532 | Ga0436364_1555357 | 3300037853 | Unclassified | 1410 |
| 533 | Ga0439453_0009770 | 3300041408 | Bacteria | 1569 |
| 534 | Ga0439435_0194826 | 3300042436 | Bacteria | 666 |
| 535 | Ga0439460_0099428 | 3300042461 | Bacteria | 933 |
| 536 | Ga0466963_0249627 | 3300044694 | Bacteria | 1245 |
| 537 | Ga0453684_1753611 | 3300044712 | Bacteria | 633 |
| 538 | Ga0451576_0040683 | 3300045051 | Bacteria | 4917 |
| 539 | Ga0451576_0092252 | 3300045051 | Bacteria | 3150 |
| 540 | Ga0451576_0113585 | 3300045051 | Bacteria | 2819 |
| 541 | Ga0451576_0671639 | 3300045051 | Bacteria | 1089 |
| 542 | Ga0466967_0336347 | 3300045976 | Bacteria | 1459 |
| 543 | Ga0466967_1297180 | 3300045976 | Unclassified | 725 |
| 544 | Ga0495592_0021194 | 3300046454 | Bacteria | 4942 |
| 545 | Ga0495603_0362317 | 3300046455 | Bacteria | 832 |
| 546 | Ga0495591_112438 | 3300046458 | Bacteria | 668 |
| 547 | Ga0495651_0187952 | 3300046462 | Bacteria | 1456 |
| 548 | Ga0495580_0008121 | 3300046472 | Bacteria | 8369 |
| 549 | Ga0495580_0312073 | 3300046472 | Unclassified | 1070 |
| 550 | Ga0495582_0573113 | 3300046473 | Unclassified | 653 |
| 551 | Ga0495664_0175508 | 3300046477 | Bacteria | 1300 |
| 552 | Ga0495594_0354566 | 3300046499 | Bacteria | 835 |
| 553 | Ga0495594_0808988 | 3300046499 | Bacteria | 528 |
| 554 | Ga0495608_0034081 | 3300046511 | Bacteria | 3438 |
| 555 | Ga0495608_0300355 | 3300046511 | Bacteria | 994 |
| 556 | Ga0495618_0477455 | 3300046514 | Unclassified | 754 |
| 557 | Ga0495628_0030887 | 3300046516 | Bacteria | 4335 |
| 558 | Ga0495630_0041023 | 3300046517 | Bacteria | 3457 |
| 559 | Ga0495642_0014190 | 3300046528 | Bacteria | 3087 |
| 560 | Ga0495665_0062789 | 3300046531 | Bacteria | 1961 |
| 561 | Ga0495665_0454600 | 3300046531 | Unclassified | 647 |
| 562 | Ga0495640_0126420 | 3300046533 | Bacteria | 1658 |
| 563 | Ga0495640_0389277 | 3300046533 | Unclassified | 857 |
| 564 | Ga0495587_0057380 | 3300046536 | Bacteria | 2289 |
| 565 | Ga0495598_0140971 | 3300046537 | Bacteria | 834 |
| 566 | Ga0495598_0174964 | 3300046537 | Bacteria | 763 |
| 567 | Ga0495609_0113018 | 3300046538 | Bacteria | 1171 |
| 568 | Ga0495621_0064202 | 3300046539 | Unclassified | 1339 |
| 569 | Ga0495645_0332283 | 3300046543 | Bacteria | 984 |
| 570 | Ga0495633_0358887 | 3300046558 | Bacteria | 660 |
| 571 | Ga0495667_0394504 | 3300046559 | Unclassified | 872 |
| 572 | Ga0495667_0500268 | 3300046559 | Unclassified | 761 |
| 573 | Ga0495656_0636511 | 3300046615 | Unclassified | 572 |
| 574 | Ga0495634_0079911 | 3300046642 | Bacteria | 2141 |
| 575 | Ga0495634_0151009 | 3300046642 | Unclassified | 1469 |
| 576 | Ga0495634_0410910 | 3300046642 | Unclassified | 803 |
| 577 | Ga0495635_0240978 | 3300046663 | Unclassified | 1220 |
| 578 | Ga0495635_0678360 | 3300046663 | Unclassified | 669 |
| 579 | Ga0495659_0059166 | 3300046664 | Bacteria | 1411 |
| 580 | Ga0495659_0389155 | 3300046664 | Bacteria | 600 |
| 581 | Ga0495657_0389104 | 3300046675 | Unclassified | 822 |
| 582 | Ga0495599_0065619 | 3300046678 | Bacteria | 2268 |
| 583 | Ga0495646_0509723 | 3300046680 | Unclassified | 617 |
| 584 | Ga0495647_0017778 | 3300046681 | Bacteria | 2521 |
| 585 | Ga0495647_0467937 | 3300046681 | Unclassified | 585 |
| 586 | Ga0495658_0077931 | 3300046683 | Bacteria | 1939 |
| 587 | Ga0495658_0123757 | 3300046683 | Bacteria | 1567 |
| 588 | Ga0495669_0158542 | 3300046684 | Bacteria | 1074 |
| 589 | Ga0495613_0006776 | 3300046689 | Bacteria | 8551 |
| 590 | Ga0495613_0055291 | 3300046689 | Bacteria | 2916 |
| 591 | Ga0495613_0056038 | 3300046689 | Bacteria | 2895 |
| 592 | Ga0495613_0224044 | 3300046689 | Bacteria | 1319 |
| 593 | Ga0495613_0747537 | 3300046689 | Unclassified | 641 |
| 594 | Ga0495581_0620688 | 3300047315 | Unclassified | 626 |
| 595 | Ga0495604_0092753 | 3300047317 | Unclassified | 2236 |
| 596 | Ga0495636_0412710 | 3300047318 | Bacteria | 644 |
| 597 | Ga0495674_0052885 | 3300047319 | Bacteria | 3572 |
| 598 | Ga0495674_0328178 | 3300047319 | Bacteria | 1245 |
| 599 | Ga0495680_0100190 | 3300047322 | Bacteria | 2159 |
| 600 | Ga0495685_031904 | 3300047447 | Bacteria | 1810 |
| 601 | Ga0495684_0000053 | 3300047471 | Bacteria | 82157 |
| 602 | Ga0495602_0158349 | 3300048088 | Bacteria | 1771 |
| 603 | Ga0496100_0025659 | 3300048903 | Bacteria | 3606 |
| 604 | Ga0496101_0002033 | 3300048904 | Bacteria | 12304 |
| 605 | Ga0496101_0186390 | 3300048904 | Unclassified | 1600 |
| 606 | Ga0496102_0468433 | 3300048905 | Unclassified | 1181 |
| 607 | Ga0496104_0501925 | 3300048907 | Bacteria | 1124 |
| 608 | Ga0496104_0936194 | 3300048907 | Bacteria | 771 |
| 609 | Ga0496105_0853802 | 3300048908 | Bacteria | 689 |
| 610 | Ga0496106_0218693 | 3300048909 | Bacteria | 1519 |
| 611 | Ga0496109_0991075 | 3300048912 | Bacteria | 778 |
| 612 | Ga0496112_0356814 | 3300048915 | Bacteria | 1404 |
| 613 | Ga0496112_1347521 | 3300048915 | Bacteria | 629 |
| 614 | Ga0496114_0000224 | 3300048917 | Bacteria | 41100 |
| 615 | Ga0496114_0439598 | 3300048917 | Unclassified | 1155 |
| 616 | Ga0496114_1261067 | 3300048917 | Unclassified | 626 |
| 617 | Ga0501038_0484195 | 3300049574 | Bacteria | 948 |
| 618 | Ga0501040_0002994 | 3300049576 | Bacteria | 10939 |
| 619 | Ga0501041_0008795 | 3300049577 | Bacteria | 5943 |
| 620 | Ga0501042_0018474 | 3300049578 | Bacteria | 4827 |
| 621 | Ga0501043_0323227 | 3300049579 | Bacteria | 1176 |
| 622 | Ga0501067_0072969 | 3300049583 | Bacteria | 1902 |
| 623 | Ga0501067_0372914 | 3300049583 | Bacteria | 796 |
| 624 | Ga0501077_0291136 | 3300049593 | Bacteria | 1040 |
| 625 | Ga0501081_0173120 | 3300049743 | Bacteria | 1559 |
| 626 | Ga0501045_0253639 | 3300049824 | Bacteria | 1309 |
| 627 | nmdc:mga05p37_1286_c1 | 3300050507 | Bacteria | 29122 |
| 628 | nmdc:mga05p37_1366299_c1 | 3300050507 | Unclassified | 716 |
| 629 | nmdc:mga05p37_1682365_c1 | 3300050507 | Bacteria | 620 |
| 630 | nmdc:mga05p37_2604_c2 | 3300050507 | Bacteria | 9380 |
| 631 | nmdc:mga05p37_33262_c2 | 3300050507 | Unclassified | 3829 |
| 632 | nmdc:mga05p37_51966_c1 | 3300050507 | Bacteria | 5039 |
| 633 | nmdc:mga05p37_98504_c1 | 3300050507 | Bacteria | 3601 |
| 634 | nmdc:mga09592_104089_c1 | 3300050508 | Unclassified | 2432 |
| 635 | nmdc:mga09592_1391206_c1 | 3300050508 | Bacteria | 574 |
| 636 | nmdc:mga09592_57384_c2 | 3300050508 | Unclassified | 2837 |
| 637 | nmdc:mga09592_83643_c1 | 3300050508 | Bacteria | 2720 |
| 638 | nmdc:mga09592_8582_c1 | 3300050508 | Bacteria | 8312 |
| 639 | nmdc:mga0qj67_259059_c1 | 3300050509 | Bacteria | 1411 |
| 640 | nmdc:mga06r32_299855_c1 | 3300050510 | Bacteria | 1593 |
| 641 | nmdc:mga06r32_76337_c1 | 3300050510 | Unclassified | 3254 |
| 642 | nmdc:mga06r32_79019_c1 | 3300050510 | Bacteria | 3199 |
| 643 | nmdc:mga08y16_1456671_c1 | 3300050511 | Unclassified | 646 |
| 644 | nmdc:mga08y16_16989_c1 | 3300050511 | Bacteria | 7663 |
| 645 | nmdc:mga08y16_20147_c1 | 3300050511 | Bacteria | 7039 |
| 646 | nmdc:mga08y16_2_c1 | 3300050511 | Bacteria | 983367 |
| 647 | nmdc:mga08y16_527007_c1 | 3300050511 | Bacteria | 1198 |
| 648 | nmdc:mga08y16_56559_c1 | 3300050511 | Bacteria | 4099 |
| 649 | nmdc:mga0n895_1125415_c1 | 3300050512 | Bacteria | 762 |
| 650 | nmdc:mga0n895_1372649_c1 | 3300050512 | Unclassified | 676 |
| 651 | nmdc:mga0n895_155_c1 | 3300050512 | Bacteria | 42337 |
| 652 | nmdc:mga0n895_22134_c1 | 3300050512 | Bacteria | 5957 |
| 653 | nmdc:mga0n895_22949_c1 | 3300050512 | Bacteria | 5856 |
| 654 | nmdc:mga0n895_278071_c1 | 3300050512 | Bacteria | 1698 |
| 655 | nmdc:mga0n895_318284_c1 | 3300050512 | Bacteria | 1577 |
| 656 | nmdc:mga0n895_332434_c1 | 3300050512 | Unclassified | 1539 |
| 657 | nmdc:mga0n895_461514_c1 | 3300050512 | Bacteria | 1282 |
| 658 | nmdc:mga0n895_569327_c1 | 3300050512 | Bacteria | 1138 |
| 659 | nmdc:mga0rr50_110142_c1 | 3300050513 | Bacteria | 2178 |
| 660 | nmdc:mga0rr50_1117979_c1 | 3300050513 | Unclassified | 670 |
| 661 | nmdc:mga0rr50_130271_c1 | 3300050513 | Bacteria | 2013 |
| 662 | nmdc:mga0rr50_147625_c1 | 3300050513 | Bacteria | 1897 |
| 663 | nmdc:mga0rr50_2085_c1 | 3300050513 | Bacteria | 11170 |
| 664 | nmdc:mga0rr50_279927_c1 | 3300050513 | Bacteria | 1392 |
| 665 | nmdc:mga0rr50_421087_c1 | 3300050513 | Bacteria | 1130 |
| 666 | nmdc:mga0rr50_572626_c1 | 3300050513 | Bacteria | 962 |
| 667 | nmdc:mga0rr50_667167_c1 | 3300050513 | Bacteria | 887 |
| 668 | nmdc:mga0rr50_8_c1 | 3300050513 | Bacteria | 271775 |
| 669 | nmdc:mga08x19_1236723_c1 | 3300050514 | Bacteria | 529 |
| 670 | nmdc:mga08x19_518753_c1 | 3300050514 | Unclassified | 842 |
| 671 | nmdc:mga08x19_6227_c1 | 3300050514 | Bacteria | 7060 |
| 672 | nmdc:mga08x19_705276_c1 | 3300050514 | Bacteria | 716 |
| 673 | nmdc:mga08x19_725289_c1 | 3300050514 | Bacteria | 706 |
| 674 | nmdc:mga08x19_8441_c1 | 3300050514 | Bacteria | 6136 |
| 675 | nmdc:mga0a205_124959_c1 | 3300050515 | Unclassified | 2472 |
| 676 | nmdc:mga0a205_186381_c1 | 3300050515 | Bacteria | 1968 |
| 677 | nmdc:mga0a205_345667_c1 | 3300050515 | Bacteria | 1356 |
| 678 | nmdc:mga0a205_397971_c1 | 3300050515 | Unclassified | 1241 |
| 679 | nmdc:mga0a205_461751_c1 | 3300050515 | Unclassified | 1129 |
| 680 | nmdc:mga0a205_534994_c1 | 3300050515 | Bacteria | 1028 |
| 681 | Ga0495601_0585699 | 3300053077 | Unclassified | 716 |
| 682 | Ga0495595_0037229 | 3300053084 | Unclassified | 2211 |
| 683 | Ga0495595_0152132 | 3300053084 | Unclassified | 1139 |
| 684 | Ga0495619_0000467 | 3300053085 | Bacteria | 27272 |
| 685 | Ga0495619_0115407 | 3300053085 | Bacteria | 1838 |
| 686 | Ga0495619_0400805 | 3300053085 | Bacteria | 947 |
| 687 | Ga0500658_0460415 | 3300053134 | Unclassified | 578 |
| 688 | Ga0501084_0204622 | 3300054114 | Bacteria | 1666 |
| 689 | Ga0530510_0302798 | 3300061734 | Bacteria | 1196 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0113585 | Ga0451576_0113585_1531_1914 | 122 |
| 2 | 3300005546 | Ga0070696_100350568 | Ga0070696_1003505682 | 132 |
| 3 | 3300035111 | Ga0373923_0030845 | Ga0373923_0030845_66_470 | 132 |
| 4 | 3300035117 | Ga0373953_0034209 | Ga0373953_0034209_194_598 | 132 |
| 5 | 3300035118 | Ga0373954_0409771 | Ga0373954_0409771_121_525 | 132 |
| 6 | 3300035119 | Ga0373956_0074960 | Ga0373956_0074960_576_980 | 132 |
| 7 | 3300035172 | Ga0373955_0297689 | Ga0373955_0297689_415_819 | 132 |
| 8 | 3300035692 | Ga0373935_0366690 | Ga0373935_0366690_376_780 | 132 |
| 9 | 3300035695 | Ga0373927_0003122 | Ga0373927_0003122_10007_10411 | 132 |
| 10 | 3300035725 | Ga0373947_0203911 | Ga0373947_0203911_680_1084 | 132 |
| 11 | 3300036401 | Ga0373937_0024576 | Ga0373937_0024576_1351_1755 | 132 |
| 12 | 3300046472 | Ga0495580_0008121 | Ga0495580_0008121_4927_5331 | 132 |
| 13 | 3300046511 | Ga0495608_0300355 | Ga0495608_0300355_455_859 | 132 |
| 14 | 3300046531 | Ga0495665_0454600 | Ga0495665_0454600_26_430 | 132 |
| 15 | 3300046543 | Ga0495645_0332283 | Ga0495645_0332283_77_481 | 132 |
| 16 | 3300046559 | Ga0495667_0394504 | Ga0495667_0394504_280_684 | 132 |
| 17 | 3300046663 | Ga0495635_0678360 | Ga0495635_0678360_84_488 | 132 |
| 18 | 3300046680 | Ga0495646_0509723 | Ga0495646_0509723_183_587 | 132 |
| 19 | 3300046689 | Ga0495613_0224044 | Ga0495613_0224044_287_691 | 132 |
| 20 | 3300047319 | Ga0495674_0328178 | Ga0495674_0328178_746_1150 | 132 |
| 21 | 3300048088 | Ga0495602_0158349 | Ga0495602_0158349_688_1092 | 132 |
| 22 | 3300005468 | Ga0070707_100132105 | Ga0070707_1001321052 | 133 |
| 23 | 3300005518 | Ga0070699_100088560 | Ga0070699_1000885604 | 133 |
| 24 | 3300025922 | Ga0207646_10232911 | Ga0207646_102329112 | 133 |
| 25 | 3300046499 | Ga0495594_0808988 | Ga0495594_0808988_17_484 | 133 |
| 26 | 3300005330 | Ga0070690_100044608 | Ga0070690_1000446083 | 135 |
| 27 | 3300005335 | Ga0070666_10005197 | Ga0070666_100051979 | 135 |
| 28 | 3300005338 | Ga0068868_101236384 | Ga0068868_1012363841 | 135 |
| 29 | 3300005343 | Ga0070687_100018069 | Ga0070687_1000180693 | 135 |
| 30 | 3300005345 | Ga0070692_11090658 | Ga0070692_110906581 | 135 |
| 31 | 3300005366 | Ga0070659_100104759 | Ga0070659_1001047592 | 135 |
| 32 | 3300005436 | Ga0070713_100016406 | Ga0070713_1000164066 | 135 |
| 33 | 3300005436 | Ga0070713_100851994 | Ga0070713_1008519942 | 135 |
| 34 | 3300005439 | Ga0070711_100323950 | Ga0070711_1003239502 | 135 |
| 35 | 3300005457 | Ga0070662_100912737 | Ga0070662_1009127371 | 135 |
| 36 | 3300005578 | Ga0068854_100016621 | Ga0068854_1000166213 | 135 |
| 37 | 3300005842 | Ga0068858_100534659 | Ga0068858_1005346592 | 135 |
| 38 | 3300006028 | Ga0070717_10406113 | Ga0070717_104061133 | 135 |
| 39 | 3300009177 | Ga0105248_10203524 | Ga0105248_102035242 | 135 |
| 40 | 3300013297 | Ga0157378_12462910 | Ga0157378_124629101 | 135 |
| 41 | 3300013307 | Ga0157372_10227110 | Ga0157372_102271101 | 135 |
| 42 | 3300025903 | Ga0207680_10003047 | Ga0207680_100030473 | 135 |
| 43 | 3300025911 | Ga0207654_10160375 | Ga0207654_101603751 | 135 |
| 44 | 3300025918 | Ga0207662_10160184 | Ga0207662_101601842 | 135 |
| 45 | 3300025928 | Ga0207700_10012994 | Ga0207700_100129942 | 135 |
| 46 | 3300025941 | Ga0207711_10152869 | Ga0207711_101528692 | 135 |
| 47 | 3300025981 | Ga0207640_10092137 | Ga0207640_100921373 | 135 |
| 48 | 3300026035 | Ga0207703_10465325 | Ga0207703_104653252 | 135 |
| 49 | 3300035692 | Ga0373935_0772090 | Ga0373935_0772090_195_620 | 135 |
| 50 | 3300035695 | Ga0373927_0161115 | Ga0373927_0161115_311_736 | 135 |
| 51 | 3300050514 | nmdc:mga08x19_518753_c1 | nmdc:mga08x19_518753_c1_221_643 | 135 |
| 52 | 3300005293 | Ga0065715_11013547 | Ga0065715_110135471 | 136 |
| 53 | 3300005367 | Ga0070667_101562284 | Ga0070667_1015622841 | 136 |
| 54 | 3300005564 | Ga0070664_100422475 | Ga0070664_1004224752 | 136 |
| 55 | 3300005617 | Ga0068859_101539761 | Ga0068859_1015397611 | 136 |
| 56 | 3300006931 | Ga0097620_101539729 | Ga0097620_1015397292 | 136 |
| 57 | 3300009147 | Ga0114129_11329851 | Ga0114129_113298512 | 136 |
| 58 | 3300035118 | Ga0373954_0105903 | Ga0373954_0105903_543_1016 | 136 |
| 59 | 3300035692 | Ga0373935_0060735 | Ga0373935_0060735_1140_1613 | 136 |
| 60 | 3300035725 | Ga0373947_0582128 | Ga0373947_0582128_73_546 | 136 |
| 61 | 3300036401 | Ga0373937_0024622 | Ga0373937_0024622_1308_1781 | 136 |
| 62 | 3300045976 | Ga0466967_1297180 | Ga0466967_1297180_258_686 | 136 |
| 63 | 3300050511 | nmdc:mga08y16_1456671_c1 | nmdc:mga08y16_1456671_c1_28_501 | 136 |
| 64 | 3300005293 | Ga0065715_10382837 | Ga0065715_103828371 | 137 |
| 65 | 3300005330 | Ga0070690_100887440 | Ga0070690_1008874401 | 137 |
| 66 | 3300005339 | Ga0070660_100409308 | Ga0070660_1004093082 | 137 |
| 67 | 3300005340 | Ga0070689_100007594 | Ga0070689_1000075944 | 137 |
| 68 | 3300005343 | Ga0070687_100339225 | Ga0070687_1003392251 | 137 |
| 69 | 3300005354 | Ga0070675_100000420 | Ga0070675_1000004206 | 137 |
| 70 | 3300005406 | Ga0070703_10102669 | Ga0070703_101026693 | 137 |
| 71 | 3300005518 | Ga0070699_100019455 | Ga0070699_1000194557 | 137 |
| 72 | 3300005543 | Ga0070672_100045709 | Ga0070672_1000457095 | 137 |
| 73 | 3300005546 | Ga0070696_100008917 | Ga0070696_1000089174 | 137 |
| 74 | 3300005549 | Ga0070704_100533901 | Ga0070704_1005339012 | 137 |
| 75 | 3300005564 | Ga0070664_101084422 | Ga0070664_1010844221 | 137 |
| 76 | 3300005617 | Ga0068859_100004813 | Ga0068859_10000481316 | 137 |
| 77 | 3300005618 | Ga0068864_100479442 | Ga0068864_1004794423 | 137 |
| 78 | 3300005841 | Ga0068863_100657128 | Ga0068863_1006571282 | 137 |
| 79 | 3300005842 | Ga0068858_100033758 | Ga0068858_1000337585 | 137 |
| 80 | 3300005843 | Ga0068860_100008710 | Ga0068860_1000087108 | 137 |
| 81 | 3300006237 | Ga0097621_101092074 | Ga0097621_1010920741 | 137 |
| 82 | 3300006358 | Ga0068871_100989659 | Ga0068871_1009896592 | 137 |
| 83 | 3300006881 | Ga0068865_100250478 | Ga0068865_1002504782 | 137 |
| 84 | 3300006931 | Ga0097620_100004814 | Ga0097620_10000481416 | 137 |
| 85 | 3300013308 | Ga0157375_10171475 | Ga0157375_101714753 | 137 |
| 86 | 3300014745 | Ga0157377_10058158 | Ga0157377_100581583 | 137 |
| 87 | 3300034820 | Ga0373959_0075424 | Ga0373959_0075424_273_740 | 137 |
| 88 | 3300035121 | Ga0373960_0240367 | Ga0373960_0240367_146_613 | 137 |
| 89 | 3300037853 | Ga0436364_1555357 | Ga0436364_1555357_541_975 | 137 |
| 90 | 3300005340 | Ga0070689_100527183 | Ga0070689_1005271832 | 138 |
| 91 | 3300005341 | Ga0070691_10365503 | Ga0070691_103655032 | 138 |
| 92 | 3300005440 | Ga0070705_100035978 | Ga0070705_1000359782 | 138 |
| 93 | 3300005444 | Ga0070694_100188676 | Ga0070694_1001886762 | 138 |
| 94 | 3300005549 | Ga0070704_100040294 | Ga0070704_1000402943 | 138 |
| 95 | 3300026067 | Ga0207678_11499239 | Ga0207678_114992391 | 138 |
| 96 | 3300026118 | Ga0207675_100169087 | Ga0207675_1001690872 | 138 |
| 97 | 3300028381 | Ga0268264_10775127 | Ga0268264_107751271 | 138 |
| 98 | 3300031901 | Ga0307406_10296600 | Ga0307406_102966002 | 138 |
| 99 | 3300046473 | Ga0495582_0573113 | Ga0495582_0573113_115_543 | 138 |
| 100 | 3300046539 | Ga0495621_0064202 | Ga0495621_0064202_723_1181 | 138 |
| 101 | 3300046689 | Ga0495613_0006776 | Ga0495613_0006776_4695_5123 | 138 |
| 102 | 3300005434 | Ga0070709_10097681 | Ga0070709_100976811 | 139 |
| 103 | 3300005445 | Ga0070708_100036000 | Ga0070708_1000360002 | 139 |
| 104 | 3300006028 | Ga0070717_11372256 | Ga0070717_113722561 | 139 |
| 105 | 3300006173 | Ga0070716_100336903 | Ga0070716_1003369032 | 139 |
| 106 | 3300006175 | Ga0070712_101009227 | Ga0070712_1010092271 | 139 |
| 107 | 3300007076 | Ga0075435_100292109 | Ga0075435_1002921092 | 139 |
| 108 | 3300013297 | Ga0157378_12157689 | Ga0157378_121576892 | 139 |
| 109 | 3300025906 | Ga0207699_10056845 | Ga0207699_100568454 | 139 |
| 110 | 3300025915 | Ga0207693_10810326 | Ga0207693_108103261 | 139 |
| 111 | 3300025939 | Ga0207665_10353429 | Ga0207665_103534291 | 139 |
| 112 | 3300050514 | nmdc:mga08x19_705276_c1 | nmdc:mga08x19_705276_c1_201_647 | 139 |
| 113 | 3300005295 | Ga0065707_10017938 | Ga0065707_100179383 | 140 |
| 114 | 3300005340 | Ga0070689_100064840 | Ga0070689_1000648402 | 140 |
| 115 | 3300005354 | Ga0070675_100681561 | Ga0070675_1006815612 | 140 |
| 116 | 3300005365 | Ga0070688_100025850 | Ga0070688_1000258502 | 140 |
| 117 | 3300005456 | Ga0070678_100290418 | Ga0070678_1002904182 | 140 |
| 118 | 3300005617 | Ga0068859_100011030 | Ga0068859_1000110306 | 140 |
| 119 | 3300006880 | Ga0075429_101039023 | Ga0075429_1010390232 | 140 |
| 120 | 3300006931 | Ga0097620_100011030 | Ga0097620_1000110306 | 140 |
| 121 | 3300007076 | Ga0075435_100031431 | Ga0075435_1000314314 | 140 |
| 122 | 3300009147 | Ga0114129_12322984 | Ga0114129_123229841 | 140 |
| 123 | 3300025906 | Ga0207699_10236969 | Ga0207699_102369692 | 140 |
| 124 | 3300025926 | Ga0207659_11710316 | Ga0207659_117103161 | 140 |
| 125 | 3300025936 | Ga0207670_10008405 | Ga0207670_100084054 | 140 |
| 126 | 3300025939 | Ga0207665_10101987 | Ga0207665_101019873 | 140 |
| 127 | 3300035111 | Ga0373923_0025960 | Ga0373923_0025960_705_1157 | 140 |
| 128 | 3300035171 | Ga0373946_0011756 | Ga0373946_0011756_453_905 | 140 |
| 129 | 3300035172 | Ga0373955_0038971 | Ga0373955_0038971_918_1370 | 140 |
| 130 | 3300035410 | Ga0373924_0131436 | Ga0373924_0131436_239_691 | 140 |
| 131 | 3300035692 | Ga0373935_0047950 | Ga0373935_0047950_1837_2289 | 140 |
| 132 | 3300035695 | Ga0373927_0303384 | Ga0373927_0303384_504_956 | 140 |
| 133 | 3300037068 | Ga0373925_0007400 | Ga0373925_0007400_816_1268 | 140 |
| 134 | 3300045051 | Ga0451576_0092252 | Ga0451576_0092252_286_726 | 140 |
| 135 | 3300046537 | Ga0495598_0174964 | Ga0495598_0174964_185_625 | 140 |
| 136 | 3300046689 | Ga0495613_0056038 | Ga0495613_0056038_1013_1465 | 140 |
| 137 | 3300048905 | Ga0496102_0468433 | Ga0496102_0468433_354_797 | 140 |
| 138 | 3300050507 | nmdc:mga05p37_1682365_c1 | nmdc:mga05p37_1682365_c1_113_553 | 140 |
| 139 | 3300053085 | Ga0495619_0400805 | Ga0495619_0400805_172_624 | 140 |
| 140 | 3300005331 | Ga0070670_100192322 | Ga0070670_1001923222 | 141 |
| 141 | 3300005338 | Ga0068868_100447393 | Ga0068868_1004473933 | 141 |
| 142 | 3300005347 | Ga0070668_100537392 | Ga0070668_1005373921 | 141 |
| 143 | 3300005459 | Ga0068867_101157175 | Ga0068867_1011571751 | 141 |
| 144 | 3300005549 | Ga0070704_100042174 | Ga0070704_1000421741 | 141 |
| 145 | 3300005578 | Ga0068854_101153624 | Ga0068854_1011536241 | 141 |
| 146 | 3300005617 | Ga0068859_100013716 | Ga0068859_1000137167 | 141 |
| 147 | 3300005618 | Ga0068864_100097966 | Ga0068864_1000979663 | 141 |
| 148 | 3300005718 | Ga0068866_10056148 | Ga0068866_100561484 | 141 |
| 149 | 3300005718 | Ga0068866_11155705 | Ga0068866_111557051 | 141 |
| 150 | 3300005843 | Ga0068860_101878042 | Ga0068860_1018780421 | 141 |
| 151 | 3300006163 | Ga0070715_10210119 | Ga0070715_102101191 | 141 |
| 152 | 3300006173 | Ga0070716_100754377 | Ga0070716_1007543771 | 141 |
| 153 | 3300006358 | Ga0068871_100055583 | Ga0068871_1000555832 | 141 |
| 154 | 3300006358 | Ga0068871_100148282 | Ga0068871_1001482822 | 141 |
| 155 | 3300006931 | Ga0097620_100013716 | Ga0097620_1000137162 | 141 |
| 156 | 3300009148 | Ga0105243_11149257 | Ga0105243_111492571 | 141 |
| 157 | 3300009177 | Ga0105248_10967486 | Ga0105248_109674862 | 141 |
| 158 | 3300011119 | Ga0105246_10505143 | Ga0105246_105051431 | 141 |
| 159 | 3300014325 | Ga0163163_10037770 | Ga0163163_100377705 | 141 |
| 160 | 3300014969 | Ga0157376_10484951 | Ga0157376_104849511 | 141 |
| 161 | 3300025899 | Ga0207642_10739692 | Ga0207642_107396921 | 141 |
| 162 | 3300025925 | Ga0207650_10306765 | Ga0207650_103067652 | 141 |
| 163 | 3300025938 | Ga0207704_10113790 | Ga0207704_101137903 | 141 |
| 164 | 3300026035 | Ga0207703_11056503 | Ga0207703_110565031 | 141 |
| 165 | 3300026089 | Ga0207648_10817522 | Ga0207648_108175221 | 141 |
| 166 | 3300026095 | Ga0207676_10078620 | Ga0207676_100786203 | 141 |
| 167 | 3300026116 | Ga0207674_10193538 | Ga0207674_101935382 | 141 |
| 168 | 3300026121 | Ga0207683_10707836 | Ga0207683_107078361 | 141 |
| 169 | 3300028381 | Ga0268264_11278527 | Ga0268264_112785273 | 141 |
| 170 | 3300035116 | Ga0373945_0074619 | Ga0373945_0074619_719_1174 | 141 |
| 171 | 3300046499 | Ga0495594_0354566 | Ga0495594_0354566_327_782 | 141 |
| 172 | 3300046533 | Ga0495640_0389277 | Ga0495640_0389277_30_485 | 141 |
| 173 | 3300046642 | Ga0495634_0410910 | Ga0495634_0410910_316_771 | 141 |
| 174 | 3300046675 | Ga0495657_0389104 | Ga0495657_0389104_40_477 | 141 |
| 175 | 3300046681 | Ga0495647_0017778 | Ga0495647_0017778_1128_1583 | 141 |
| 176 | 3300046683 | Ga0495658_0123757 | Ga0495658_0123757_1018_1473 | 141 |
| 177 | 3300046689 | Ga0495613_0747537 | Ga0495613_0747537_101_556 | 141 |
| 178 | 3300047315 | Ga0495581_0620688 | Ga0495581_0620688_29_484 | 141 |
| 179 | 3300048903 | Ga0496100_0025659 | Ga0496100_0025659_1441_1893 | 141 |
| 180 | 3300048904 | Ga0496101_0002033 | Ga0496101_0002033_996_1448 | 141 |
| 181 | 3300048917 | Ga0496114_0000224 | Ga0496114_0000224_19180_19632 | 141 |
| 182 | 3300050513 | nmdc:mga0rr50_667167_c1 | nmdc:mga0rr50_667167_c1_195_653 | 141 |
| 183 | 3300053084 | Ga0495595_0152132 | Ga0495595_0152132_399_851 | 141 |
| 184 | 3300005334 | Ga0068869_100184698 | Ga0068869_1001846982 | 142 |
| 185 | 3300005335 | Ga0070666_10236424 | Ga0070666_102364242 | 142 |
| 186 | 3300005459 | Ga0068867_100048878 | Ga0068867_1000488783 | 142 |
| 187 | 3300005548 | Ga0070665_100007666 | Ga0070665_1000076667 | 142 |
| 188 | 3300006237 | Ga0097621_100036808 | Ga0097621_1000368085 | 142 |
| 189 | 3300006852 | Ga0075433_10186648 | Ga0075433_101866482 | 142 |
| 190 | 3300006871 | Ga0075434_100151091 | Ga0075434_1001510913 | 142 |
| 191 | 3300009148 | Ga0105243_11205774 | Ga0105243_112057742 | 142 |
| 192 | 3300009176 | Ga0105242_10003405 | Ga0105242_100034057 | 142 |
| 193 | 3300009177 | Ga0105248_10370785 | Ga0105248_103707852 | 142 |
| 194 | 3300013297 | Ga0157378_10239618 | Ga0157378_102396181 | 142 |
| 195 | 3300013306 | Ga0163162_10096350 | Ga0163162_100963503 | 142 |
| 196 | 3300014326 | Ga0157380_10958032 | Ga0157380_109580322 | 142 |
| 197 | 3300014968 | Ga0157379_10412566 | Ga0157379_104125663 | 142 |
| 198 | 3300014969 | Ga0157376_10141916 | Ga0157376_101419162 | 142 |
| 199 | 3300025903 | Ga0207680_10184829 | Ga0207680_101848293 | 142 |
| 200 | 3300025927 | Ga0207687_10071059 | Ga0207687_100710593 | 142 |
| 201 | 3300025934 | Ga0207686_10060080 | Ga0207686_100600802 | 142 |
| 202 | 3300025937 | Ga0207669_11080888 | Ga0207669_110808881 | 142 |
| 203 | 3300025941 | Ga0207711_10779599 | Ga0207711_107795993 | 142 |
| 204 | 3300025942 | Ga0207689_10279317 | Ga0207689_102793172 | 142 |
| 205 | 3300025981 | Ga0207640_10418534 | Ga0207640_104185341 | 142 |
| 206 | 3300026089 | Ga0207648_10025117 | Ga0207648_100251175 | 142 |
| 207 | 3300027907 | Ga0207428_11010378 | Ga0207428_110103781 | 142 |
| 208 | 3300028379 | Ga0268266_10007524 | Ga0268266_100075247 | 142 |
| 209 | 3300035725 | Ga0373947_0361599 | Ga0373947_0361599_470_904 | 142 |
| 210 | 3300037068 | Ga0373925_1352407 | Ga0373925_1352407_123_557 | 142 |
| 211 | 3300044694 | Ga0466963_0249627 | Ga0466963_0249627_657_1106 | 142 |
| 212 | 3300045976 | Ga0466967_0336347 | Ga0466967_0336347_105_554 | 142 |
| 213 | 3300046455 | Ga0495603_0362317 | Ga0495603_0362317_44_478 | 142 |
| 214 | 3300048917 | Ga0496114_0439598 | Ga0496114_0439598_272_706 | 142 |
| 215 | 3300049583 | Ga0501067_0072969 | Ga0501067_0072969_1247_1681 | 142 |
| 216 | 3300050509 | nmdc:mga0qj67_259059_c1 | nmdc:mga0qj67_259059_c1_874_1314 | 142 |
| 217 | 3300050512 | nmdc:mga0n895_332434_c1 | nmdc:mga0n895_332434_c1_924_1358 | 142 |
| 218 | 3300050513 | nmdc:mga0rr50_572626_c1 | nmdc:mga0rr50_572626_c1_415_861 | 142 |
| 219 | 3300050514 | nmdc:mga08x19_1236723_c1 | nmdc:mga08x19_1236723_c1_15_461 | 142 |
| 220 | 3300053134 | Ga0500658_0460415 | Ga0500658_0460415_24_458 | 142 |
| 221 | 3300005293 | Ga0065715_10105377 | Ga0065715_101053773 | 143 |
| 222 | 3300005293 | Ga0065715_11157041 | Ga0065715_111570411 | 143 |
| 223 | 3300005331 | Ga0070670_100056545 | Ga0070670_1000565455 | 143 |
| 224 | 3300005334 | Ga0068869_101051464 | Ga0068869_1010514642 | 143 |
| 225 | 3300005339 | Ga0070660_100776742 | Ga0070660_1007767422 | 143 |
| 226 | 3300005340 | Ga0070689_100004437 | Ga0070689_1000044375 | 143 |
| 227 | 3300005340 | Ga0070689_100157305 | Ga0070689_1001573052 | 143 |
| 228 | 3300005345 | Ga0070692_10548435 | Ga0070692_105484352 | 143 |
| 229 | 3300005345 | Ga0070692_10844625 | Ga0070692_108446251 | 143 |
| 230 | 3300005347 | Ga0070668_100746430 | Ga0070668_1007464302 | 143 |
| 231 | 3300005353 | Ga0070669_100003956 | Ga0070669_1000039567 | 143 |
| 232 | 3300005353 | Ga0070669_100013215 | Ga0070669_1000132156 | 143 |
| 233 | 3300005353 | Ga0070669_100236595 | Ga0070669_1002365952 | 143 |
| 234 | 3300005354 | Ga0070675_100015160 | Ga0070675_1000151604 | 143 |
| 235 | 3300005354 | Ga0070675_100903125 | Ga0070675_1009031253 | 143 |
| 236 | 3300005356 | Ga0070674_100034274 | Ga0070674_1000342743 | 143 |
| 237 | 3300005365 | Ga0070688_100021695 | Ga0070688_1000216953 | 143 |
| 238 | 3300005366 | Ga0070659_100914461 | Ga0070659_1009144611 | 143 |
| 239 | 3300005438 | Ga0070701_10006396 | Ga0070701_100063964 | 143 |
| 240 | 3300005440 | Ga0070705_100141952 | Ga0070705_1001419523 | 143 |
| 241 | 3300005441 | Ga0070700_100320739 | Ga0070700_1003207392 | 143 |
| 242 | 3300005444 | Ga0070694_100020555 | Ga0070694_1000205553 | 143 |
| 243 | 3300005457 | Ga0070662_100024350 | Ga0070662_1000243504 | 143 |
| 244 | 3300005457 | Ga0070662_100121692 | Ga0070662_1001216922 | 143 |
| 245 | 3300005471 | Ga0070698_101219248 | Ga0070698_1012192482 | 143 |
| 246 | 3300005545 | Ga0070695_100298064 | Ga0070695_1002980642 | 143 |
| 247 | 3300005577 | Ga0068857_100001266 | Ga0068857_10000126618 | 143 |
| 248 | 3300005577 | Ga0068857_100181290 | Ga0068857_1001812904 | 143 |
| 249 | 3300005616 | Ga0068852_100870742 | Ga0068852_1008707422 | 143 |
| 250 | 3300005617 | Ga0068859_100005036 | Ga0068859_10000503614 | 143 |
| 251 | 3300005618 | Ga0068864_100237196 | Ga0068864_1002371962 | 143 |
| 252 | 3300005718 | Ga0068866_10159885 | Ga0068866_101598852 | 143 |
| 253 | 3300005719 | Ga0068861_100129069 | Ga0068861_1001290693 | 143 |
| 254 | 3300005840 | Ga0068870_10007388 | Ga0068870_100073882 | 143 |
| 255 | 3300005842 | Ga0068858_100097790 | Ga0068858_1000977902 | 143 |
| 256 | 3300005843 | Ga0068860_100465341 | Ga0068860_1004653412 | 143 |
| 257 | 3300005844 | Ga0068862_100006051 | Ga0068862_1000060519 | 143 |
| 258 | 3300006844 | Ga0075428_100740949 | Ga0075428_1007409492 | 143 |
| 259 | 3300006844 | Ga0075428_101205477 | Ga0075428_1012054771 | 143 |
| 260 | 3300006846 | Ga0075430_100000072 | Ga0075430_10000007248 | 143 |
| 261 | 3300006846 | Ga0075430_100242321 | Ga0075430_1002423212 | 143 |
| 262 | 3300006847 | Ga0075431_100013452 | Ga0075431_1000134526 | 143 |
| 263 | 3300006847 | Ga0075431_101088522 | Ga0075431_1010885221 | 143 |
| 264 | 3300006852 | Ga0075433_10573214 | Ga0075433_105732142 | 143 |
| 265 | 3300006871 | Ga0075434_100672911 | Ga0075434_1006729112 | 143 |
| 266 | 3300006880 | Ga0075429_100019241 | Ga0075429_1000192412 | 143 |
| 267 | 3300006880 | Ga0075429_100670107 | Ga0075429_1006701072 | 143 |
| 268 | 3300006881 | Ga0068865_100256718 | Ga0068865_1002567182 | 143 |
| 269 | 3300006931 | Ga0097620_100005036 | Ga0097620_1000050364 | 143 |
| 270 | 3300009098 | Ga0105245_11026190 | Ga0105245_110261901 | 143 |
| 271 | 3300009147 | Ga0114129_10601186 | Ga0114129_106011861 | 143 |
| 272 | 3300009176 | Ga0105242_10142350 | Ga0105242_101423503 | 143 |
| 273 | 3300014325 | Ga0163163_10616231 | Ga0163163_106162311 | 143 |
| 274 | 3300014326 | Ga0157380_10467495 | Ga0157380_104674952 | 143 |
| 275 | 3300014969 | Ga0157376_10034851 | Ga0157376_100348514 | 143 |
| 276 | 3300025908 | Ga0207643_10003059 | Ga0207643_100030599 | 143 |
| 277 | 3300025908 | Ga0207643_10003533 | Ga0207643_100035332 | 143 |
| 278 | 3300025923 | Ga0207681_10001613 | Ga0207681_100016133 | 143 |
| 279 | 3300025923 | Ga0207681_10562880 | Ga0207681_105628802 | 143 |
| 280 | 3300025925 | Ga0207650_10105381 | Ga0207650_101053812 | 143 |
| 281 | 3300025933 | Ga0207706_10043015 | Ga0207706_100430152 | 143 |
| 282 | 3300025935 | Ga0207709_10117223 | Ga0207709_101172232 | 143 |
| 283 | 3300025936 | Ga0207670_10012794 | Ga0207670_100127946 | 143 |
| 284 | 3300025938 | Ga0207704_10038785 | Ga0207704_100387852 | 143 |
| 285 | 3300025945 | Ga0207679_10081320 | Ga0207679_100813204 | 143 |
| 286 | 3300025960 | Ga0207651_10023303 | Ga0207651_100233033 | 143 |
| 287 | 3300025961 | Ga0207712_10007323 | Ga0207712_100073234 | 143 |
| 288 | 3300025972 | Ga0207668_10014395 | Ga0207668_100143952 | 143 |
| 289 | 3300025972 | Ga0207668_10080879 | Ga0207668_100808791 | 143 |
| 290 | 3300026035 | Ga0207703_10190728 | Ga0207703_101907283 | 143 |
| 291 | 3300026035 | Ga0207703_10244652 | Ga0207703_102446522 | 143 |
| 292 | 3300026075 | Ga0207708_10105502 | Ga0207708_101055022 | 143 |
| 293 | 3300026075 | Ga0207708_11050039 | Ga0207708_110500391 | 143 |
| 294 | 3300026089 | Ga0207648_10001866 | Ga0207648_100018665 | 143 |
| 295 | 3300026116 | Ga0207674_10019158 | Ga0207674_100191586 | 143 |
| 296 | 3300026116 | Ga0207674_10084419 | Ga0207674_100844195 | 143 |
| 297 | 3300026118 | Ga0207675_100015632 | Ga0207675_1000156325 | 143 |
| 298 | 3300026118 | Ga0207675_100181116 | Ga0207675_1001811162 | 143 |
| 299 | 3300026118 | Ga0207675_100275563 | Ga0207675_1002755632 | 143 |
| 300 | 3300026142 | Ga0207698_10744277 | Ga0207698_107442772 | 143 |
| 301 | 3300027907 | Ga0207428_10003716 | Ga0207428_100037163 | 143 |
| 302 | 3300028380 | Ga0268265_10000421 | Ga0268265_1000042131 | 143 |
| 303 | 3300028381 | Ga0268264_10421067 | Ga0268264_104210672 | 143 |
| 304 | 3300044712 | Ga0453684_1753611 | Ga0453684_1753611_177_614 | 143 |
| 305 | 3300045051 | Ga0451576_0671639 | Ga0451576_0671639_187_624 | 143 |
| 306 | 3300048915 | Ga0496112_1347521 | Ga0496112_1347521_43_492 | 143 |
| 307 | 3300049593 | Ga0501077_0291136 | Ga0501077_0291136_59_496 | 143 |
| 308 | 3300050508 | nmdc:mga09592_104089_c1 | nmdc:mga09592_104089_c1_224_661 | 143 |
| 309 | 3300050511 | nmdc:mga08y16_16989_c1 | nmdc:mga08y16_16989_c1_1304_1741 | 143 |
| 310 | 3300050513 | nmdc:mga0rr50_1117979_c1 | nmdc:mga0rr50_1117979_c1_130_567 | 143 |
| 311 | 3300050515 | nmdc:mga0a205_461751_c1 | nmdc:mga0a205_461751_c1_558_995 | 143 |
| 312 | 3300005290 | Ga0065712_10267094 | Ga0065712_102670942 | 144 |
| 313 | 3300005355 | Ga0070671_101453163 | Ga0070671_1014531631 | 144 |
| 314 | 3300005365 | Ga0070688_100480872 | Ga0070688_1004808721 | 144 |
| 315 | 3300005543 | Ga0070672_101484802 | Ga0070672_1014848021 | 144 |
| 316 | 3300005563 | Ga0068855_100287927 | Ga0068855_1002879272 | 144 |
| 317 | 3300005719 | Ga0068861_100243105 | Ga0068861_1002431053 | 144 |
| 318 | 3300005719 | Ga0068861_100728803 | Ga0068861_1007288032 | 144 |
| 319 | 3300005844 | Ga0068862_100014260 | Ga0068862_1000142606 | 144 |
| 320 | 3300006844 | Ga0075428_100000056 | Ga0075428_10000005630 | 144 |
| 321 | 3300006844 | Ga0075428_100825542 | Ga0075428_1008255422 | 144 |
| 322 | 3300006847 | Ga0075431_100110346 | Ga0075431_1001103462 | 144 |
| 323 | 3300006871 | Ga0075434_100184004 | Ga0075434_1001840042 | 144 |
| 324 | 3300007076 | Ga0075435_100000962 | Ga0075435_1000009625 | 144 |
| 325 | 3300009094 | Ga0111539_10000002 | Ga0111539_10000002251 | 144 |
| 326 | 3300009094 | Ga0111539_10021656 | Ga0111539_100216566 | 144 |
| 327 | 3300009098 | Ga0105245_10344157 | Ga0105245_103441572 | 144 |
| 328 | 3300009147 | Ga0114129_10012031 | Ga0114129_100120316 | 144 |
| 329 | 3300009147 | Ga0114129_10022700 | Ga0114129_100227002 | 144 |
| 330 | 3300009147 | Ga0114129_10284660 | Ga0114129_102846603 | 144 |
| 331 | 3300009177 | Ga0105248_10466773 | Ga0105248_104667732 | 144 |
| 332 | 3300009553 | Ga0105249_12636839 | Ga0105249_126368391 | 144 |
| 333 | 3300010375 | Ga0105239_12002347 | Ga0105239_120023471 | 144 |
| 334 | 3300013308 | Ga0157375_10359266 | Ga0157375_103592663 | 144 |
| 335 | 3300014326 | Ga0157380_10037251 | Ga0157380_100372514 | 144 |
| 336 | 3300014968 | Ga0157379_11489864 | Ga0157379_114898641 | 144 |
| 337 | 3300015265 | Ga0182005_1148521 | Ga0182005_11485211 | 144 |
| 338 | 3300025923 | Ga0207681_10006385 | Ga0207681_100063858 | 144 |
| 339 | 3300025925 | Ga0207650_10865767 | Ga0207650_108657672 | 144 |
| 340 | 3300025927 | Ga0207687_10344747 | Ga0207687_103447472 | 144 |
| 341 | 3300025933 | Ga0207706_10277433 | Ga0207706_102774332 | 144 |
| 342 | 3300025937 | Ga0207669_10442722 | Ga0207669_104427222 | 144 |
| 343 | 3300025938 | Ga0207704_10921979 | Ga0207704_109219792 | 144 |
| 344 | 3300025940 | Ga0207691_10189119 | Ga0207691_101891192 | 144 |
| 345 | 3300025940 | Ga0207691_10863845 | Ga0207691_108638451 | 144 |
| 346 | 3300025949 | Ga0207667_10133590 | Ga0207667_101335903 | 144 |
| 347 | 3300025972 | Ga0207668_10632155 | Ga0207668_106321552 | 144 |
| 348 | 3300026023 | Ga0207677_10297655 | Ga0207677_102976552 | 144 |
| 349 | 3300026118 | Ga0207675_100084976 | Ga0207675_1000849765 | 144 |
| 350 | 3300026118 | Ga0207675_100167340 | Ga0207675_1001673402 | 144 |
| 351 | 3300027907 | Ga0207428_10000004 | Ga0207428_10000004405 | 144 |
| 352 | 3300027907 | Ga0207428_10084357 | Ga0207428_100843572 | 144 |
| 353 | 3300028380 | Ga0268265_10129348 | Ga0268265_101293482 | 144 |
| 354 | 3300034816 | Ga0373930_0004773 | Ga0373930_0004773_294_749 | 144 |
| 355 | 3300034818 | Ga0373950_0032529 | Ga0373950_0032529_20_475 | 144 |
| 356 | 3300034820 | Ga0373959_0000414 | Ga0373959_0000414_4098_4553 | 144 |
| 357 | 3300035084 | Ga0373928_0001753 | Ga0373928_0001753_116_571 | 144 |
| 358 | 3300035085 | Ga0373929_0000819 | Ga0373929_0000819_454_909 | 144 |
| 359 | 3300035088 | Ga0373940_0000568 | Ga0373940_0000568_2670_3125 | 144 |
| 360 | 3300035090 | Ga0373949_0001899 | Ga0373949_0001899_4225_4680 | 144 |
| 361 | 3300035091 | Ga0373951_0001057 | Ga0373951_0001057_3765_4220 | 144 |
| 362 | 3300035092 | Ga0373952_0001303 | Ga0373952_0001303_1515_1970 | 144 |
| 363 | 3300035112 | Ga0373932_0001327 | Ga0373932_0001327_3425_3880 | 144 |
| 364 | 3300035114 | Ga0373939_0002741 | Ga0373939_0002741_1715_2170 | 144 |
| 365 | 3300035115 | Ga0373941_0001420 | Ga0373941_0001420_3851_4306 | 144 |
| 366 | 3300035121 | Ga0373960_0000111 | Ga0373960_0000111_6758_7213 | 144 |
| 367 | 3300035207 | Ga0373942_0000209 | Ga0373942_0000209_10603_11058 | 144 |
| 368 | 3300035241 | Ga0373961_0002181 | Ga0373961_0002181_332_787 | 144 |
| 369 | 3300035242 | Ga0373962_0069060 | Ga0373962_0069060_328_783 | 144 |
| 370 | 3300035691 | Ga0373931_0002316 | Ga0373931_0002316_5313_5768 | 144 |
| 371 | 3300045051 | Ga0451576_0040683 | Ga0451576_0040683_1516_1971 | 144 |
| 372 | 3300046664 | Ga0495659_0389155 | Ga0495659_0389155_41_478 | 144 |
| 373 | 3300048909 | Ga0496106_0218693 | Ga0496106_0218693_358_813 | 144 |
| 374 | 3300049583 | Ga0501067_0372914 | Ga0501067_0372914_90_545 | 144 |
| 375 | 3300050507 | nmdc:mga05p37_1366299_c1 | nmdc:mga05p37_1366299_c1_259_705 | 144 |
| 376 | 3300050507 | nmdc:mga05p37_2604_c2 | nmdc:mga05p37_2604_c2_3846_4301 | 144 |
| 377 | 3300050507 | nmdc:mga05p37_33262_c2 | nmdc:mga05p37_33262_c2_1352_1843 | 144 |
| 378 | 3300050507 | nmdc:mga05p37_51966_c1 | nmdc:mga05p37_51966_c1_2122_2568 | 144 |
| 379 | 3300050508 | nmdc:mga09592_57384_c2 | nmdc:mga09592_57384_c2_123_614 | 144 |
| 380 | 3300050510 | nmdc:mga06r32_79019_c1 | nmdc:mga06r32_79019_c1_2035_2475 | 144 |
| 381 | 3300050511 | nmdc:mga08y16_2_c1 | nmdc:mga08y16_2_c1_673450_673890 | 144 |
| 382 | 3300050511 | nmdc:mga08y16_56559_c1 | nmdc:mga08y16_56559_c1_1610_2065 | 144 |
| 383 | 3300050512 | nmdc:mga0n895_1372649_c1 | nmdc:mga0n895_1372649_c1_103_558 | 144 |
| 384 | 3300050512 | nmdc:mga0n895_22949_c1 | nmdc:mga0n895_22949_c1_1667_2122 | 144 |
| 385 | 3300050513 | nmdc:mga0rr50_2085_c1 | nmdc:mga0rr50_2085_c1_7180_7638 | 144 |
| 386 | 3300050515 | nmdc:mga0a205_124959_c1 | nmdc:mga0a205_124959_c1_1676_2167 | 144 |
| 387 | 3300005289 | Ga0065704_10304040 | Ga0065704_103040402 | 145 |
| 388 | 3300005328 | Ga0070676_10019922 | Ga0070676_100199223 | 145 |
| 389 | 3300005330 | Ga0070690_100077917 | Ga0070690_1000779172 | 145 |
| 390 | 3300005339 | Ga0070660_100116064 | Ga0070660_1001160642 | 145 |
| 391 | 3300005341 | Ga0070691_10197266 | Ga0070691_101972662 | 145 |
| 392 | 3300005345 | Ga0070692_10069121 | Ga0070692_100691212 | 145 |
| 393 | 3300005347 | Ga0070668_100051959 | Ga0070668_1000519593 | 145 |
| 394 | 3300005355 | Ga0070671_100052813 | Ga0070671_1000528133 | 145 |
| 395 | 3300005364 | Ga0070673_100063095 | Ga0070673_1000630952 | 145 |
| 396 | 3300005438 | Ga0070701_10116861 | Ga0070701_101168612 | 145 |
| 397 | 3300005440 | Ga0070705_100000037 | Ga0070705_10000003760 | 145 |
| 398 | 3300005440 | Ga0070705_100013278 | Ga0070705_1000132784 | 145 |
| 399 | 3300005441 | Ga0070700_100021963 | Ga0070700_1000219633 | 145 |
| 400 | 3300005441 | Ga0070700_100073743 | Ga0070700_1000737432 | 145 |
| 401 | 3300005441 | Ga0070700_100161970 | Ga0070700_1001619701 | 145 |
| 402 | 3300005444 | Ga0070694_100001204 | Ga0070694_1000012048 | 145 |
| 403 | 3300005444 | Ga0070694_100001228 | Ga0070694_1000012287 | 145 |
| 404 | 3300005444 | Ga0070694_100010891 | Ga0070694_1000108913 | 145 |
| 405 | 3300005445 | Ga0070708_101184080 | Ga0070708_1011840801 | 145 |
| 406 | 3300005459 | Ga0068867_100011482 | Ga0068867_1000114825 | 145 |
| 407 | 3300005467 | Ga0070706_100418119 | Ga0070706_1004181193 | 145 |
| 408 | 3300005468 | Ga0070707_100836009 | Ga0070707_1008360092 | 145 |
| 409 | 3300005471 | Ga0070698_100052702 | Ga0070698_1000527024 | 145 |
| 410 | 3300005518 | Ga0070699_100077668 | Ga0070699_1000776683 | 145 |
| 411 | 3300005535 | Ga0070684_100581855 | Ga0070684_1005818551 | 145 |
| 412 | 3300005536 | Ga0070697_101257660 | Ga0070697_1012576601 | 145 |
| 413 | 3300005543 | Ga0070672_100060990 | Ga0070672_1000609903 | 145 |
| 414 | 3300005543 | Ga0070672_100264523 | Ga0070672_1002645232 | 145 |
| 415 | 3300005543 | Ga0070672_101258152 | Ga0070672_1012581521 | 145 |
| 416 | 3300005545 | Ga0070695_100000085 | Ga0070695_10000008520 | 145 |
| 417 | 3300005546 | Ga0070696_100000139 | Ga0070696_10000013935 | 145 |
| 418 | 3300005549 | Ga0070704_100000453 | Ga0070704_10000045321 | 145 |
| 419 | 3300005549 | Ga0070704_100002706 | Ga0070704_1000027065 | 145 |
| 420 | 3300005549 | Ga0070704_100444049 | Ga0070704_1004440492 | 145 |
| 421 | 3300005840 | Ga0068870_10009645 | Ga0068870_100096453 | 145 |
| 422 | 3300005844 | Ga0068862_100727062 | Ga0068862_1007270623 | 145 |
| 423 | 3300006844 | Ga0075428_100002585 | Ga0075428_10000258517 | 145 |
| 424 | 3300006844 | Ga0075428_100093273 | Ga0075428_1000932734 | 145 |
| 425 | 3300006844 | Ga0075428_100236343 | Ga0075428_1002363432 | 145 |
| 426 | 3300006844 | Ga0075428_100531833 | Ga0075428_1005318332 | 145 |
| 427 | 3300006852 | Ga0075433_10181092 | Ga0075433_101810922 | 145 |
| 428 | 3300006871 | Ga0075434_100040479 | Ga0075434_1000404793 | 145 |
| 429 | 3300006871 | Ga0075434_100155144 | Ga0075434_1001551443 | 145 |
| 430 | 3300006871 | Ga0075434_100217520 | Ga0075434_1002175203 | 145 |
| 431 | 3300006880 | Ga0075429_100094158 | Ga0075429_1000941584 | 145 |
| 432 | 3300006914 | Ga0075436_100017364 | Ga0075436_1000173644 | 145 |
| 433 | 3300007076 | Ga0075435_100000028 | Ga0075435_10000002830 | 145 |
| 434 | 3300009094 | Ga0111539_10020340 | Ga0111539_100203404 | 145 |
| 435 | 3300009094 | Ga0111539_10043711 | Ga0111539_100437112 | 145 |
| 436 | 3300009098 | Ga0105245_10173726 | Ga0105245_101737262 | 145 |
| 437 | 3300009101 | Ga0105247_10009886 | Ga0105247_100098867 | 145 |
| 438 | 3300009147 | Ga0114129_10001718 | Ga0114129_1000171818 | 145 |
| 439 | 3300009147 | Ga0114129_10086253 | Ga0114129_100862532 | 145 |
| 440 | 3300009147 | Ga0114129_10208473 | Ga0114129_102084733 | 145 |
| 441 | 3300009147 | Ga0114129_10341257 | Ga0114129_103412571 | 145 |
| 442 | 3300009147 | Ga0114129_10678885 | Ga0114129_106788852 | 145 |
| 443 | 3300009148 | Ga0105243_10145046 | Ga0105243_101450462 | 145 |
| 444 | 3300009176 | Ga0105242_10263971 | Ga0105242_102639712 | 145 |
| 445 | 3300009177 | Ga0105248_10036273 | Ga0105248_100362733 | 145 |
| 446 | 3300009177 | Ga0105248_10252430 | Ga0105248_102524301 | 145 |
| 447 | 3300009553 | Ga0105249_10012175 | Ga0105249_100121754 | 145 |
| 448 | 3300013297 | Ga0157378_10243400 | Ga0157378_102434002 | 145 |
| 449 | 3300013306 | Ga0163162_10179210 | Ga0163162_101792102 | 145 |
| 450 | 3300013308 | Ga0157375_10002605 | Ga0157375_100026056 | 145 |
| 451 | 3300013308 | Ga0157375_10377499 | Ga0157375_103774993 | 145 |
| 452 | 3300025900 | Ga0207710_10078992 | Ga0207710_100789922 | 145 |
| 453 | 3300025901 | Ga0207688_10100206 | Ga0207688_101002062 | 145 |
| 454 | 3300025907 | Ga0207645_10015012 | Ga0207645_100150123 | 145 |
| 455 | 3300025917 | Ga0207660_10540977 | Ga0207660_105409772 | 145 |
| 456 | 3300025918 | Ga0207662_10076280 | Ga0207662_100762802 | 145 |
| 457 | 3300025918 | Ga0207662_11139563 | Ga0207662_111395631 | 145 |
| 458 | 3300025919 | Ga0207657_10026590 | Ga0207657_100265903 | 145 |
| 459 | 3300025923 | Ga0207681_10605508 | Ga0207681_106055082 | 145 |
| 460 | 3300025931 | Ga0207644_10578671 | Ga0207644_105786711 | 145 |
| 461 | 3300025940 | Ga0207691_10060219 | Ga0207691_100602192 | 145 |
| 462 | 3300026067 | Ga0207678_10559844 | Ga0207678_105598441 | 145 |
| 463 | 3300026075 | Ga0207708_10035033 | Ga0207708_100350332 | 145 |
| 464 | 3300026075 | Ga0207708_11142270 | Ga0207708_111422702 | 145 |
| 465 | 3300026088 | Ga0207641_10199516 | Ga0207641_101995162 | 145 |
| 466 | 3300027907 | Ga0207428_10334440 | Ga0207428_103344401 | 145 |
| 467 | 3300027907 | Ga0207428_10347250 | Ga0207428_103472502 | 145 |
| 468 | 3300028380 | Ga0268265_10324891 | Ga0268265_103248912 | 145 |
| 469 | 3300041408 | Ga0439453_0009770 | Ga0439453_0009770_45_494 | 145 |
| 470 | 3300042436 | Ga0439435_0194826 | Ga0439435_0194826_132_581 | 145 |
| 471 | 3300042461 | Ga0439460_0099428 | Ga0439460_0099428_249_698 | 145 |
| 472 | 3300046458 | Ga0495591_112438 | Ga0495591_112438_159_602 | 145 |
| 473 | 3300046528 | Ga0495642_0014190 | Ga0495642_0014190_74_517 | 145 |
| 474 | 3300046538 | Ga0495609_0113018 | Ga0495609_0113018_29_472 | 145 |
| 475 | 3300046558 | Ga0495633_0358887 | Ga0495633_0358887_184_627 | 145 |
| 476 | 3300046664 | Ga0495659_0059166 | Ga0495659_0059166_72_515 | 145 |
| 477 | 3300046684 | Ga0495669_0158542 | Ga0495669_0158542_58_501 | 145 |
| 478 | 3300047318 | Ga0495636_0412710 | Ga0495636_0412710_35_478 | 145 |
| 479 | 3300047447 | Ga0495685_031904 | Ga0495685_031904_286_729 | 145 |
| 480 | 3300048917 | Ga0496114_1261067 | Ga0496114_1261067_23_466 | 145 |
| 481 | 3300049574 | Ga0501038_0484195 | Ga0501038_0484195_91_534 | 145 |
| 482 | 3300049576 | Ga0501040_0002994 | Ga0501040_0002994_7931_8374 | 145 |
| 483 | 3300049577 | Ga0501041_0008795 | Ga0501041_0008795_2373_2816 | 145 |
| 484 | 3300049578 | Ga0501042_0018474 | Ga0501042_0018474_2152_2595 | 145 |
| 485 | 3300049579 | Ga0501043_0323227 | Ga0501043_0323227_39_482 | 145 |
| 486 | 3300049743 | Ga0501081_0173120 | Ga0501081_0173120_112_555 | 145 |
| 487 | 3300049824 | Ga0501045_0253639 | Ga0501045_0253639_812_1255 | 145 |
| 488 | 3300050507 | nmdc:mga05p37_1286_c1 | nmdc:mga05p37_1286_c1_12815_13258 | 145 |
| 489 | 3300050508 | nmdc:mga09592_83643_c1 | nmdc:mga09592_83643_c1_1893_2336 | 145 |
| 490 | 3300050508 | nmdc:mga09592_8582_c1 | nmdc:mga09592_8582_c1_2458_2901 | 145 |
| 491 | 3300050510 | nmdc:mga06r32_76337_c1 | nmdc:mga06r32_76337_c1_2404_2847 | 145 |
| 492 | 3300050511 | nmdc:mga08y16_527007_c1 | nmdc:mga08y16_527007_c1_534_974 | 145 |
| 493 | 3300050512 | nmdc:mga0n895_1125415_c1 | nmdc:mga0n895_1125415_c1_20_463 | 145 |
| 494 | 3300050512 | nmdc:mga0n895_155_c1 | nmdc:mga0n895_155_c1_17499_17954 | 145 |
| 495 | 3300050512 | nmdc:mga0n895_22134_c1 | nmdc:mga0n895_22134_c1_1262_1705 | 145 |
| 496 | 3300050512 | nmdc:mga0n895_318284_c1 | nmdc:mga0n895_318284_c1_184_624 | 145 |
| 497 | 3300050512 | nmdc:mga0n895_461514_c1 | nmdc:mga0n895_461514_c1_77_520 | 145 |
| 498 | 3300050513 | nmdc:mga0rr50_130271_c1 | nmdc:mga0rr50_130271_c1_1222_1665 | 145 |
| 499 | 3300050513 | nmdc:mga0rr50_279927_c1 | nmdc:mga0rr50_279927_c1_109_549 | 145 |
| 500 | 3300050513 | nmdc:mga0rr50_8_c1 | nmdc:mga0rr50_8_c1_124648_125103 | 145 |
| 501 | 3300050514 | nmdc:mga08x19_725289_c1 | nmdc:mga08x19_725289_c1_201_641 | 145 |
| 502 | 3300050514 | nmdc:mga08x19_8441_c1 | nmdc:mga08x19_8441_c1_5081_5536 | 145 |
| 503 | 3300050515 | nmdc:mga0a205_186381_c1 | nmdc:mga0a205_186381_c1_712_1155 | 145 |
| 504 | 3300050515 | nmdc:mga0a205_345667_c1 | nmdc:mga0a205_345667_c1_862_1305 | 145 |
| 505 | 3300054114 | Ga0501084_0204622 | Ga0501084_0204622_484_927 | 145 |
| 506 | 3300061734 | Ga0530510_0302798 | Ga0530510_0302798_49_492 | 145 |
| 507 | 3300005295 | Ga0065707_10298169 | Ga0065707_102981691 | 146 |
| 508 | 3300005330 | Ga0070690_100098152 | Ga0070690_1000981522 | 146 |
| 509 | 3300005340 | Ga0070689_100176984 | Ga0070689_1001769842 | 146 |
| 510 | 3300005364 | Ga0070673_100151129 | Ga0070673_1001511292 | 146 |
| 511 | 3300005367 | Ga0070667_100006576 | Ga0070667_1000065763 | 146 |
| 512 | 3300005444 | Ga0070694_100720437 | Ga0070694_1007204371 | 146 |
| 513 | 3300005445 | Ga0070708_100581769 | Ga0070708_1005817692 | 146 |
| 514 | 3300005471 | Ga0070698_100000929 | Ga0070698_10000092914 | 146 |
| 515 | 3300005471 | Ga0070698_100354222 | Ga0070698_1003542222 | 146 |
| 516 | 3300005518 | Ga0070699_100002294 | Ga0070699_10000229415 | 146 |
| 517 | 3300005518 | Ga0070699_101163483 | Ga0070699_1011634831 | 146 |
| 518 | 3300005544 | Ga0070686_100678182 | Ga0070686_1006781822 | 146 |
| 519 | 3300005545 | Ga0070695_101123743 | Ga0070695_1011237431 | 146 |
| 520 | 3300005546 | Ga0070696_100207392 | Ga0070696_1002073922 | 146 |
| 521 | 3300005548 | Ga0070665_100171575 | Ga0070665_1001715752 | 146 |
| 522 | 3300005549 | Ga0070704_100025028 | Ga0070704_1000250282 | 146 |
| 523 | 3300005615 | Ga0070702_100030815 | Ga0070702_1000308152 | 146 |
| 524 | 3300005617 | Ga0068859_100196467 | Ga0068859_1001964674 | 146 |
| 525 | 3300005718 | Ga0068866_10378931 | Ga0068866_103789312 | 146 |
| 526 | 3300005841 | Ga0068863_100030531 | Ga0068863_1000305314 | 146 |
| 527 | 3300005842 | Ga0068858_100086239 | Ga0068858_1000862393 | 146 |
| 528 | 3300005843 | Ga0068860_100452577 | Ga0068860_1004525772 | 146 |
| 529 | 3300006058 | Ga0075432_10070913 | Ga0075432_100709132 | 146 |
| 530 | 3300006163 | Ga0070715_10657774 | Ga0070715_106577741 | 146 |
| 531 | 3300006173 | Ga0070716_100638241 | Ga0070716_1006382411 | 146 |
| 532 | 3300006844 | Ga0075428_100871365 | Ga0075428_1008713651 | 146 |
| 533 | 3300006871 | Ga0075434_100761387 | Ga0075434_1007613871 | 146 |
| 534 | 3300006914 | Ga0075436_100142621 | Ga0075436_1001426212 | 146 |
| 535 | 3300006931 | Ga0097620_100196467 | Ga0097620_1001964672 | 146 |
| 536 | 3300007076 | Ga0075435_100316552 | Ga0075435_1003165522 | 146 |
| 537 | 3300007076 | Ga0075435_100476530 | Ga0075435_1004765302 | 146 |
| 538 | 3300007076 | Ga0075435_100517469 | Ga0075435_1005174692 | 146 |
| 539 | 3300009094 | Ga0111539_10008678 | Ga0111539_100086787 | 146 |
| 540 | 3300009147 | Ga0114129_10207764 | Ga0114129_102077643 | 146 |
| 541 | 3300009148 | Ga0105243_10182668 | Ga0105243_101826681 | 146 |
| 542 | 3300009176 | Ga0105242_10246450 | Ga0105242_102464501 | 146 |
| 543 | 3300009176 | Ga0105242_10459796 | Ga0105242_104597962 | 146 |
| 544 | 3300010159 | Ga0099796_10082764 | Ga0099796_100827642 | 146 |
| 545 | 3300013297 | Ga0157378_11828923 | Ga0157378_118289231 | 146 |
| 546 | 3300025899 | Ga0207642_10372977 | Ga0207642_103729772 | 146 |
| 547 | 3300025905 | Ga0207685_10663284 | Ga0207685_106632841 | 146 |
| 548 | 3300025912 | Ga0207707_10158528 | Ga0207707_101585282 | 146 |
| 549 | 3300025921 | Ga0207652_10044836 | Ga0207652_100448362 | 146 |
| 550 | 3300025931 | Ga0207644_10215835 | Ga0207644_102158352 | 146 |
| 551 | 3300025935 | Ga0207709_10433268 | Ga0207709_104332682 | 146 |
| 552 | 3300025936 | Ga0207670_10037370 | Ga0207670_100373703 | 146 |
| 553 | 3300025939 | Ga0207665_10451880 | Ga0207665_104518801 | 146 |
| 554 | 3300025940 | Ga0207691_10003774 | Ga0207691_1000377410 | 146 |
| 555 | 3300025941 | Ga0207711_10033096 | Ga0207711_100330962 | 146 |
| 556 | 3300025945 | Ga0207679_10790464 | Ga0207679_107904642 | 146 |
| 557 | 3300025960 | Ga0207651_10223638 | Ga0207651_102236382 | 146 |
| 558 | 3300025986 | Ga0207658_10117457 | Ga0207658_101174572 | 146 |
| 559 | 3300026023 | Ga0207677_10295702 | Ga0207677_102957022 | 146 |
| 560 | 3300026035 | Ga0207703_10735447 | Ga0207703_107354472 | 146 |
| 561 | 3300026088 | Ga0207641_10003478 | Ga0207641_100034784 | 146 |
| 562 | 3300026116 | Ga0207674_10777553 | Ga0207674_107775532 | 146 |
| 563 | 3300027907 | Ga0207428_10015331 | Ga0207428_100153314 | 146 |
| 564 | 3300028379 | Ga0268266_10347288 | Ga0268266_103472882 | 146 |
| 565 | 3300028380 | Ga0268265_10966190 | Ga0268265_109661901 | 146 |
| 566 | 3300028381 | Ga0268264_10078655 | Ga0268264_100786553 | 146 |
| 567 | 3300035088 | Ga0373940_0045565 | Ga0373940_0045565_482_949 | 146 |
| 568 | 3300035092 | Ga0373952_0056544 | Ga0373952_0056544_327_794 | 146 |
| 569 | 3300035118 | Ga0373954_0257278 | Ga0373954_0257278_267_719 | 146 |
| 570 | 3300035170 | Ga0373943_0327640 | Ga0373943_0327640_267_719 | 146 |
| 571 | 3300035242 | Ga0373962_0011729 | Ga0373962_0011729_1001_1468 | 146 |
| 572 | 3300035692 | Ga0373935_0150129 | Ga0373935_0150129_24_476 | 146 |
| 573 | 3300046454 | Ga0495592_0021194 | Ga0495592_0021194_4135_4587 | 146 |
| 574 | 3300046472 | Ga0495580_0312073 | Ga0495580_0312073_159_611 | 146 |
| 575 | 3300046477 | Ga0495664_0175508 | Ga0495664_0175508_44_496 | 146 |
| 576 | 3300046511 | Ga0495608_0034081 | Ga0495608_0034081_1672_2124 | 146 |
| 577 | 3300046514 | Ga0495618_0477455 | Ga0495618_0477455_252_704 | 146 |
| 578 | 3300046516 | Ga0495628_0030887 | Ga0495628_0030887_826_1278 | 146 |
| 579 | 3300046517 | Ga0495630_0041023 | Ga0495630_0041023_1296_1748 | 146 |
| 580 | 3300046531 | Ga0495665_0062789 | Ga0495665_0062789_40_486 | 146 |
| 581 | 3300046533 | Ga0495640_0126420 | Ga0495640_0126420_1137_1589 | 146 |
| 582 | 3300046536 | Ga0495587_0057380 | Ga0495587_0057380_215_667 | 146 |
| 583 | 3300046537 | Ga0495598_0140971 | Ga0495598_0140971_102_554 | 146 |
| 584 | 3300046559 | Ga0495667_0500268 | Ga0495667_0500268_204_656 | 146 |
| 585 | 3300046642 | Ga0495634_0079911 | Ga0495634_0079911_1207_1659 | 146 |
| 586 | 3300046663 | Ga0495635_0240978 | Ga0495635_0240978_212_664 | 146 |
| 587 | 3300046678 | Ga0495599_0065619 | Ga0495599_0065619_1052_1504 | 146 |
| 588 | 3300046681 | Ga0495647_0467937 | Ga0495647_0467937_54_506 | 146 |
| 589 | 3300046683 | Ga0495658_0077931 | Ga0495658_0077931_1192_1644 | 146 |
| 590 | 3300046689 | Ga0495613_0055291 | Ga0495613_0055291_129_581 | 146 |
| 591 | 3300047317 | Ga0495604_0092753 | Ga0495604_0092753_1234_1686 | 146 |
| 592 | 3300047319 | Ga0495674_0052885 | Ga0495674_0052885_2391_2843 | 146 |
| 593 | 3300047322 | Ga0495680_0100190 | Ga0495680_0100190_609_1061 | 146 |
| 594 | 3300047471 | Ga0495684_0000053 | Ga0495684_0000053_26815_27267 | 146 |
| 595 | 3300048904 | Ga0496101_0186390 | Ga0496101_0186390_282_749 | 146 |
| 596 | 3300050507 | nmdc:mga05p37_98504_c1 | nmdc:mga05p37_98504_c1_2136_2600 | 146 |
| 597 | 3300050511 | nmdc:mga08y16_20147_c1 | nmdc:mga08y16_20147_c1_1744_2196 | 146 |
| 598 | 3300050513 | nmdc:mga0rr50_147625_c1 | nmdc:mga0rr50_147625_c1_211_669 | 146 |
| 599 | 3300050513 | nmdc:mga0rr50_421087_c1 | nmdc:mga0rr50_421087_c1_125_577 | 146 |
| 600 | 3300050514 | nmdc:mga08x19_6227_c1 | nmdc:mga08x19_6227_c1_3649_4104 | 146 |
| 601 | 3300050515 | nmdc:mga0a205_397971_c1 | nmdc:mga0a205_397971_c1_629_1096 | 146 |
| 602 | 3300053077 | Ga0495601_0585699 | Ga0495601_0585699_162_614 | 146 |
| 603 | 3300053084 | Ga0495595_0037229 | Ga0495595_0037229_560_1012 | 146 |
| 604 | 3300053085 | Ga0495619_0000467 | Ga0495619_0000467_6421_6873 | 146 |
| 605 | 3300053085 | Ga0495619_0115407 | Ga0495619_0115407_572_1024 | 146 |
| 606 | 3300004799 | Ga0058863_11332999 | Ga0058863_113329992 | 147 |
| 607 | 3300005293 | Ga0065715_10014205 | Ga0065715_100142052 | 147 |
| 608 | 3300005338 | Ga0068868_100497558 | Ga0068868_1004975582 | 147 |
| 609 | 3300005353 | Ga0070669_100067210 | Ga0070669_1000672103 | 147 |
| 610 | 3300005353 | Ga0070669_100129337 | Ga0070669_1001293372 | 147 |
| 611 | 3300005354 | Ga0070675_100149811 | Ga0070675_1001498112 | 147 |
| 612 | 3300005356 | Ga0070674_100837878 | Ga0070674_1008378781 | 147 |
| 613 | 3300005436 | Ga0070713_102043692 | Ga0070713_1020436921 | 147 |
| 614 | 3300005438 | Ga0070701_10248486 | Ga0070701_102484862 | 147 |
| 615 | 3300005438 | Ga0070701_10706231 | Ga0070701_107062311 | 147 |
| 616 | 3300005444 | Ga0070694_100932405 | Ga0070694_1009324051 | 147 |
| 617 | 3300005457 | Ga0070662_100090590 | Ga0070662_1000905902 | 147 |
| 618 | 3300005457 | Ga0070662_100261771 | Ga0070662_1002617712 | 147 |
| 619 | 3300005458 | Ga0070681_10020213 | Ga0070681_100202138 | 147 |
| 620 | 3300005459 | Ga0068867_101680530 | Ga0068867_1016805301 | 147 |
| 621 | 3300005468 | Ga0070707_100083186 | Ga0070707_1000831862 | 147 |
| 622 | 3300005468 | Ga0070707_100322630 | Ga0070707_1003226302 | 147 |
| 623 | 3300005530 | Ga0070679_100031839 | Ga0070679_1000318394 | 147 |
| 624 | 3300005536 | Ga0070697_100077672 | Ga0070697_1000776723 | 147 |
| 625 | 3300005536 | Ga0070697_100608516 | Ga0070697_1006085162 | 147 |
| 626 | 3300005563 | Ga0068855_101133831 | Ga0068855_1011338311 | 147 |
| 627 | 3300005577 | Ga0068857_101259772 | Ga0068857_1012597721 | 147 |
| 628 | 3300005719 | Ga0068861_100031278 | Ga0068861_1000312784 | 147 |
| 629 | 3300005719 | Ga0068861_100096934 | Ga0068861_1000969342 | 147 |
| 630 | 3300005842 | Ga0068858_100037321 | Ga0068858_1000373214 | 147 |
| 631 | 3300005843 | Ga0068860_100151514 | Ga0068860_1001515142 | 147 |
| 632 | 3300005844 | Ga0068862_100078254 | Ga0068862_1000782542 | 147 |
| 633 | 3300006844 | Ga0075428_101042020 | Ga0075428_1010420201 | 147 |
| 634 | 3300006846 | Ga0075430_100479450 | Ga0075430_1004794502 | 147 |
| 635 | 3300006847 | Ga0075431_100364473 | Ga0075431_1003644732 | 147 |
| 636 | 3300006871 | Ga0075434_100043057 | Ga0075434_1000430572 | 147 |
| 637 | 3300006871 | Ga0075434_101207774 | Ga0075434_1012077741 | 147 |
| 638 | 3300006880 | Ga0075429_101556021 | Ga0075429_1015560211 | 147 |
| 639 | 3300006931 | Ga0097620_100025646 | Ga0097620_1000256467 | 147 |
| 640 | 3300007076 | Ga0075435_100052058 | Ga0075435_1000520583 | 147 |
| 641 | 3300009098 | Ga0105245_10216535 | Ga0105245_102165352 | 147 |
| 642 | 3300009101 | Ga0105247_10048684 | Ga0105247_100486842 | 147 |
| 643 | 3300009148 | Ga0105243_10545627 | Ga0105243_105456271 | 147 |
| 644 | 3300009174 | Ga0105241_10799240 | Ga0105241_107992402 | 147 |
| 645 | 3300009177 | Ga0105248_11285264 | Ga0105248_112852642 | 147 |
| 646 | 3300009177 | Ga0105248_12072581 | Ga0105248_120725811 | 147 |
| 647 | 3300009553 | Ga0105249_10345122 | Ga0105249_103451222 | 147 |
| 648 | 3300013307 | Ga0157372_11734364 | Ga0157372_117343642 | 147 |
| 649 | 3300014968 | Ga0157379_10012294 | Ga0157379_100122947 | 147 |
| 650 | 3300025900 | Ga0207710_10223050 | Ga0207710_102230502 | 147 |
| 651 | 3300025922 | Ga0207646_10761597 | Ga0207646_107615971 | 147 |
| 652 | 3300025923 | Ga0207681_10020770 | Ga0207681_100207704 | 147 |
| 653 | 3300025923 | Ga0207681_10221754 | Ga0207681_102217542 | 147 |
| 654 | 3300025926 | Ga0207659_10177169 | Ga0207659_101771692 | 147 |
| 655 | 3300025929 | Ga0207664_10271190 | Ga0207664_102711902 | 147 |
| 656 | 3300025933 | Ga0207706_10088280 | Ga0207706_100882803 | 147 |
| 657 | 3300025933 | Ga0207706_10140474 | Ga0207706_101404743 | 147 |
| 658 | 3300025937 | Ga0207669_10504017 | Ga0207669_105040172 | 147 |
| 659 | 3300025941 | Ga0207711_11277702 | Ga0207711_112777021 | 147 |
| 660 | 3300025972 | Ga0207668_10049380 | Ga0207668_100493801 | 147 |
| 661 | 3300026023 | Ga0207677_10468657 | Ga0207677_104686572 | 147 |
| 662 | 3300026035 | Ga0207703_10184501 | Ga0207703_101845012 | 147 |
| 663 | 3300026075 | Ga0207708_10091229 | Ga0207708_100912292 | 147 |
| 664 | 3300026089 | Ga0207648_10057452 | Ga0207648_100574523 | 147 |
| 665 | 3300026089 | Ga0207648_10881518 | Ga0207648_108815182 | 147 |
| 666 | 3300026116 | Ga0207674_10062222 | Ga0207674_100622221 | 147 |
| 667 | 3300026118 | Ga0207675_100048433 | Ga0207675_1000484332 | 147 |
| 668 | 3300026118 | Ga0207675_100061265 | Ga0207675_1000612653 | 147 |
| 669 | 3300028380 | Ga0268265_10019315 | Ga0268265_100193154 | 147 |
| 670 | 3300028380 | Ga0268265_10043652 | Ga0268265_100436522 | 147 |
| 671 | 3300028380 | Ga0268265_10411584 | Ga0268265_104115842 | 147 |
| 672 | 3300028380 | Ga0268265_11214484 | Ga0268265_112144841 | 147 |
| 673 | 3300028381 | Ga0268264_10103080 | Ga0268264_101030802 | 147 |
| 674 | 3300028381 | Ga0268264_10205267 | Ga0268264_102052671 | 147 |
| 675 | 3300036401 | Ga0373937_0649532 | Ga0373937_0649532_502_948 | 147 |
| 676 | 3300046462 | Ga0495651_0187952 | Ga0495651_0187952_169_615 | 147 |
| 677 | 3300046615 | Ga0495656_0636511 | Ga0495656_0636511_60_524 | 147 |
| 678 | 3300046642 | Ga0495634_0151009 | Ga0495634_0151009_106_564 | 147 |
| 679 | 3300048907 | Ga0496104_0501925 | Ga0496104_0501925_369_812 | 147 |
| 680 | 3300048907 | Ga0496104_0936194 | Ga0496104_0936194_226_684 | 147 |
| 681 | 3300048908 | Ga0496105_0853802 | Ga0496105_0853802_198_641 | 147 |
| 682 | 3300048912 | Ga0496109_0991075 | Ga0496109_0991075_35_478 | 147 |
| 683 | 3300048915 | Ga0496112_0356814 | Ga0496112_0356814_65_508 | 147 |
| 684 | 3300050508 | nmdc:mga09592_1391206_c1 | nmdc:mga09592_1391206_c1_85_540 | 147 |
| 685 | 3300050510 | nmdc:mga06r32_299855_c1 | nmdc:mga06r32_299855_c1_825_1280 | 147 |
| 686 | 3300050512 | nmdc:mga0n895_278071_c1 | nmdc:mga0n895_278071_c1_144_602 | 147 |
| 687 | 3300050512 | nmdc:mga0n895_569327_c1 | nmdc:mga0n895_569327_c1_654_1127 | 147 |
| 688 | 3300050513 | nmdc:mga0rr50_110142_c1 | nmdc:mga0rr50_110142_c1_297_770 | 147 |
| 689 | 3300050515 | nmdc:mga0a205_534994_c1 | nmdc:mga0a205_534994_c1_12_485 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bu7-assembly1.cif.gz_B | crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi | 0.9197 | 57 | 132 |
| 3fjs-assembly2.cif.gz_D | crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution | 0.9179 | 57 | 135 |
| 5zbe-assembly1.cif.gz_A | crystal structure of aere from microcystis aeruginosa | 0.9049 | 57 | 136 |
| 1o4t-assembly1.cif.gz_B | crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution | 0.8938 | 59 | 132 |
| 3c3v-assembly1.cif.gz_A | crystal structure of peanut major allergen ara h 3 | 0.8904 | 57 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bu7B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9197 | 57 | 132 | 2.60.120.10 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9012 | 57 | 135 | 2.60.120.10 |
| 1o4tB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8938 | 59 | 132 | 2.60.120.10 |
| af_A1YQH2_38_212_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8856 | 57 | 132 | 2.60.120.10 |
| 5cu1A00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8847 | 57 | 144 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2XCV7-F1-model_v4 | Cupin domain-containing protein | 0.9552 | 54 | 147 |
|
| AF-A0A255R774-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9537 | 55 | 147 |
|
| AF-L8MH88-F1-model_v4 | deleted | 0.9533 | 57 | 147 |
|
| AF-A0A0N9XF37-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9498 | 54 | 147 |
|
| AF-K2SC26-F1-model_v4 | Cupin RmlC-type | 0.9487 | 53 | 137 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar