F475388

General Info

Members Datasets Scaffolds Average Seq Length
689 274 689 147

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10735447|Ga0207703_107354472
Length 175
Sequence MHRHPRCFATVWQTTGFTIEVGRLIIRAMLSRRDAVASFALFADLVASGRHLDALAQTTPAAPGTPPPPISRHDLPRVTMDDWEVTVSYVDYPPGRVGAAHHHAGFVLAYVLEGAVVTKISGQGEEKTYTVGQMFYEQPGATHEVSKNASQTQPARLLAMIFAKKGSTLTMPGPA

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 2.03
Rhizosphere 97.68
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11332999 3300004799 Bacteria 713
2 Ga0065704_10304040 3300005289 Unclassified 880
3 Ga0065712_10267094 3300005290 Unclassified 924
4 Ga0065715_10014205 3300005293 Bacteria 2165
5 Ga0065715_10105377 3300005293 Bacteria 2876
6 Ga0065715_10382837 3300005293 Bacteria 893
7 Ga0065715_11013547 3300005293 Bacteria 542
8 Ga0065715_11157041 3300005293 Unclassified 507
9 Ga0065707_10017938 3300005295 Bacteria 3349
10 Ga0065707_10298169 3300005295 Unclassified 1009
11 Ga0070676_10019922 3300005328 Unclassified 3738
12 Ga0070690_100044608 3300005330 Bacteria 2815
13 Ga0070690_100077917 3300005330 Bacteria 2165
14 Ga0070690_100098152 3300005330 Bacteria 1939
15 Ga0070690_100887440 3300005330 Unclassified 697
16 Ga0070670_100056545 3300005331 Bacteria 3367
17 Ga0070670_100192322 3300005331 Bacteria 1773
18 Ga0068869_100184698 3300005334 Unclassified 1636
19 Ga0068869_101051464 3300005334 Unclassified 711
20 Ga0070666_10005197 3300005335 Bacteria 7974
21 Ga0070666_10236424 3300005335 Unclassified 1291
22 Ga0068868_100447393 3300005338 Unclassified 1123
23 Ga0068868_100497558 3300005338 Bacteria 1067
24 Ga0068868_101236384 3300005338 Unclassified 692
25 Ga0070660_100116064 3300005339 Bacteria 2134
26 Ga0070660_100409308 3300005339 Bacteria 1122
27 Ga0070660_100776742 3300005339 Unclassified 805
28 Ga0070689_100004437 3300005340 Bacteria 9479
29 Ga0070689_100007594 3300005340 Bacteria 7596
30 Ga0070689_100064840 3300005340 Bacteria 2844
31 Ga0070689_100157305 3300005340 Bacteria 1835
32 Ga0070689_100176984 3300005340 Bacteria 1731
33 Ga0070689_100527183 3300005340 Bacteria 1015
34 Ga0070691_10197266 3300005341 Unclassified 1056
35 Ga0070691_10365503 3300005341 Unclassified 805
36 Ga0070687_100018069 3300005343 Bacteria 3254
37 Ga0070687_100339225 3300005343 Bacteria 966
38 Ga0070692_10069121 3300005345 Bacteria 1878
39 Ga0070692_10548435 3300005345 Bacteria 757
40 Ga0070692_10844625 3300005345 Unclassified 629
41 Ga0070692_11090658 3300005345 Unclassified 563
42 Ga0070668_100051959 3300005347 Bacteria 3159
43 Ga0070668_100537392 3300005347 Bacteria 1016
44 Ga0070668_100746430 3300005347 Bacteria 866
45 Ga0070669_100003956 3300005353 Bacteria 10716
46 Ga0070669_100013215 3300005353 Bacteria 5870
47 Ga0070669_100067210 3300005353 Unclassified 2644
48 Ga0070669_100129337 3300005353 Bacteria 1935
49 Ga0070669_100236595 3300005353 Unclassified 1449
50 Ga0070675_100000420 3300005354 Bacteria 28958
51 Ga0070675_100015160 3300005354 Bacteria 6087
52 Ga0070675_100149811 3300005354 Unclassified 2000
53 Ga0070675_100681561 3300005354 Bacteria 935
54 Ga0070675_100903125 3300005354 Unclassified 810
55 Ga0070671_100052813 3300005355 Bacteria 3379
56 Ga0070671_101453163 3300005355 Bacteria 606
57 Ga0070674_100034274 3300005356 Unclassified 3389
58 Ga0070674_100837878 3300005356 Bacteria 797
59 Ga0070673_100063095 3300005364 Bacteria 2947
60 Ga0070673_100151129 3300005364 Unclassified 1966
61 Ga0070688_100021695 3300005365 Bacteria 3754
62 Ga0070688_100025850 3300005365 Bacteria 3481
63 Ga0070688_100480872 3300005365 Bacteria 934
64 Ga0070659_100104759 3300005366 Bacteria 2279
65 Ga0070659_100914461 3300005366 Bacteria 767
66 Ga0070667_100006576 3300005367 Bacteria 9665
67 Ga0070667_101562284 3300005367 Bacteria 620
68 Ga0070703_10102669 3300005406 Unclassified 1010
69 Ga0070709_10097681 3300005434 Bacteria 1950
70 Ga0070713_100016406 3300005436 Bacteria 5569
71 Ga0070713_100851994 3300005436 Unclassified 875
72 Ga0070713_102043692 3300005436 Unclassified 556
73 Ga0070701_10006396 3300005438 Bacteria 4955
74 Ga0070701_10116861 3300005438 Unclassified 1497
75 Ga0070701_10248486 3300005438 Bacteria 1073
76 Ga0070701_10706231 3300005438 Bacteria 679
77 Ga0070711_100323950 3300005439 Bacteria 1232
78 Ga0070705_100000037 3300005440 Bacteria 66783
79 Ga0070705_100013278 3300005440 Bacteria 4209
80 Ga0070705_100035978 3300005440 Bacteria 2780
81 Ga0070705_100141952 3300005440 Bacteria 1582
82 Ga0070700_100021963 3300005441 Bacteria 3715
83 Ga0070700_100073743 3300005441 Bacteria 2185
84 Ga0070700_100161970 3300005441 Bacteria 1541
85 Ga0070700_100320739 3300005441 Bacteria 1138
86 Ga0070694_100001204 3300005444 Bacteria 14924
87 Ga0070694_100001228 3300005444 Bacteria 14815
88 Ga0070694_100010891 3300005444 Bacteria 5627
89 Ga0070694_100020555 3300005444 Bacteria 4211
90 Ga0070694_100188676 3300005444 Bacteria 1529
91 Ga0070694_100720437 3300005444 Bacteria 813
92 Ga0070694_100932405 3300005444 Bacteria 718
93 Ga0070708_100036000 3300005445 Unclassified 4316
94 Ga0070708_100581769 3300005445 Bacteria 1056
95 Ga0070708_101184080 3300005445 Bacteria 715
96 Ga0070678_100290418 3300005456 Bacteria 1386
97 Ga0070662_100024350 3300005457 Bacteria 4170
98 Ga0070662_100090590 3300005457 Bacteria 2296
99 Ga0070662_100121692 3300005457 Bacteria 2001
100 Ga0070662_100261771 3300005457 Unclassified 1394
101 Ga0070662_100912737 3300005457 Unclassified 750
102 Ga0070681_10020213 3300005458 Bacteria 6675
103 Ga0068867_100011482 3300005459 Bacteria 6252
104 Ga0068867_100048878 3300005459 Bacteria 3113
105 Ga0068867_101157175 3300005459 Bacteria 709
106 Ga0068867_101680530 3300005459 Bacteria 595
107 Ga0070706_100418119 3300005467 Bacteria 1248
108 Ga0070707_100083186 3300005468 Archaea 3092
109 Ga0070707_100132105 3300005468 Unclassified 2428
110 Ga0070707_100322630 3300005468 Unclassified 1501
111 Ga0070707_100836009 3300005468 Bacteria 885
112 Ga0070698_100000929 3300005471 Bacteria 32009
113 Ga0070698_100052702 3300005471 Bacteria 4137
114 Ga0070698_100354222 3300005471 Bacteria 1399
115 Ga0070698_101219248 3300005471 Unclassified 702
116 Ga0070699_100002294 3300005518 Bacteria 17216
117 Ga0070699_100019455 3300005518 Bacteria 5846
118 Ga0070699_100077668 3300005518 Unclassified 2891
119 Ga0070699_100088560 3300005518 Bacteria 2704
120 Ga0070699_101163483 3300005518 Bacteria 707
121 Ga0070679_100031839 3300005530 Bacteria 5214
122 Ga0070684_100581855 3300005535 Bacteria 1040
123 Ga0070697_100077672 3300005536 Archaea 2731
124 Ga0070697_100608516 3300005536 Unclassified 961
125 Ga0070697_101257660 3300005536 Bacteria 660
126 Ga0070672_100045709 3300005543 Unclassified 3389
127 Ga0070672_100060990 3300005543 Unclassified 2972
128 Ga0070672_100264523 3300005543 Bacteria 1451
129 Ga0070672_101258152 3300005543 Unclassified 660
130 Ga0070672_101484802 3300005543 Bacteria 607
131 Ga0070686_100678182 3300005544 Unclassified 820
132 Ga0070695_100000085 3300005545 Bacteria 39151
133 Ga0070695_100298064 3300005545 Bacteria 1191
134 Ga0070695_101123743 3300005545 Bacteria 644
135 Ga0070696_100000139 3300005546 Bacteria 39687
136 Ga0070696_100008917 3300005546 Bacteria 6712
137 Ga0070696_100207392 3300005546 Bacteria 1466
138 Ga0070696_100350568 3300005546 Bacteria 1143
139 Ga0070665_100007666 3300005548 Bacteria 10967
140 Ga0070665_100171575 3300005548 Bacteria 2170
141 Ga0070704_100000453 3300005549 Bacteria 19337
142 Ga0070704_100002706 3300005549 Bacteria 10021
143 Ga0070704_100025028 3300005549 Bacteria 3925
144 Ga0070704_100040294 3300005549 Bacteria 3214
145 Ga0070704_100042174 3300005549 Unclassified 3155
146 Ga0070704_100444049 3300005549 Bacteria 1116
147 Ga0070704_100533901 3300005549 Bacteria 1023
148 Ga0068855_100287927 3300005563 Bacteria 1822
149 Ga0068855_101133831 3300005563 Bacteria 816
150 Ga0070664_100422475 3300005564 Bacteria 1221
151 Ga0070664_101084422 3300005564 Unclassified 754
152 Ga0068857_100001266 3300005577 Bacteria 19807
153 Ga0068857_100181290 3300005577 Unclassified 1917
154 Ga0068857_101259772 3300005577 Bacteria 717
155 Ga0068854_100016621 3300005578 Bacteria 4909
156 Ga0068854_101153624 3300005578 Bacteria 692
157 Ga0070702_100030815 3300005615 Bacteria 2928
158 Ga0068852_100870742 3300005616 Unclassified 917
159 Ga0068859_100004813 3300005617 Bacteria 13744
160 Ga0068859_100005036 3300005617 Bacteria 13407
161 Ga0068859_100011030 3300005617 Bacteria 9092
162 Ga0068859_100013716 3300005617 Bacteria 8125
163 Ga0068859_100196467 3300005617 Unclassified 2102
164 Ga0068859_101539761 3300005617 Unclassified 734
165 Ga0068864_100097966 3300005618 Unclassified 2597
166 Ga0068864_100237196 3300005618 Unclassified 1689
167 Ga0068864_100479442 3300005618 Bacteria 1194
168 Ga0068866_10056148 3300005718 Unclassified 2025
169 Ga0068866_10159885 3300005718 Unclassified 1312
170 Ga0068866_10378931 3300005718 Unclassified 907
171 Ga0068866_11155705 3300005718 Unclassified 557
172 Ga0068861_100031278 3300005719 Unclassified 3909
173 Ga0068861_100096934 3300005719 Unclassified 2338
174 Ga0068861_100129069 3300005719 Bacteria 2050
175 Ga0068861_100243105 3300005719 Bacteria 1532
176 Ga0068861_100728803 3300005719 Bacteria 924
177 Ga0068870_10007388 3300005840 Bacteria 4894
178 Ga0068870_10009645 3300005840 Bacteria 4399
179 Ga0068863_100030531 3300005841 Bacteria 5145
180 Ga0068863_100657128 3300005841 Bacteria 1040
181 Ga0068858_100033758 3300005842 Bacteria 4745
182 Ga0068858_100037321 3300005842 Unclassified 4506
183 Ga0068858_100086239 3300005842 Bacteria 2921
184 Ga0068858_100097790 3300005842 Bacteria 2736
185 Ga0068858_100534659 3300005842 Bacteria 1134
186 Ga0068860_100008710 3300005843 Bacteria 10104
187 Ga0068860_100151514 3300005843 Unclassified 2233
188 Ga0068860_100452577 3300005843 Unclassified 1277
189 Ga0068860_100465341 3300005843 Bacteria 1259
190 Ga0068860_101878042 3300005843 Unclassified 621
191 Ga0068862_100006051 3300005844 Bacteria 10077
192 Ga0068862_100014260 3300005844 Bacteria 6591
193 Ga0068862_100078254 3300005844 Bacteria 2865
194 Ga0068862_100727062 3300005844 Bacteria 964
195 Ga0070717_10406113 3300006028 Unclassified 1224
196 Ga0070717_11372256 3300006028 Unclassified 642
197 Ga0075432_10070913 3300006058 Unclassified 1252
198 Ga0070715_10210119 3300006163 Unclassified 994
199 Ga0070715_10657774 3300006163 Unclassified 621
200 Ga0070716_100336903 3300006173 Unclassified 1063
201 Ga0070716_100638241 3300006173 Bacteria 806
202 Ga0070716_100754377 3300006173 Unclassified 749
203 Ga0070712_101009227 3300006175 Unclassified 720
204 Ga0097621_100036808 3300006237 Bacteria 3916
205 Ga0097621_101092074 3300006237 Bacteria 749
206 Ga0068871_100055583 3300006358 Unclassified 3214
207 Ga0068871_100148282 3300006358 Bacteria 1999
208 Ga0068871_100989659 3300006358 Unclassified 783
209 Ga0075428_100000056 3300006844 Bacteria 89990
210 Ga0075428_100002585 3300006844 Bacteria 19667
211 Ga0075428_100093273 3300006844 Bacteria 3282
212 Ga0075428_100236343 3300006844 Unclassified 1972
213 Ga0075428_100531833 3300006844 Unclassified 1257
214 Ga0075428_100740949 3300006844 Bacteria 1046
215 Ga0075428_100825542 3300006844 Unclassified 985
216 Ga0075428_100871365 3300006844 Unclassified 956
217 Ga0075428_101042020 3300006844 Bacteria 865
218 Ga0075428_101205477 3300006844 Unclassified 798
219 Ga0075430_100000072 3300006846 Bacteria 55365
220 Ga0075430_100242321 3300006846 Bacteria 1494
221 Ga0075430_100479450 3300006846 Bacteria 1026
222 Ga0075431_100013452 3300006847 Bacteria 8265
223 Ga0075431_100110346 3300006847 Bacteria 2839
224 Ga0075431_100364473 3300006847 Bacteria 1451
225 Ga0075431_101088522 3300006847 Unclassified 764
226 Ga0075433_10181092 3300006852 Bacteria 1875
227 Ga0075433_10186648 3300006852 Bacteria 1845
228 Ga0075433_10573214 3300006852 Unclassified 991
229 Ga0075434_100040479 3300006871 Bacteria 4614
230 Ga0075434_100043057 3300006871 Bacteria 4476
231 Ga0075434_100151091 3300006871 Unclassified 2343
232 Ga0075434_100155144 3300006871 Bacteria 2309
233 Ga0075434_100184004 3300006871 Bacteria 2110
234 Ga0075434_100217520 3300006871 Bacteria 1930
235 Ga0075434_100672911 3300006871 Bacteria 1053
236 Ga0075434_100761387 3300006871 Bacteria 985
237 Ga0075434_101207774 3300006871 Bacteria 768
238 Ga0075429_100019241 3300006880 Bacteria 5915
239 Ga0075429_100094158 3300006880 Bacteria 2613
240 Ga0075429_100670107 3300006880 Unclassified 909
241 Ga0075429_101039023 3300006880 Unclassified 716
242 Ga0075429_101556021 3300006880 Bacteria 575
243 Ga0068865_100250478 3300006881 Bacteria 1398
244 Ga0068865_100256718 3300006881 Unclassified 1382
245 Ga0075436_100017364 3300006914 Bacteria 4926
246 Ga0075436_100142621 3300006914 Bacteria 1684
247 Ga0097620_100004814 3300006931 Bacteria 13744
248 Ga0097620_100005036 3300006931 Bacteria 13407
249 Ga0097620_100011030 3300006931 Bacteria 9092
250 Ga0097620_100013716 3300006931 Bacteria 8125
251 Ga0097620_100025646 3300006931 Bacteria 5912
252 Ga0097620_100196467 3300006931 Unclassified 2102
253 Ga0097620_101539729 3300006931 Unclassified 734
254 Ga0075435_100000028 3300007076 Bacteria 82360
255 Ga0075435_100000962 3300007076 Bacteria 18187
256 Ga0075435_100031431 3300007076 Bacteria 4182
257 Ga0075435_100052058 3300007076 Bacteria 3299
258 Ga0075435_100292109 3300007076 Unclassified 1393
259 Ga0075435_100316552 3300007076 Bacteria 1335
260 Ga0075435_100476530 3300007076 Unclassified 1078
261 Ga0075435_100517469 3300007076 Unclassified 1032
262 Ga0111539_10000002 3300009094 Bacteria 983359
263 Ga0111539_10008678 3300009094 Bacteria 12900
264 Ga0111539_10020340 3300009094 Bacteria 8176
265 Ga0111539_10021656 3300009094 Bacteria 7907
266 Ga0111539_10043711 3300009094 Bacteria 5370
267 Ga0105245_10173726 3300009098 Bacteria 2053
268 Ga0105245_10216535 3300009098 Bacteria 1845
269 Ga0105245_10344157 3300009098 Bacteria 1475
270 Ga0105245_11026190 3300009098 Bacteria 870
271 Ga0105247_10009886 3300009101 Bacteria 5779
272 Ga0105247_10048684 3300009101 Bacteria 2604
273 Ga0114129_10001718 3300009147 Bacteria 29903
274 Ga0114129_10012031 3300009147 Bacteria 12307
275 Ga0114129_10022700 3300009147 Bacteria 8899
276 Ga0114129_10086253 3300009147 Bacteria 4354
277 Ga0114129_10207764 3300009147 Bacteria 2649
278 Ga0114129_10208473 3300009147 Bacteria 2643
279 Ga0114129_10284660 3300009147 Bacteria 2208
280 Ga0114129_10341257 3300009147 Unclassified 1987
281 Ga0114129_10601186 3300009147 Bacteria 1425
282 Ga0114129_10678885 3300009147 Unclassified 1326
283 Ga0114129_11329851 3300009147 Unclassified 889
284 Ga0114129_12322984 3300009147 Bacteria 643
285 Ga0105243_10145046 3300009148 Bacteria 2030
286 Ga0105243_10182668 3300009148 Bacteria 1825
287 Ga0105243_10545627 3300009148 Bacteria 1107
288 Ga0105243_11149257 3300009148 Unclassified 787
289 Ga0105243_11205774 3300009148 Unclassified 770
290 Ga0105241_10799240 3300009174 Bacteria 869
291 Ga0105242_10003405 3300009176 Bacteria 12367
292 Ga0105242_10142350 3300009176 Bacteria 2082
293 Ga0105242_10246450 3300009176 Bacteria 1608
294 Ga0105242_10263971 3300009176 Bacteria 1557
295 Ga0105242_10459796 3300009176 Bacteria 1202
296 Ga0105248_10036273 3300009177 Bacteria 5514
297 Ga0105248_10203524 3300009177 Bacteria 2231
298 Ga0105248_10252430 3300009177 Bacteria 1985
299 Ga0105248_10370785 3300009177 Unclassified 1612
300 Ga0105248_10466773 3300009177 Bacteria 1423
301 Ga0105248_10967486 3300009177 Bacteria 961
302 Ga0105248_11285264 3300009177 Bacteria 828
303 Ga0105248_12072581 3300009177 Unclassified 647
304 Ga0105249_10012175 3300009553 Bacteria 7575
305 Ga0105249_10345122 3300009553 Bacteria 1507
306 Ga0105249_12636839 3300009553 Unclassified 575
307 Ga0099796_10082764 3300010159 Bacteria 1180
308 Ga0105239_12002347 3300010375 Bacteria 672
309 Ga0105246_10505143 3300011119 Bacteria 1027
310 Ga0157378_10239618 3300013297 Bacteria 1732
311 Ga0157378_10243400 3300013297 Bacteria 1719
312 Ga0157378_11828923 3300013297 Unclassified 656
313 Ga0157378_12157689 3300013297 Bacteria 608
314 Ga0157378_12462910 3300013297 Unclassified 572
315 Ga0163162_10096350 3300013306 Bacteria 3047
316 Ga0163162_10179210 3300013306 Bacteria 2245
317 Ga0157372_10227110 3300013307 Bacteria 2164
318 Ga0157372_11734364 3300013307 Bacteria 718
319 Ga0157375_10002605 3300013308 Bacteria 15654
320 Ga0157375_10171475 3300013308 Bacteria 2317
321 Ga0157375_10359266 3300013308 Bacteria 1622
322 Ga0157375_10377499 3300013308 Bacteria 1584
323 Ga0163163_10037770 3300014325 Bacteria 4699
324 Ga0163163_10616231 3300014325 Bacteria 1149
325 Ga0157380_10037251 3300014326 Bacteria 3767
326 Ga0157380_10467495 3300014326 Unclassified 1216
327 Ga0157380_10958032 3300014326 Unclassified 886
328 Ga0157377_10058158 3300014745 Bacteria 2201
329 Ga0157379_10012294 3300014968 Bacteria 7477
330 Ga0157379_10412566 3300014968 Bacteria 1243
331 Ga0157379_11489864 3300014968 Bacteria 658
332 Ga0157376_10034851 3300014969 Bacteria 4067
333 Ga0157376_10141916 3300014969 Unclassified 2156
334 Ga0157376_10484951 3300014969 Bacteria 1212
335 Ga0182005_1148521 3300015265 Bacteria 681
336 Ga0207642_10372977 3300025899 Unclassified 847
337 Ga0207642_10739692 3300025899 Unclassified 622
338 Ga0207710_10078992 3300025900 Bacteria 1523
339 Ga0207710_10223050 3300025900 Bacteria 936
340 Ga0207688_10100206 3300025901 Bacteria 1672
341 Ga0207680_10003047 3300025903 Bacteria 7864
342 Ga0207680_10184829 3300025903 Unclassified 1412
343 Ga0207685_10663284 3300025905 Unclassified 565
344 Ga0207699_10056845 3300025906 Bacteria 2334
345 Ga0207699_10236969 3300025906 Bacteria 1252
346 Ga0207645_10015012 3300025907 Bacteria 5162
347 Ga0207643_10003059 3300025908 Bacteria 8994
348 Ga0207643_10003533 3300025908 Bacteria 8410
349 Ga0207654_10160375 3300025911 Unclassified 1452
350 Ga0207707_10158528 3300025912 Bacteria 1979
351 Ga0207693_10810326 3300025915 Unclassified 721
352 Ga0207660_10540977 3300025917 Unclassified 947
353 Ga0207662_10076280 3300025918 Bacteria 2037
354 Ga0207662_10160184 3300025918 Bacteria 1437
355 Ga0207662_11139563 3300025918 Unclassified 554
356 Ga0207657_10026590 3300025919 Bacteria 5313
357 Ga0207652_10044836 3300025921 Bacteria 3769
358 Ga0207646_10232911 3300025922 Bacteria 1664
359 Ga0207646_10761597 3300025922 Unclassified 864
360 Ga0207681_10001613 3300025923 Bacteria 14545
361 Ga0207681_10006385 3300025923 Bacteria 7238
362 Ga0207681_10020770 3300025923 Unclassified 4166
363 Ga0207681_10221754 3300025923 Unclassified 1463
364 Ga0207681_10562880 3300025923 Bacteria 939
365 Ga0207681_10605508 3300025923 Unclassified 906
366 Ga0207650_10105381 3300025925 Unclassified 2177
367 Ga0207650_10306765 3300025925 Bacteria 1297
368 Ga0207650_10865767 3300025925 Bacteria 767
369 Ga0207659_10177169 3300025926 Unclassified 1686
370 Ga0207659_11710316 3300025926 Unclassified 536
371 Ga0207687_10071059 3300025927 Unclassified 2486
372 Ga0207687_10344747 3300025927 Bacteria 1212
373 Ga0207700_10012994 3300025928 Bacteria 5396
374 Ga0207664_10271190 3300025929 Bacteria 1486
375 Ga0207644_10215835 3300025931 Bacteria 1518
376 Ga0207644_10578671 3300025931 Bacteria 931
377 Ga0207706_10043015 3300025933 Bacteria 4003
378 Ga0207706_10088280 3300025933 Bacteria 2726
379 Ga0207706_10140474 3300025933 Unclassified 2125
380 Ga0207706_10277433 3300025933 Bacteria 1462
381 Ga0207686_10060080 3300025934 Unclassified 2404
382 Ga0207709_10117223 3300025935 Bacteria 1791
383 Ga0207709_10433268 3300025935 Bacteria 1012
384 Ga0207670_10008405 3300025936 Bacteria 5827
385 Ga0207670_10012794 3300025936 Unclassified 4923
386 Ga0207670_10037370 3300025936 Bacteria 3164
387 Ga0207669_10442722 3300025937 Bacteria 1028
388 Ga0207669_10504017 3300025937 Bacteria 969
389 Ga0207669_11080888 3300025937 Bacteria 677
390 Ga0207704_10038785 3300025938 Unclassified 2767
391 Ga0207704_10113790 3300025938 Unclassified 1835
392 Ga0207704_10921979 3300025938 Unclassified 735
393 Ga0207665_10101987 3300025939 Bacteria 2005
394 Ga0207665_10353429 3300025939 Unclassified 1110
395 Ga0207665_10451880 3300025939 Bacteria 986
396 Ga0207691_10003774 3300025940 Bacteria 14711
397 Ga0207691_10060219 3300025940 Unclassified 3450
398 Ga0207691_10189119 3300025940 Bacteria 1796
399 Ga0207691_10863845 3300025940 Unclassified 758
400 Ga0207711_10033096 3300025941 Bacteria 4372
401 Ga0207711_10152869 3300025941 Unclassified 2084
402 Ga0207711_10779599 3300025941 Bacteria 891
403 Ga0207711_11277702 3300025941 Bacteria 676
404 Ga0207689_10279317 3300025942 Unclassified 1383
405 Ga0207679_10081320 3300025945 Unclassified 2477
406 Ga0207679_10790464 3300025945 Unclassified 865
407 Ga0207667_10133590 3300025949 Unclassified 2556
408 Ga0207651_10023303 3300025960 Bacteria 3805
409 Ga0207651_10223638 3300025960 Bacteria 1523
410 Ga0207712_10007323 3300025961 Bacteria 6966
411 Ga0207668_10014395 3300025972 Bacteria 4895
412 Ga0207668_10049380 3300025972 Bacteria 2892
413 Ga0207668_10080879 3300025972 Unclassified 2355
414 Ga0207668_10632155 3300025972 Bacteria 935
415 Ga0207640_10092137 3300025981 Bacteria 2101
416 Ga0207640_10418534 3300025981 Unclassified 1096
417 Ga0207658_10117457 3300025986 Bacteria 2114
418 Ga0207677_10295702 3300026023 Bacteria 1336
419 Ga0207677_10297655 3300026023 Bacteria 1332
420 Ga0207677_10468657 3300026023 Bacteria 1083
421 Ga0207703_10184501 3300026035 Bacteria 1843
422 Ga0207703_10190728 3300026035 Bacteria 1815
423 Ga0207703_10244652 3300026035 Bacteria 1614
424 Ga0207703_10465325 3300026035 Unclassified 1183
425 Ga0207703_10735447 3300026035 Bacteria 939
426 Ga0207703_11056503 3300026035 Bacteria 780
427 Ga0207678_10559844 3300026067 Bacteria 1000
428 Ga0207678_11499239 3300026067 Bacteria 595
429 Ga0207708_10035033 3300026075 Bacteria 3820
430 Ga0207708_10091229 3300026075 Unclassified 2349
431 Ga0207708_10105502 3300026075 Unclassified 2184
432 Ga0207708_11050039 3300026075 Bacteria 709
433 Ga0207708_11142270 3300026075 Bacteria 680
434 Ga0207641_10003478 3300026088 Bacteria 13952
435 Ga0207641_10199516 3300026088 Bacteria 1844
436 Ga0207648_10001866 3300026089 Bacteria 23037
437 Ga0207648_10025117 3300026089 Bacteria 5312
438 Ga0207648_10057452 3300026089 Unclassified 3395
439 Ga0207648_10817522 3300026089 Bacteria 868
440 Ga0207648_10881518 3300026089 Bacteria 835
441 Ga0207676_10078620 3300026095 Unclassified 2672
442 Ga0207674_10019158 3300026116 Bacteria 7420
443 Ga0207674_10062222 3300026116 Bacteria 3770
444 Ga0207674_10084419 3300026116 Bacteria 3174
445 Ga0207674_10193538 3300026116 Bacteria 1983
446 Ga0207674_10777553 3300026116 Bacteria 924
447 Ga0207675_100015632 3300026118 Bacteria 7078
448 Ga0207675_100048433 3300026118 Unclassified 3967
449 Ga0207675_100061265 3300026118 Unclassified 3513
450 Ga0207675_100084976 3300026118 Bacteria 2970
451 Ga0207675_100167340 3300026118 Bacteria 2100
452 Ga0207675_100169087 3300026118 Bacteria 2089
453 Ga0207675_100181116 3300026118 Bacteria 2018
454 Ga0207675_100275563 3300026118 Unclassified 1633
455 Ga0207683_10707836 3300026121 Bacteria 934
456 Ga0207698_10744277 3300026142 Unclassified 979
457 Ga0207428_10000004 3300027907 Bacteria 727800
458 Ga0207428_10003716 3300027907 Bacteria 14661
459 Ga0207428_10015331 3300027907 Bacteria 6632
460 Ga0207428_10084357 3300027907 Bacteria 2476
461 Ga0207428_10334440 3300027907 Unclassified 1116
462 Ga0207428_10347250 3300027907 Bacteria 1092
463 Ga0207428_11010378 3300027907 Bacteria 584
464 Ga0268266_10007524 3300028379 Bacteria 9815
465 Ga0268266_10347288 3300028379 Bacteria 1394
466 Ga0268265_10000421 3300028380 Bacteria 45504
467 Ga0268265_10019315 3300028380 Bacteria 4734
468 Ga0268265_10043652 3300028380 Unclassified 3334
469 Ga0268265_10129348 3300028380 Bacteria 2095
470 Ga0268265_10324891 3300028380 Bacteria 1395
471 Ga0268265_10411584 3300028380 Bacteria 1253
472 Ga0268265_10966190 3300028380 Bacteria 840
473 Ga0268265_11214484 3300028380 Bacteria 752
474 Ga0268264_10078655 3300028381 Bacteria 2812
475 Ga0268264_10103080 3300028381 Unclassified 2484
476 Ga0268264_10205267 3300028381 Bacteria 1805
477 Ga0268264_10421067 3300028381 Bacteria 1288
478 Ga0268264_10775127 3300028381 Bacteria 957
479 Ga0268264_11278527 3300028381 Unclassified 744
480 Ga0307406_10296600 3300031901 Bacteria 1240
481 Ga0373930_0004773 3300034816 Bacteria 2223
482 Ga0373950_0032529 3300034818 Bacteria 971
483 Ga0373959_0000414 3300034820 Bacteria 8214
484 Ga0373959_0075424 3300034820 Bacteria 769
485 Ga0373928_0001753 3300035084 Bacteria 4223
486 Ga0373929_0000819 3300035085 Bacteria 6060
487 Ga0373940_0000568 3300035088 Bacteria 5844
488 Ga0373940_0045565 3300035088 Bacteria 1218
489 Ga0373949_0001899 3300035090 Bacteria 5653
490 Ga0373951_0001057 3300035091 Bacteria 7396
491 Ga0373952_0001303 3300035092 Bacteria 4561
492 Ga0373952_0056544 3300035092 Unclassified 949
493 Ga0373923_0025960 3300035111 Bacteria 2327
494 Ga0373923_0030845 3300035111 Bacteria 2158
495 Ga0373932_0001327 3300035112 Bacteria 6946
496 Ga0373939_0002741 3300035114 Bacteria 4133
497 Ga0373941_0001420 3300035115 Bacteria 5054
498 Ga0373945_0074619 3300035116 Unclassified 1290
499 Ga0373953_0034209 3300035117 Bacteria 1991
500 Ga0373954_0105903 3300035118 Unclassified 1358
501 Ga0373954_0257278 3300035118 Unclassified 860
502 Ga0373954_0409771 3300035118 Unclassified 670
503 Ga0373956_0074960 3300035119 Bacteria 1547
504 Ga0373960_0000111 3300035121 Bacteria 13140
505 Ga0373960_0240367 3300035121 Bacteria 654
506 Ga0373943_0327640 3300035170 Unclassified 874
507 Ga0373946_0011756 3300035171 Bacteria 3273
508 Ga0373955_0038971 3300035172 Bacteria 2534
509 Ga0373955_0297689 3300035172 Bacteria 972
510 Ga0373942_0000209 3300035207 Bacteria 15209
511 Ga0373961_0002181 3300035241 Bacteria 5194
512 Ga0373962_0011729 3300035242 Bacteria 2200
513 Ga0373962_0069060 3300035242 Bacteria 1052
514 Ga0373924_0131436 3300035410 Bacteria 1089
515 Ga0373931_0002316 3300035691 Bacteria 8414
516 Ga0373935_0047950 3300035692 Bacteria 2703
517 Ga0373935_0060735 3300035692 Unclassified 2418
518 Ga0373935_0150129 3300035692 Bacteria 1581
519 Ga0373935_0366690 3300035692 Bacteria 1029
520 Ga0373935_0772090 3300035692 Unclassified 709
521 Ga0373927_0003122 3300035695 Bacteria 11979
522 Ga0373927_0161115 3300035695 Bacteria 1470
523 Ga0373927_0303384 3300035695 Bacteria 1051
524 Ga0373947_0203911 3300035725 Bacteria 1295
525 Ga0373947_0361599 3300035725 Bacteria 975
526 Ga0373947_0582128 3300035725 Unclassified 762
527 Ga0373937_0024576 3300036401 Bacteria 5436
528 Ga0373937_0024622 3300036401 Bacteria 5430
529 Ga0373937_0649532 3300036401 Bacteria 1000
530 Ga0373925_0007400 3300037068 Bacteria 8011
531 Ga0373925_1352407 3300037068 Bacteria 584
532 Ga0436364_1555357 3300037853 Unclassified 1410
533 Ga0439453_0009770 3300041408 Bacteria 1569
534 Ga0439435_0194826 3300042436 Bacteria 666
535 Ga0439460_0099428 3300042461 Bacteria 933
536 Ga0466963_0249627 3300044694 Bacteria 1245
537 Ga0453684_1753611 3300044712 Bacteria 633
538 Ga0451576_0040683 3300045051 Bacteria 4917
539 Ga0451576_0092252 3300045051 Bacteria 3150
540 Ga0451576_0113585 3300045051 Bacteria 2819
541 Ga0451576_0671639 3300045051 Bacteria 1089
542 Ga0466967_0336347 3300045976 Bacteria 1459
543 Ga0466967_1297180 3300045976 Unclassified 725
544 Ga0495592_0021194 3300046454 Bacteria 4942
545 Ga0495603_0362317 3300046455 Bacteria 832
546 Ga0495591_112438 3300046458 Bacteria 668
547 Ga0495651_0187952 3300046462 Bacteria 1456
548 Ga0495580_0008121 3300046472 Bacteria 8369
549 Ga0495580_0312073 3300046472 Unclassified 1070
550 Ga0495582_0573113 3300046473 Unclassified 653
551 Ga0495664_0175508 3300046477 Bacteria 1300
552 Ga0495594_0354566 3300046499 Bacteria 835
553 Ga0495594_0808988 3300046499 Bacteria 528
554 Ga0495608_0034081 3300046511 Bacteria 3438
555 Ga0495608_0300355 3300046511 Bacteria 994
556 Ga0495618_0477455 3300046514 Unclassified 754
557 Ga0495628_0030887 3300046516 Bacteria 4335
558 Ga0495630_0041023 3300046517 Bacteria 3457
559 Ga0495642_0014190 3300046528 Bacteria 3087
560 Ga0495665_0062789 3300046531 Bacteria 1961
561 Ga0495665_0454600 3300046531 Unclassified 647
562 Ga0495640_0126420 3300046533 Bacteria 1658
563 Ga0495640_0389277 3300046533 Unclassified 857
564 Ga0495587_0057380 3300046536 Bacteria 2289
565 Ga0495598_0140971 3300046537 Bacteria 834
566 Ga0495598_0174964 3300046537 Bacteria 763
567 Ga0495609_0113018 3300046538 Bacteria 1171
568 Ga0495621_0064202 3300046539 Unclassified 1339
569 Ga0495645_0332283 3300046543 Bacteria 984
570 Ga0495633_0358887 3300046558 Bacteria 660
571 Ga0495667_0394504 3300046559 Unclassified 872
572 Ga0495667_0500268 3300046559 Unclassified 761
573 Ga0495656_0636511 3300046615 Unclassified 572
574 Ga0495634_0079911 3300046642 Bacteria 2141
575 Ga0495634_0151009 3300046642 Unclassified 1469
576 Ga0495634_0410910 3300046642 Unclassified 803
577 Ga0495635_0240978 3300046663 Unclassified 1220
578 Ga0495635_0678360 3300046663 Unclassified 669
579 Ga0495659_0059166 3300046664 Bacteria 1411
580 Ga0495659_0389155 3300046664 Bacteria 600
581 Ga0495657_0389104 3300046675 Unclassified 822
582 Ga0495599_0065619 3300046678 Bacteria 2268
583 Ga0495646_0509723 3300046680 Unclassified 617
584 Ga0495647_0017778 3300046681 Bacteria 2521
585 Ga0495647_0467937 3300046681 Unclassified 585
586 Ga0495658_0077931 3300046683 Bacteria 1939
587 Ga0495658_0123757 3300046683 Bacteria 1567
588 Ga0495669_0158542 3300046684 Bacteria 1074
589 Ga0495613_0006776 3300046689 Bacteria 8551
590 Ga0495613_0055291 3300046689 Bacteria 2916
591 Ga0495613_0056038 3300046689 Bacteria 2895
592 Ga0495613_0224044 3300046689 Bacteria 1319
593 Ga0495613_0747537 3300046689 Unclassified 641
594 Ga0495581_0620688 3300047315 Unclassified 626
595 Ga0495604_0092753 3300047317 Unclassified 2236
596 Ga0495636_0412710 3300047318 Bacteria 644
597 Ga0495674_0052885 3300047319 Bacteria 3572
598 Ga0495674_0328178 3300047319 Bacteria 1245
599 Ga0495680_0100190 3300047322 Bacteria 2159
600 Ga0495685_031904 3300047447 Bacteria 1810
601 Ga0495684_0000053 3300047471 Bacteria 82157
602 Ga0495602_0158349 3300048088 Bacteria 1771
603 Ga0496100_0025659 3300048903 Bacteria 3606
604 Ga0496101_0002033 3300048904 Bacteria 12304
605 Ga0496101_0186390 3300048904 Unclassified 1600
606 Ga0496102_0468433 3300048905 Unclassified 1181
607 Ga0496104_0501925 3300048907 Bacteria 1124
608 Ga0496104_0936194 3300048907 Bacteria 771
609 Ga0496105_0853802 3300048908 Bacteria 689
610 Ga0496106_0218693 3300048909 Bacteria 1519
611 Ga0496109_0991075 3300048912 Bacteria 778
612 Ga0496112_0356814 3300048915 Bacteria 1404
613 Ga0496112_1347521 3300048915 Bacteria 629
614 Ga0496114_0000224 3300048917 Bacteria 41100
615 Ga0496114_0439598 3300048917 Unclassified 1155
616 Ga0496114_1261067 3300048917 Unclassified 626
617 Ga0501038_0484195 3300049574 Bacteria 948
618 Ga0501040_0002994 3300049576 Bacteria 10939
619 Ga0501041_0008795 3300049577 Bacteria 5943
620 Ga0501042_0018474 3300049578 Bacteria 4827
621 Ga0501043_0323227 3300049579 Bacteria 1176
622 Ga0501067_0072969 3300049583 Bacteria 1902
623 Ga0501067_0372914 3300049583 Bacteria 796
624 Ga0501077_0291136 3300049593 Bacteria 1040
625 Ga0501081_0173120 3300049743 Bacteria 1559
626 Ga0501045_0253639 3300049824 Bacteria 1309
627 nmdc:mga05p37_1286_c1 3300050507 Bacteria 29122
628 nmdc:mga05p37_1366299_c1 3300050507 Unclassified 716
629 nmdc:mga05p37_1682365_c1 3300050507 Bacteria 620
630 nmdc:mga05p37_2604_c2 3300050507 Bacteria 9380
631 nmdc:mga05p37_33262_c2 3300050507 Unclassified 3829
632 nmdc:mga05p37_51966_c1 3300050507 Bacteria 5039
633 nmdc:mga05p37_98504_c1 3300050507 Bacteria 3601
634 nmdc:mga09592_104089_c1 3300050508 Unclassified 2432
635 nmdc:mga09592_1391206_c1 3300050508 Bacteria 574
636 nmdc:mga09592_57384_c2 3300050508 Unclassified 2837
637 nmdc:mga09592_83643_c1 3300050508 Bacteria 2720
638 nmdc:mga09592_8582_c1 3300050508 Bacteria 8312
639 nmdc:mga0qj67_259059_c1 3300050509 Bacteria 1411
640 nmdc:mga06r32_299855_c1 3300050510 Bacteria 1593
641 nmdc:mga06r32_76337_c1 3300050510 Unclassified 3254
642 nmdc:mga06r32_79019_c1 3300050510 Bacteria 3199
643 nmdc:mga08y16_1456671_c1 3300050511 Unclassified 646
644 nmdc:mga08y16_16989_c1 3300050511 Bacteria 7663
645 nmdc:mga08y16_20147_c1 3300050511 Bacteria 7039
646 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
647 nmdc:mga08y16_527007_c1 3300050511 Bacteria 1198
648 nmdc:mga08y16_56559_c1 3300050511 Bacteria 4099
649 nmdc:mga0n895_1125415_c1 3300050512 Bacteria 762
650 nmdc:mga0n895_1372649_c1 3300050512 Unclassified 676
651 nmdc:mga0n895_155_c1 3300050512 Bacteria 42337
652 nmdc:mga0n895_22134_c1 3300050512 Bacteria 5957
653 nmdc:mga0n895_22949_c1 3300050512 Bacteria 5856
654 nmdc:mga0n895_278071_c1 3300050512 Bacteria 1698
655 nmdc:mga0n895_318284_c1 3300050512 Bacteria 1577
656 nmdc:mga0n895_332434_c1 3300050512 Unclassified 1539
657 nmdc:mga0n895_461514_c1 3300050512 Bacteria 1282
658 nmdc:mga0n895_569327_c1 3300050512 Bacteria 1138
659 nmdc:mga0rr50_110142_c1 3300050513 Bacteria 2178
660 nmdc:mga0rr50_1117979_c1 3300050513 Unclassified 670
661 nmdc:mga0rr50_130271_c1 3300050513 Bacteria 2013
662 nmdc:mga0rr50_147625_c1 3300050513 Bacteria 1897
663 nmdc:mga0rr50_2085_c1 3300050513 Bacteria 11170
664 nmdc:mga0rr50_279927_c1 3300050513 Bacteria 1392
665 nmdc:mga0rr50_421087_c1 3300050513 Bacteria 1130
666 nmdc:mga0rr50_572626_c1 3300050513 Bacteria 962
667 nmdc:mga0rr50_667167_c1 3300050513 Bacteria 887
668 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
669 nmdc:mga08x19_1236723_c1 3300050514 Bacteria 529
670 nmdc:mga08x19_518753_c1 3300050514 Unclassified 842
671 nmdc:mga08x19_6227_c1 3300050514 Bacteria 7060
672 nmdc:mga08x19_705276_c1 3300050514 Bacteria 716
673 nmdc:mga08x19_725289_c1 3300050514 Bacteria 706
674 nmdc:mga08x19_8441_c1 3300050514 Bacteria 6136
675 nmdc:mga0a205_124959_c1 3300050515 Unclassified 2472
676 nmdc:mga0a205_186381_c1 3300050515 Bacteria 1968
677 nmdc:mga0a205_345667_c1 3300050515 Bacteria 1356
678 nmdc:mga0a205_397971_c1 3300050515 Unclassified 1241
679 nmdc:mga0a205_461751_c1 3300050515 Unclassified 1129
680 nmdc:mga0a205_534994_c1 3300050515 Bacteria 1028
681 Ga0495601_0585699 3300053077 Unclassified 716
682 Ga0495595_0037229 3300053084 Unclassified 2211
683 Ga0495595_0152132 3300053084 Unclassified 1139
684 Ga0495619_0000467 3300053085 Bacteria 27272
685 Ga0495619_0115407 3300053085 Bacteria 1838
686 Ga0495619_0400805 3300053085 Bacteria 947
687 Ga0500658_0460415 3300053134 Unclassified 578
688 Ga0501084_0204622 3300054114 Bacteria 1666
689 Ga0530510_0302798 3300061734 Bacteria 1196

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0113585 Ga0451576_0113585_1531_1914 122
2 3300005546 Ga0070696_100350568 Ga0070696_1003505682 132
3 3300035111 Ga0373923_0030845 Ga0373923_0030845_66_470 132
4 3300035117 Ga0373953_0034209 Ga0373953_0034209_194_598 132
5 3300035118 Ga0373954_0409771 Ga0373954_0409771_121_525 132
6 3300035119 Ga0373956_0074960 Ga0373956_0074960_576_980 132
7 3300035172 Ga0373955_0297689 Ga0373955_0297689_415_819 132
8 3300035692 Ga0373935_0366690 Ga0373935_0366690_376_780 132
9 3300035695 Ga0373927_0003122 Ga0373927_0003122_10007_10411 132
10 3300035725 Ga0373947_0203911 Ga0373947_0203911_680_1084 132
11 3300036401 Ga0373937_0024576 Ga0373937_0024576_1351_1755 132
12 3300046472 Ga0495580_0008121 Ga0495580_0008121_4927_5331 132
13 3300046511 Ga0495608_0300355 Ga0495608_0300355_455_859 132
14 3300046531 Ga0495665_0454600 Ga0495665_0454600_26_430 132
15 3300046543 Ga0495645_0332283 Ga0495645_0332283_77_481 132
16 3300046559 Ga0495667_0394504 Ga0495667_0394504_280_684 132
17 3300046663 Ga0495635_0678360 Ga0495635_0678360_84_488 132
18 3300046680 Ga0495646_0509723 Ga0495646_0509723_183_587 132
19 3300046689 Ga0495613_0224044 Ga0495613_0224044_287_691 132
20 3300047319 Ga0495674_0328178 Ga0495674_0328178_746_1150 132
21 3300048088 Ga0495602_0158349 Ga0495602_0158349_688_1092 132
22 3300005468 Ga0070707_100132105 Ga0070707_1001321052 133
23 3300005518 Ga0070699_100088560 Ga0070699_1000885604 133
24 3300025922 Ga0207646_10232911 Ga0207646_102329112 133
25 3300046499 Ga0495594_0808988 Ga0495594_0808988_17_484 133
26 3300005330 Ga0070690_100044608 Ga0070690_1000446083 135
27 3300005335 Ga0070666_10005197 Ga0070666_100051979 135
28 3300005338 Ga0068868_101236384 Ga0068868_1012363841 135
29 3300005343 Ga0070687_100018069 Ga0070687_1000180693 135
30 3300005345 Ga0070692_11090658 Ga0070692_110906581 135
31 3300005366 Ga0070659_100104759 Ga0070659_1001047592 135
32 3300005436 Ga0070713_100016406 Ga0070713_1000164066 135
33 3300005436 Ga0070713_100851994 Ga0070713_1008519942 135
34 3300005439 Ga0070711_100323950 Ga0070711_1003239502 135
35 3300005457 Ga0070662_100912737 Ga0070662_1009127371 135
36 3300005578 Ga0068854_100016621 Ga0068854_1000166213 135
37 3300005842 Ga0068858_100534659 Ga0068858_1005346592 135
38 3300006028 Ga0070717_10406113 Ga0070717_104061133 135
39 3300009177 Ga0105248_10203524 Ga0105248_102035242 135
40 3300013297 Ga0157378_12462910 Ga0157378_124629101 135
41 3300013307 Ga0157372_10227110 Ga0157372_102271101 135
42 3300025903 Ga0207680_10003047 Ga0207680_100030473 135
43 3300025911 Ga0207654_10160375 Ga0207654_101603751 135
44 3300025918 Ga0207662_10160184 Ga0207662_101601842 135
45 3300025928 Ga0207700_10012994 Ga0207700_100129942 135
46 3300025941 Ga0207711_10152869 Ga0207711_101528692 135
47 3300025981 Ga0207640_10092137 Ga0207640_100921373 135
48 3300026035 Ga0207703_10465325 Ga0207703_104653252 135
49 3300035692 Ga0373935_0772090 Ga0373935_0772090_195_620 135
50 3300035695 Ga0373927_0161115 Ga0373927_0161115_311_736 135
51 3300050514 nmdc:mga08x19_518753_c1 nmdc:mga08x19_518753_c1_221_643 135
52 3300005293 Ga0065715_11013547 Ga0065715_110135471 136
53 3300005367 Ga0070667_101562284 Ga0070667_1015622841 136
54 3300005564 Ga0070664_100422475 Ga0070664_1004224752 136
55 3300005617 Ga0068859_101539761 Ga0068859_1015397611 136
56 3300006931 Ga0097620_101539729 Ga0097620_1015397292 136
57 3300009147 Ga0114129_11329851 Ga0114129_113298512 136
58 3300035118 Ga0373954_0105903 Ga0373954_0105903_543_1016 136
59 3300035692 Ga0373935_0060735 Ga0373935_0060735_1140_1613 136
60 3300035725 Ga0373947_0582128 Ga0373947_0582128_73_546 136
61 3300036401 Ga0373937_0024622 Ga0373937_0024622_1308_1781 136
62 3300045976 Ga0466967_1297180 Ga0466967_1297180_258_686 136
63 3300050511 nmdc:mga08y16_1456671_c1 nmdc:mga08y16_1456671_c1_28_501 136
64 3300005293 Ga0065715_10382837 Ga0065715_103828371 137
65 3300005330 Ga0070690_100887440 Ga0070690_1008874401 137
66 3300005339 Ga0070660_100409308 Ga0070660_1004093082 137
67 3300005340 Ga0070689_100007594 Ga0070689_1000075944 137
68 3300005343 Ga0070687_100339225 Ga0070687_1003392251 137
69 3300005354 Ga0070675_100000420 Ga0070675_1000004206 137
70 3300005406 Ga0070703_10102669 Ga0070703_101026693 137
71 3300005518 Ga0070699_100019455 Ga0070699_1000194557 137
72 3300005543 Ga0070672_100045709 Ga0070672_1000457095 137
73 3300005546 Ga0070696_100008917 Ga0070696_1000089174 137
74 3300005549 Ga0070704_100533901 Ga0070704_1005339012 137
75 3300005564 Ga0070664_101084422 Ga0070664_1010844221 137
76 3300005617 Ga0068859_100004813 Ga0068859_10000481316 137
77 3300005618 Ga0068864_100479442 Ga0068864_1004794423 137
78 3300005841 Ga0068863_100657128 Ga0068863_1006571282 137
79 3300005842 Ga0068858_100033758 Ga0068858_1000337585 137
80 3300005843 Ga0068860_100008710 Ga0068860_1000087108 137
81 3300006237 Ga0097621_101092074 Ga0097621_1010920741 137
82 3300006358 Ga0068871_100989659 Ga0068871_1009896592 137
83 3300006881 Ga0068865_100250478 Ga0068865_1002504782 137
84 3300006931 Ga0097620_100004814 Ga0097620_10000481416 137
85 3300013308 Ga0157375_10171475 Ga0157375_101714753 137
86 3300014745 Ga0157377_10058158 Ga0157377_100581583 137
87 3300034820 Ga0373959_0075424 Ga0373959_0075424_273_740 137
88 3300035121 Ga0373960_0240367 Ga0373960_0240367_146_613 137
89 3300037853 Ga0436364_1555357 Ga0436364_1555357_541_975 137
90 3300005340 Ga0070689_100527183 Ga0070689_1005271832 138
91 3300005341 Ga0070691_10365503 Ga0070691_103655032 138
92 3300005440 Ga0070705_100035978 Ga0070705_1000359782 138
93 3300005444 Ga0070694_100188676 Ga0070694_1001886762 138
94 3300005549 Ga0070704_100040294 Ga0070704_1000402943 138
95 3300026067 Ga0207678_11499239 Ga0207678_114992391 138
96 3300026118 Ga0207675_100169087 Ga0207675_1001690872 138
97 3300028381 Ga0268264_10775127 Ga0268264_107751271 138
98 3300031901 Ga0307406_10296600 Ga0307406_102966002 138
99 3300046473 Ga0495582_0573113 Ga0495582_0573113_115_543 138
100 3300046539 Ga0495621_0064202 Ga0495621_0064202_723_1181 138
101 3300046689 Ga0495613_0006776 Ga0495613_0006776_4695_5123 138
102 3300005434 Ga0070709_10097681 Ga0070709_100976811 139
103 3300005445 Ga0070708_100036000 Ga0070708_1000360002 139
104 3300006028 Ga0070717_11372256 Ga0070717_113722561 139
105 3300006173 Ga0070716_100336903 Ga0070716_1003369032 139
106 3300006175 Ga0070712_101009227 Ga0070712_1010092271 139
107 3300007076 Ga0075435_100292109 Ga0075435_1002921092 139
108 3300013297 Ga0157378_12157689 Ga0157378_121576892 139
109 3300025906 Ga0207699_10056845 Ga0207699_100568454 139
110 3300025915 Ga0207693_10810326 Ga0207693_108103261 139
111 3300025939 Ga0207665_10353429 Ga0207665_103534291 139
112 3300050514 nmdc:mga08x19_705276_c1 nmdc:mga08x19_705276_c1_201_647 139
113 3300005295 Ga0065707_10017938 Ga0065707_100179383 140
114 3300005340 Ga0070689_100064840 Ga0070689_1000648402 140
115 3300005354 Ga0070675_100681561 Ga0070675_1006815612 140
116 3300005365 Ga0070688_100025850 Ga0070688_1000258502 140
117 3300005456 Ga0070678_100290418 Ga0070678_1002904182 140
118 3300005617 Ga0068859_100011030 Ga0068859_1000110306 140
119 3300006880 Ga0075429_101039023 Ga0075429_1010390232 140
120 3300006931 Ga0097620_100011030 Ga0097620_1000110306 140
121 3300007076 Ga0075435_100031431 Ga0075435_1000314314 140
122 3300009147 Ga0114129_12322984 Ga0114129_123229841 140
123 3300025906 Ga0207699_10236969 Ga0207699_102369692 140
124 3300025926 Ga0207659_11710316 Ga0207659_117103161 140
125 3300025936 Ga0207670_10008405 Ga0207670_100084054 140
126 3300025939 Ga0207665_10101987 Ga0207665_101019873 140
127 3300035111 Ga0373923_0025960 Ga0373923_0025960_705_1157 140
128 3300035171 Ga0373946_0011756 Ga0373946_0011756_453_905 140
129 3300035172 Ga0373955_0038971 Ga0373955_0038971_918_1370 140
130 3300035410 Ga0373924_0131436 Ga0373924_0131436_239_691 140
131 3300035692 Ga0373935_0047950 Ga0373935_0047950_1837_2289 140
132 3300035695 Ga0373927_0303384 Ga0373927_0303384_504_956 140
133 3300037068 Ga0373925_0007400 Ga0373925_0007400_816_1268 140
134 3300045051 Ga0451576_0092252 Ga0451576_0092252_286_726 140
135 3300046537 Ga0495598_0174964 Ga0495598_0174964_185_625 140
136 3300046689 Ga0495613_0056038 Ga0495613_0056038_1013_1465 140
137 3300048905 Ga0496102_0468433 Ga0496102_0468433_354_797 140
138 3300050507 nmdc:mga05p37_1682365_c1 nmdc:mga05p37_1682365_c1_113_553 140
139 3300053085 Ga0495619_0400805 Ga0495619_0400805_172_624 140
140 3300005331 Ga0070670_100192322 Ga0070670_1001923222 141
141 3300005338 Ga0068868_100447393 Ga0068868_1004473933 141
142 3300005347 Ga0070668_100537392 Ga0070668_1005373921 141
143 3300005459 Ga0068867_101157175 Ga0068867_1011571751 141
144 3300005549 Ga0070704_100042174 Ga0070704_1000421741 141
145 3300005578 Ga0068854_101153624 Ga0068854_1011536241 141
146 3300005617 Ga0068859_100013716 Ga0068859_1000137167 141
147 3300005618 Ga0068864_100097966 Ga0068864_1000979663 141
148 3300005718 Ga0068866_10056148 Ga0068866_100561484 141
149 3300005718 Ga0068866_11155705 Ga0068866_111557051 141
150 3300005843 Ga0068860_101878042 Ga0068860_1018780421 141
151 3300006163 Ga0070715_10210119 Ga0070715_102101191 141
152 3300006173 Ga0070716_100754377 Ga0070716_1007543771 141
153 3300006358 Ga0068871_100055583 Ga0068871_1000555832 141
154 3300006358 Ga0068871_100148282 Ga0068871_1001482822 141
155 3300006931 Ga0097620_100013716 Ga0097620_1000137162 141
156 3300009148 Ga0105243_11149257 Ga0105243_111492571 141
157 3300009177 Ga0105248_10967486 Ga0105248_109674862 141
158 3300011119 Ga0105246_10505143 Ga0105246_105051431 141
159 3300014325 Ga0163163_10037770 Ga0163163_100377705 141
160 3300014969 Ga0157376_10484951 Ga0157376_104849511 141
161 3300025899 Ga0207642_10739692 Ga0207642_107396921 141
162 3300025925 Ga0207650_10306765 Ga0207650_103067652 141
163 3300025938 Ga0207704_10113790 Ga0207704_101137903 141
164 3300026035 Ga0207703_11056503 Ga0207703_110565031 141
165 3300026089 Ga0207648_10817522 Ga0207648_108175221 141
166 3300026095 Ga0207676_10078620 Ga0207676_100786203 141
167 3300026116 Ga0207674_10193538 Ga0207674_101935382 141
168 3300026121 Ga0207683_10707836 Ga0207683_107078361 141
169 3300028381 Ga0268264_11278527 Ga0268264_112785273 141
170 3300035116 Ga0373945_0074619 Ga0373945_0074619_719_1174 141
171 3300046499 Ga0495594_0354566 Ga0495594_0354566_327_782 141
172 3300046533 Ga0495640_0389277 Ga0495640_0389277_30_485 141
173 3300046642 Ga0495634_0410910 Ga0495634_0410910_316_771 141
174 3300046675 Ga0495657_0389104 Ga0495657_0389104_40_477 141
175 3300046681 Ga0495647_0017778 Ga0495647_0017778_1128_1583 141
176 3300046683 Ga0495658_0123757 Ga0495658_0123757_1018_1473 141
177 3300046689 Ga0495613_0747537 Ga0495613_0747537_101_556 141
178 3300047315 Ga0495581_0620688 Ga0495581_0620688_29_484 141
179 3300048903 Ga0496100_0025659 Ga0496100_0025659_1441_1893 141
180 3300048904 Ga0496101_0002033 Ga0496101_0002033_996_1448 141
181 3300048917 Ga0496114_0000224 Ga0496114_0000224_19180_19632 141
182 3300050513 nmdc:mga0rr50_667167_c1 nmdc:mga0rr50_667167_c1_195_653 141
183 3300053084 Ga0495595_0152132 Ga0495595_0152132_399_851 141
184 3300005334 Ga0068869_100184698 Ga0068869_1001846982 142
185 3300005335 Ga0070666_10236424 Ga0070666_102364242 142
186 3300005459 Ga0068867_100048878 Ga0068867_1000488783 142
187 3300005548 Ga0070665_100007666 Ga0070665_1000076667 142
188 3300006237 Ga0097621_100036808 Ga0097621_1000368085 142
189 3300006852 Ga0075433_10186648 Ga0075433_101866482 142
190 3300006871 Ga0075434_100151091 Ga0075434_1001510913 142
191 3300009148 Ga0105243_11205774 Ga0105243_112057742 142
192 3300009176 Ga0105242_10003405 Ga0105242_100034057 142
193 3300009177 Ga0105248_10370785 Ga0105248_103707852 142
194 3300013297 Ga0157378_10239618 Ga0157378_102396181 142
195 3300013306 Ga0163162_10096350 Ga0163162_100963503 142
196 3300014326 Ga0157380_10958032 Ga0157380_109580322 142
197 3300014968 Ga0157379_10412566 Ga0157379_104125663 142
198 3300014969 Ga0157376_10141916 Ga0157376_101419162 142
199 3300025903 Ga0207680_10184829 Ga0207680_101848293 142
200 3300025927 Ga0207687_10071059 Ga0207687_100710593 142
201 3300025934 Ga0207686_10060080 Ga0207686_100600802 142
202 3300025937 Ga0207669_11080888 Ga0207669_110808881 142
203 3300025941 Ga0207711_10779599 Ga0207711_107795993 142
204 3300025942 Ga0207689_10279317 Ga0207689_102793172 142
205 3300025981 Ga0207640_10418534 Ga0207640_104185341 142
206 3300026089 Ga0207648_10025117 Ga0207648_100251175 142
207 3300027907 Ga0207428_11010378 Ga0207428_110103781 142
208 3300028379 Ga0268266_10007524 Ga0268266_100075247 142
209 3300035725 Ga0373947_0361599 Ga0373947_0361599_470_904 142
210 3300037068 Ga0373925_1352407 Ga0373925_1352407_123_557 142
211 3300044694 Ga0466963_0249627 Ga0466963_0249627_657_1106 142
212 3300045976 Ga0466967_0336347 Ga0466967_0336347_105_554 142
213 3300046455 Ga0495603_0362317 Ga0495603_0362317_44_478 142
214 3300048917 Ga0496114_0439598 Ga0496114_0439598_272_706 142
215 3300049583 Ga0501067_0072969 Ga0501067_0072969_1247_1681 142
216 3300050509 nmdc:mga0qj67_259059_c1 nmdc:mga0qj67_259059_c1_874_1314 142
217 3300050512 nmdc:mga0n895_332434_c1 nmdc:mga0n895_332434_c1_924_1358 142
218 3300050513 nmdc:mga0rr50_572626_c1 nmdc:mga0rr50_572626_c1_415_861 142
219 3300050514 nmdc:mga08x19_1236723_c1 nmdc:mga08x19_1236723_c1_15_461 142
220 3300053134 Ga0500658_0460415 Ga0500658_0460415_24_458 142
221 3300005293 Ga0065715_10105377 Ga0065715_101053773 143
222 3300005293 Ga0065715_11157041 Ga0065715_111570411 143
223 3300005331 Ga0070670_100056545 Ga0070670_1000565455 143
224 3300005334 Ga0068869_101051464 Ga0068869_1010514642 143
225 3300005339 Ga0070660_100776742 Ga0070660_1007767422 143
226 3300005340 Ga0070689_100004437 Ga0070689_1000044375 143
227 3300005340 Ga0070689_100157305 Ga0070689_1001573052 143
228 3300005345 Ga0070692_10548435 Ga0070692_105484352 143
229 3300005345 Ga0070692_10844625 Ga0070692_108446251 143
230 3300005347 Ga0070668_100746430 Ga0070668_1007464302 143
231 3300005353 Ga0070669_100003956 Ga0070669_1000039567 143
232 3300005353 Ga0070669_100013215 Ga0070669_1000132156 143
233 3300005353 Ga0070669_100236595 Ga0070669_1002365952 143
234 3300005354 Ga0070675_100015160 Ga0070675_1000151604 143
235 3300005354 Ga0070675_100903125 Ga0070675_1009031253 143
236 3300005356 Ga0070674_100034274 Ga0070674_1000342743 143
237 3300005365 Ga0070688_100021695 Ga0070688_1000216953 143
238 3300005366 Ga0070659_100914461 Ga0070659_1009144611 143
239 3300005438 Ga0070701_10006396 Ga0070701_100063964 143
240 3300005440 Ga0070705_100141952 Ga0070705_1001419523 143
241 3300005441 Ga0070700_100320739 Ga0070700_1003207392 143
242 3300005444 Ga0070694_100020555 Ga0070694_1000205553 143
243 3300005457 Ga0070662_100024350 Ga0070662_1000243504 143
244 3300005457 Ga0070662_100121692 Ga0070662_1001216922 143
245 3300005471 Ga0070698_101219248 Ga0070698_1012192482 143
246 3300005545 Ga0070695_100298064 Ga0070695_1002980642 143
247 3300005577 Ga0068857_100001266 Ga0068857_10000126618 143
248 3300005577 Ga0068857_100181290 Ga0068857_1001812904 143
249 3300005616 Ga0068852_100870742 Ga0068852_1008707422 143
250 3300005617 Ga0068859_100005036 Ga0068859_10000503614 143
251 3300005618 Ga0068864_100237196 Ga0068864_1002371962 143
252 3300005718 Ga0068866_10159885 Ga0068866_101598852 143
253 3300005719 Ga0068861_100129069 Ga0068861_1001290693 143
254 3300005840 Ga0068870_10007388 Ga0068870_100073882 143
255 3300005842 Ga0068858_100097790 Ga0068858_1000977902 143
256 3300005843 Ga0068860_100465341 Ga0068860_1004653412 143
257 3300005844 Ga0068862_100006051 Ga0068862_1000060519 143
258 3300006844 Ga0075428_100740949 Ga0075428_1007409492 143
259 3300006844 Ga0075428_101205477 Ga0075428_1012054771 143
260 3300006846 Ga0075430_100000072 Ga0075430_10000007248 143
261 3300006846 Ga0075430_100242321 Ga0075430_1002423212 143
262 3300006847 Ga0075431_100013452 Ga0075431_1000134526 143
263 3300006847 Ga0075431_101088522 Ga0075431_1010885221 143
264 3300006852 Ga0075433_10573214 Ga0075433_105732142 143
265 3300006871 Ga0075434_100672911 Ga0075434_1006729112 143
266 3300006880 Ga0075429_100019241 Ga0075429_1000192412 143
267 3300006880 Ga0075429_100670107 Ga0075429_1006701072 143
268 3300006881 Ga0068865_100256718 Ga0068865_1002567182 143
269 3300006931 Ga0097620_100005036 Ga0097620_1000050364 143
270 3300009098 Ga0105245_11026190 Ga0105245_110261901 143
271 3300009147 Ga0114129_10601186 Ga0114129_106011861 143
272 3300009176 Ga0105242_10142350 Ga0105242_101423503 143
273 3300014325 Ga0163163_10616231 Ga0163163_106162311 143
274 3300014326 Ga0157380_10467495 Ga0157380_104674952 143
275 3300014969 Ga0157376_10034851 Ga0157376_100348514 143
276 3300025908 Ga0207643_10003059 Ga0207643_100030599 143
277 3300025908 Ga0207643_10003533 Ga0207643_100035332 143
278 3300025923 Ga0207681_10001613 Ga0207681_100016133 143
279 3300025923 Ga0207681_10562880 Ga0207681_105628802 143
280 3300025925 Ga0207650_10105381 Ga0207650_101053812 143
281 3300025933 Ga0207706_10043015 Ga0207706_100430152 143
282 3300025935 Ga0207709_10117223 Ga0207709_101172232 143
283 3300025936 Ga0207670_10012794 Ga0207670_100127946 143
284 3300025938 Ga0207704_10038785 Ga0207704_100387852 143
285 3300025945 Ga0207679_10081320 Ga0207679_100813204 143
286 3300025960 Ga0207651_10023303 Ga0207651_100233033 143
287 3300025961 Ga0207712_10007323 Ga0207712_100073234 143
288 3300025972 Ga0207668_10014395 Ga0207668_100143952 143
289 3300025972 Ga0207668_10080879 Ga0207668_100808791 143
290 3300026035 Ga0207703_10190728 Ga0207703_101907283 143
291 3300026035 Ga0207703_10244652 Ga0207703_102446522 143
292 3300026075 Ga0207708_10105502 Ga0207708_101055022 143
293 3300026075 Ga0207708_11050039 Ga0207708_110500391 143
294 3300026089 Ga0207648_10001866 Ga0207648_100018665 143
295 3300026116 Ga0207674_10019158 Ga0207674_100191586 143
296 3300026116 Ga0207674_10084419 Ga0207674_100844195 143
297 3300026118 Ga0207675_100015632 Ga0207675_1000156325 143
298 3300026118 Ga0207675_100181116 Ga0207675_1001811162 143
299 3300026118 Ga0207675_100275563 Ga0207675_1002755632 143
300 3300026142 Ga0207698_10744277 Ga0207698_107442772 143
301 3300027907 Ga0207428_10003716 Ga0207428_100037163 143
302 3300028380 Ga0268265_10000421 Ga0268265_1000042131 143
303 3300028381 Ga0268264_10421067 Ga0268264_104210672 143
304 3300044712 Ga0453684_1753611 Ga0453684_1753611_177_614 143
305 3300045051 Ga0451576_0671639 Ga0451576_0671639_187_624 143
306 3300048915 Ga0496112_1347521 Ga0496112_1347521_43_492 143
307 3300049593 Ga0501077_0291136 Ga0501077_0291136_59_496 143
308 3300050508 nmdc:mga09592_104089_c1 nmdc:mga09592_104089_c1_224_661 143
309 3300050511 nmdc:mga08y16_16989_c1 nmdc:mga08y16_16989_c1_1304_1741 143
310 3300050513 nmdc:mga0rr50_1117979_c1 nmdc:mga0rr50_1117979_c1_130_567 143
311 3300050515 nmdc:mga0a205_461751_c1 nmdc:mga0a205_461751_c1_558_995 143
312 3300005290 Ga0065712_10267094 Ga0065712_102670942 144
313 3300005355 Ga0070671_101453163 Ga0070671_1014531631 144
314 3300005365 Ga0070688_100480872 Ga0070688_1004808721 144
315 3300005543 Ga0070672_101484802 Ga0070672_1014848021 144
316 3300005563 Ga0068855_100287927 Ga0068855_1002879272 144
317 3300005719 Ga0068861_100243105 Ga0068861_1002431053 144
318 3300005719 Ga0068861_100728803 Ga0068861_1007288032 144
319 3300005844 Ga0068862_100014260 Ga0068862_1000142606 144
320 3300006844 Ga0075428_100000056 Ga0075428_10000005630 144
321 3300006844 Ga0075428_100825542 Ga0075428_1008255422 144
322 3300006847 Ga0075431_100110346 Ga0075431_1001103462 144
323 3300006871 Ga0075434_100184004 Ga0075434_1001840042 144
324 3300007076 Ga0075435_100000962 Ga0075435_1000009625 144
325 3300009094 Ga0111539_10000002 Ga0111539_10000002251 144
326 3300009094 Ga0111539_10021656 Ga0111539_100216566 144
327 3300009098 Ga0105245_10344157 Ga0105245_103441572 144
328 3300009147 Ga0114129_10012031 Ga0114129_100120316 144
329 3300009147 Ga0114129_10022700 Ga0114129_100227002 144
330 3300009147 Ga0114129_10284660 Ga0114129_102846603 144
331 3300009177 Ga0105248_10466773 Ga0105248_104667732 144
332 3300009553 Ga0105249_12636839 Ga0105249_126368391 144
333 3300010375 Ga0105239_12002347 Ga0105239_120023471 144
334 3300013308 Ga0157375_10359266 Ga0157375_103592663 144
335 3300014326 Ga0157380_10037251 Ga0157380_100372514 144
336 3300014968 Ga0157379_11489864 Ga0157379_114898641 144
337 3300015265 Ga0182005_1148521 Ga0182005_11485211 144
338 3300025923 Ga0207681_10006385 Ga0207681_100063858 144
339 3300025925 Ga0207650_10865767 Ga0207650_108657672 144
340 3300025927 Ga0207687_10344747 Ga0207687_103447472 144
341 3300025933 Ga0207706_10277433 Ga0207706_102774332 144
342 3300025937 Ga0207669_10442722 Ga0207669_104427222 144
343 3300025938 Ga0207704_10921979 Ga0207704_109219792 144
344 3300025940 Ga0207691_10189119 Ga0207691_101891192 144
345 3300025940 Ga0207691_10863845 Ga0207691_108638451 144
346 3300025949 Ga0207667_10133590 Ga0207667_101335903 144
347 3300025972 Ga0207668_10632155 Ga0207668_106321552 144
348 3300026023 Ga0207677_10297655 Ga0207677_102976552 144
349 3300026118 Ga0207675_100084976 Ga0207675_1000849765 144
350 3300026118 Ga0207675_100167340 Ga0207675_1001673402 144
351 3300027907 Ga0207428_10000004 Ga0207428_10000004405 144
352 3300027907 Ga0207428_10084357 Ga0207428_100843572 144
353 3300028380 Ga0268265_10129348 Ga0268265_101293482 144
354 3300034816 Ga0373930_0004773 Ga0373930_0004773_294_749 144
355 3300034818 Ga0373950_0032529 Ga0373950_0032529_20_475 144
356 3300034820 Ga0373959_0000414 Ga0373959_0000414_4098_4553 144
357 3300035084 Ga0373928_0001753 Ga0373928_0001753_116_571 144
358 3300035085 Ga0373929_0000819 Ga0373929_0000819_454_909 144
359 3300035088 Ga0373940_0000568 Ga0373940_0000568_2670_3125 144
360 3300035090 Ga0373949_0001899 Ga0373949_0001899_4225_4680 144
361 3300035091 Ga0373951_0001057 Ga0373951_0001057_3765_4220 144
362 3300035092 Ga0373952_0001303 Ga0373952_0001303_1515_1970 144
363 3300035112 Ga0373932_0001327 Ga0373932_0001327_3425_3880 144
364 3300035114 Ga0373939_0002741 Ga0373939_0002741_1715_2170 144
365 3300035115 Ga0373941_0001420 Ga0373941_0001420_3851_4306 144
366 3300035121 Ga0373960_0000111 Ga0373960_0000111_6758_7213 144
367 3300035207 Ga0373942_0000209 Ga0373942_0000209_10603_11058 144
368 3300035241 Ga0373961_0002181 Ga0373961_0002181_332_787 144
369 3300035242 Ga0373962_0069060 Ga0373962_0069060_328_783 144
370 3300035691 Ga0373931_0002316 Ga0373931_0002316_5313_5768 144
371 3300045051 Ga0451576_0040683 Ga0451576_0040683_1516_1971 144
372 3300046664 Ga0495659_0389155 Ga0495659_0389155_41_478 144
373 3300048909 Ga0496106_0218693 Ga0496106_0218693_358_813 144
374 3300049583 Ga0501067_0372914 Ga0501067_0372914_90_545 144
375 3300050507 nmdc:mga05p37_1366299_c1 nmdc:mga05p37_1366299_c1_259_705 144
376 3300050507 nmdc:mga05p37_2604_c2 nmdc:mga05p37_2604_c2_3846_4301 144
377 3300050507 nmdc:mga05p37_33262_c2 nmdc:mga05p37_33262_c2_1352_1843 144
378 3300050507 nmdc:mga05p37_51966_c1 nmdc:mga05p37_51966_c1_2122_2568 144
379 3300050508 nmdc:mga09592_57384_c2 nmdc:mga09592_57384_c2_123_614 144
380 3300050510 nmdc:mga06r32_79019_c1 nmdc:mga06r32_79019_c1_2035_2475 144
381 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_673450_673890 144
382 3300050511 nmdc:mga08y16_56559_c1 nmdc:mga08y16_56559_c1_1610_2065 144
383 3300050512 nmdc:mga0n895_1372649_c1 nmdc:mga0n895_1372649_c1_103_558 144
384 3300050512 nmdc:mga0n895_22949_c1 nmdc:mga0n895_22949_c1_1667_2122 144
385 3300050513 nmdc:mga0rr50_2085_c1 nmdc:mga0rr50_2085_c1_7180_7638 144
386 3300050515 nmdc:mga0a205_124959_c1 nmdc:mga0a205_124959_c1_1676_2167 144
387 3300005289 Ga0065704_10304040 Ga0065704_103040402 145
388 3300005328 Ga0070676_10019922 Ga0070676_100199223 145
389 3300005330 Ga0070690_100077917 Ga0070690_1000779172 145
390 3300005339 Ga0070660_100116064 Ga0070660_1001160642 145
391 3300005341 Ga0070691_10197266 Ga0070691_101972662 145
392 3300005345 Ga0070692_10069121 Ga0070692_100691212 145
393 3300005347 Ga0070668_100051959 Ga0070668_1000519593 145
394 3300005355 Ga0070671_100052813 Ga0070671_1000528133 145
395 3300005364 Ga0070673_100063095 Ga0070673_1000630952 145
396 3300005438 Ga0070701_10116861 Ga0070701_101168612 145
397 3300005440 Ga0070705_100000037 Ga0070705_10000003760 145
398 3300005440 Ga0070705_100013278 Ga0070705_1000132784 145
399 3300005441 Ga0070700_100021963 Ga0070700_1000219633 145
400 3300005441 Ga0070700_100073743 Ga0070700_1000737432 145
401 3300005441 Ga0070700_100161970 Ga0070700_1001619701 145
402 3300005444 Ga0070694_100001204 Ga0070694_1000012048 145
403 3300005444 Ga0070694_100001228 Ga0070694_1000012287 145
404 3300005444 Ga0070694_100010891 Ga0070694_1000108913 145
405 3300005445 Ga0070708_101184080 Ga0070708_1011840801 145
406 3300005459 Ga0068867_100011482 Ga0068867_1000114825 145
407 3300005467 Ga0070706_100418119 Ga0070706_1004181193 145
408 3300005468 Ga0070707_100836009 Ga0070707_1008360092 145
409 3300005471 Ga0070698_100052702 Ga0070698_1000527024 145
410 3300005518 Ga0070699_100077668 Ga0070699_1000776683 145
411 3300005535 Ga0070684_100581855 Ga0070684_1005818551 145
412 3300005536 Ga0070697_101257660 Ga0070697_1012576601 145
413 3300005543 Ga0070672_100060990 Ga0070672_1000609903 145
414 3300005543 Ga0070672_100264523 Ga0070672_1002645232 145
415 3300005543 Ga0070672_101258152 Ga0070672_1012581521 145
416 3300005545 Ga0070695_100000085 Ga0070695_10000008520 145
417 3300005546 Ga0070696_100000139 Ga0070696_10000013935 145
418 3300005549 Ga0070704_100000453 Ga0070704_10000045321 145
419 3300005549 Ga0070704_100002706 Ga0070704_1000027065 145
420 3300005549 Ga0070704_100444049 Ga0070704_1004440492 145
421 3300005840 Ga0068870_10009645 Ga0068870_100096453 145
422 3300005844 Ga0068862_100727062 Ga0068862_1007270623 145
423 3300006844 Ga0075428_100002585 Ga0075428_10000258517 145
424 3300006844 Ga0075428_100093273 Ga0075428_1000932734 145
425 3300006844 Ga0075428_100236343 Ga0075428_1002363432 145
426 3300006844 Ga0075428_100531833 Ga0075428_1005318332 145
427 3300006852 Ga0075433_10181092 Ga0075433_101810922 145
428 3300006871 Ga0075434_100040479 Ga0075434_1000404793 145
429 3300006871 Ga0075434_100155144 Ga0075434_1001551443 145
430 3300006871 Ga0075434_100217520 Ga0075434_1002175203 145
431 3300006880 Ga0075429_100094158 Ga0075429_1000941584 145
432 3300006914 Ga0075436_100017364 Ga0075436_1000173644 145
433 3300007076 Ga0075435_100000028 Ga0075435_10000002830 145
434 3300009094 Ga0111539_10020340 Ga0111539_100203404 145
435 3300009094 Ga0111539_10043711 Ga0111539_100437112 145
436 3300009098 Ga0105245_10173726 Ga0105245_101737262 145
437 3300009101 Ga0105247_10009886 Ga0105247_100098867 145
438 3300009147 Ga0114129_10001718 Ga0114129_1000171818 145
439 3300009147 Ga0114129_10086253 Ga0114129_100862532 145
440 3300009147 Ga0114129_10208473 Ga0114129_102084733 145
441 3300009147 Ga0114129_10341257 Ga0114129_103412571 145
442 3300009147 Ga0114129_10678885 Ga0114129_106788852 145
443 3300009148 Ga0105243_10145046 Ga0105243_101450462 145
444 3300009176 Ga0105242_10263971 Ga0105242_102639712 145
445 3300009177 Ga0105248_10036273 Ga0105248_100362733 145
446 3300009177 Ga0105248_10252430 Ga0105248_102524301 145
447 3300009553 Ga0105249_10012175 Ga0105249_100121754 145
448 3300013297 Ga0157378_10243400 Ga0157378_102434002 145
449 3300013306 Ga0163162_10179210 Ga0163162_101792102 145
450 3300013308 Ga0157375_10002605 Ga0157375_100026056 145
451 3300013308 Ga0157375_10377499 Ga0157375_103774993 145
452 3300025900 Ga0207710_10078992 Ga0207710_100789922 145
453 3300025901 Ga0207688_10100206 Ga0207688_101002062 145
454 3300025907 Ga0207645_10015012 Ga0207645_100150123 145
455 3300025917 Ga0207660_10540977 Ga0207660_105409772 145
456 3300025918 Ga0207662_10076280 Ga0207662_100762802 145
457 3300025918 Ga0207662_11139563 Ga0207662_111395631 145
458 3300025919 Ga0207657_10026590 Ga0207657_100265903 145
459 3300025923 Ga0207681_10605508 Ga0207681_106055082 145
460 3300025931 Ga0207644_10578671 Ga0207644_105786711 145
461 3300025940 Ga0207691_10060219 Ga0207691_100602192 145
462 3300026067 Ga0207678_10559844 Ga0207678_105598441 145
463 3300026075 Ga0207708_10035033 Ga0207708_100350332 145
464 3300026075 Ga0207708_11142270 Ga0207708_111422702 145
465 3300026088 Ga0207641_10199516 Ga0207641_101995162 145
466 3300027907 Ga0207428_10334440 Ga0207428_103344401 145
467 3300027907 Ga0207428_10347250 Ga0207428_103472502 145
468 3300028380 Ga0268265_10324891 Ga0268265_103248912 145
469 3300041408 Ga0439453_0009770 Ga0439453_0009770_45_494 145
470 3300042436 Ga0439435_0194826 Ga0439435_0194826_132_581 145
471 3300042461 Ga0439460_0099428 Ga0439460_0099428_249_698 145
472 3300046458 Ga0495591_112438 Ga0495591_112438_159_602 145
473 3300046528 Ga0495642_0014190 Ga0495642_0014190_74_517 145
474 3300046538 Ga0495609_0113018 Ga0495609_0113018_29_472 145
475 3300046558 Ga0495633_0358887 Ga0495633_0358887_184_627 145
476 3300046664 Ga0495659_0059166 Ga0495659_0059166_72_515 145
477 3300046684 Ga0495669_0158542 Ga0495669_0158542_58_501 145
478 3300047318 Ga0495636_0412710 Ga0495636_0412710_35_478 145
479 3300047447 Ga0495685_031904 Ga0495685_031904_286_729 145
480 3300048917 Ga0496114_1261067 Ga0496114_1261067_23_466 145
481 3300049574 Ga0501038_0484195 Ga0501038_0484195_91_534 145
482 3300049576 Ga0501040_0002994 Ga0501040_0002994_7931_8374 145
483 3300049577 Ga0501041_0008795 Ga0501041_0008795_2373_2816 145
484 3300049578 Ga0501042_0018474 Ga0501042_0018474_2152_2595 145
485 3300049579 Ga0501043_0323227 Ga0501043_0323227_39_482 145
486 3300049743 Ga0501081_0173120 Ga0501081_0173120_112_555 145
487 3300049824 Ga0501045_0253639 Ga0501045_0253639_812_1255 145
488 3300050507 nmdc:mga05p37_1286_c1 nmdc:mga05p37_1286_c1_12815_13258 145
489 3300050508 nmdc:mga09592_83643_c1 nmdc:mga09592_83643_c1_1893_2336 145
490 3300050508 nmdc:mga09592_8582_c1 nmdc:mga09592_8582_c1_2458_2901 145
491 3300050510 nmdc:mga06r32_76337_c1 nmdc:mga06r32_76337_c1_2404_2847 145
492 3300050511 nmdc:mga08y16_527007_c1 nmdc:mga08y16_527007_c1_534_974 145
493 3300050512 nmdc:mga0n895_1125415_c1 nmdc:mga0n895_1125415_c1_20_463 145
494 3300050512 nmdc:mga0n895_155_c1 nmdc:mga0n895_155_c1_17499_17954 145
495 3300050512 nmdc:mga0n895_22134_c1 nmdc:mga0n895_22134_c1_1262_1705 145
496 3300050512 nmdc:mga0n895_318284_c1 nmdc:mga0n895_318284_c1_184_624 145
497 3300050512 nmdc:mga0n895_461514_c1 nmdc:mga0n895_461514_c1_77_520 145
498 3300050513 nmdc:mga0rr50_130271_c1 nmdc:mga0rr50_130271_c1_1222_1665 145
499 3300050513 nmdc:mga0rr50_279927_c1 nmdc:mga0rr50_279927_c1_109_549 145
500 3300050513 nmdc:mga0rr50_8_c1 nmdc:mga0rr50_8_c1_124648_125103 145
501 3300050514 nmdc:mga08x19_725289_c1 nmdc:mga08x19_725289_c1_201_641 145
502 3300050514 nmdc:mga08x19_8441_c1 nmdc:mga08x19_8441_c1_5081_5536 145
503 3300050515 nmdc:mga0a205_186381_c1 nmdc:mga0a205_186381_c1_712_1155 145
504 3300050515 nmdc:mga0a205_345667_c1 nmdc:mga0a205_345667_c1_862_1305 145
505 3300054114 Ga0501084_0204622 Ga0501084_0204622_484_927 145
506 3300061734 Ga0530510_0302798 Ga0530510_0302798_49_492 145
507 3300005295 Ga0065707_10298169 Ga0065707_102981691 146
508 3300005330 Ga0070690_100098152 Ga0070690_1000981522 146
509 3300005340 Ga0070689_100176984 Ga0070689_1001769842 146
510 3300005364 Ga0070673_100151129 Ga0070673_1001511292 146
511 3300005367 Ga0070667_100006576 Ga0070667_1000065763 146
512 3300005444 Ga0070694_100720437 Ga0070694_1007204371 146
513 3300005445 Ga0070708_100581769 Ga0070708_1005817692 146
514 3300005471 Ga0070698_100000929 Ga0070698_10000092914 146
515 3300005471 Ga0070698_100354222 Ga0070698_1003542222 146
516 3300005518 Ga0070699_100002294 Ga0070699_10000229415 146
517 3300005518 Ga0070699_101163483 Ga0070699_1011634831 146
518 3300005544 Ga0070686_100678182 Ga0070686_1006781822 146
519 3300005545 Ga0070695_101123743 Ga0070695_1011237431 146
520 3300005546 Ga0070696_100207392 Ga0070696_1002073922 146
521 3300005548 Ga0070665_100171575 Ga0070665_1001715752 146
522 3300005549 Ga0070704_100025028 Ga0070704_1000250282 146
523 3300005615 Ga0070702_100030815 Ga0070702_1000308152 146
524 3300005617 Ga0068859_100196467 Ga0068859_1001964674 146
525 3300005718 Ga0068866_10378931 Ga0068866_103789312 146
526 3300005841 Ga0068863_100030531 Ga0068863_1000305314 146
527 3300005842 Ga0068858_100086239 Ga0068858_1000862393 146
528 3300005843 Ga0068860_100452577 Ga0068860_1004525772 146
529 3300006058 Ga0075432_10070913 Ga0075432_100709132 146
530 3300006163 Ga0070715_10657774 Ga0070715_106577741 146
531 3300006173 Ga0070716_100638241 Ga0070716_1006382411 146
532 3300006844 Ga0075428_100871365 Ga0075428_1008713651 146
533 3300006871 Ga0075434_100761387 Ga0075434_1007613871 146
534 3300006914 Ga0075436_100142621 Ga0075436_1001426212 146
535 3300006931 Ga0097620_100196467 Ga0097620_1001964672 146
536 3300007076 Ga0075435_100316552 Ga0075435_1003165522 146
537 3300007076 Ga0075435_100476530 Ga0075435_1004765302 146
538 3300007076 Ga0075435_100517469 Ga0075435_1005174692 146
539 3300009094 Ga0111539_10008678 Ga0111539_100086787 146
540 3300009147 Ga0114129_10207764 Ga0114129_102077643 146
541 3300009148 Ga0105243_10182668 Ga0105243_101826681 146
542 3300009176 Ga0105242_10246450 Ga0105242_102464501 146
543 3300009176 Ga0105242_10459796 Ga0105242_104597962 146
544 3300010159 Ga0099796_10082764 Ga0099796_100827642 146
545 3300013297 Ga0157378_11828923 Ga0157378_118289231 146
546 3300025899 Ga0207642_10372977 Ga0207642_103729772 146
547 3300025905 Ga0207685_10663284 Ga0207685_106632841 146
548 3300025912 Ga0207707_10158528 Ga0207707_101585282 146
549 3300025921 Ga0207652_10044836 Ga0207652_100448362 146
550 3300025931 Ga0207644_10215835 Ga0207644_102158352 146
551 3300025935 Ga0207709_10433268 Ga0207709_104332682 146
552 3300025936 Ga0207670_10037370 Ga0207670_100373703 146
553 3300025939 Ga0207665_10451880 Ga0207665_104518801 146
554 3300025940 Ga0207691_10003774 Ga0207691_1000377410 146
555 3300025941 Ga0207711_10033096 Ga0207711_100330962 146
556 3300025945 Ga0207679_10790464 Ga0207679_107904642 146
557 3300025960 Ga0207651_10223638 Ga0207651_102236382 146
558 3300025986 Ga0207658_10117457 Ga0207658_101174572 146
559 3300026023 Ga0207677_10295702 Ga0207677_102957022 146
560 3300026035 Ga0207703_10735447 Ga0207703_107354472 146
561 3300026088 Ga0207641_10003478 Ga0207641_100034784 146
562 3300026116 Ga0207674_10777553 Ga0207674_107775532 146
563 3300027907 Ga0207428_10015331 Ga0207428_100153314 146
564 3300028379 Ga0268266_10347288 Ga0268266_103472882 146
565 3300028380 Ga0268265_10966190 Ga0268265_109661901 146
566 3300028381 Ga0268264_10078655 Ga0268264_100786553 146
567 3300035088 Ga0373940_0045565 Ga0373940_0045565_482_949 146
568 3300035092 Ga0373952_0056544 Ga0373952_0056544_327_794 146
569 3300035118 Ga0373954_0257278 Ga0373954_0257278_267_719 146
570 3300035170 Ga0373943_0327640 Ga0373943_0327640_267_719 146
571 3300035242 Ga0373962_0011729 Ga0373962_0011729_1001_1468 146
572 3300035692 Ga0373935_0150129 Ga0373935_0150129_24_476 146
573 3300046454 Ga0495592_0021194 Ga0495592_0021194_4135_4587 146
574 3300046472 Ga0495580_0312073 Ga0495580_0312073_159_611 146
575 3300046477 Ga0495664_0175508 Ga0495664_0175508_44_496 146
576 3300046511 Ga0495608_0034081 Ga0495608_0034081_1672_2124 146
577 3300046514 Ga0495618_0477455 Ga0495618_0477455_252_704 146
578 3300046516 Ga0495628_0030887 Ga0495628_0030887_826_1278 146
579 3300046517 Ga0495630_0041023 Ga0495630_0041023_1296_1748 146
580 3300046531 Ga0495665_0062789 Ga0495665_0062789_40_486 146
581 3300046533 Ga0495640_0126420 Ga0495640_0126420_1137_1589 146
582 3300046536 Ga0495587_0057380 Ga0495587_0057380_215_667 146
583 3300046537 Ga0495598_0140971 Ga0495598_0140971_102_554 146
584 3300046559 Ga0495667_0500268 Ga0495667_0500268_204_656 146
585 3300046642 Ga0495634_0079911 Ga0495634_0079911_1207_1659 146
586 3300046663 Ga0495635_0240978 Ga0495635_0240978_212_664 146
587 3300046678 Ga0495599_0065619 Ga0495599_0065619_1052_1504 146
588 3300046681 Ga0495647_0467937 Ga0495647_0467937_54_506 146
589 3300046683 Ga0495658_0077931 Ga0495658_0077931_1192_1644 146
590 3300046689 Ga0495613_0055291 Ga0495613_0055291_129_581 146
591 3300047317 Ga0495604_0092753 Ga0495604_0092753_1234_1686 146
592 3300047319 Ga0495674_0052885 Ga0495674_0052885_2391_2843 146
593 3300047322 Ga0495680_0100190 Ga0495680_0100190_609_1061 146
594 3300047471 Ga0495684_0000053 Ga0495684_0000053_26815_27267 146
595 3300048904 Ga0496101_0186390 Ga0496101_0186390_282_749 146
596 3300050507 nmdc:mga05p37_98504_c1 nmdc:mga05p37_98504_c1_2136_2600 146
597 3300050511 nmdc:mga08y16_20147_c1 nmdc:mga08y16_20147_c1_1744_2196 146
598 3300050513 nmdc:mga0rr50_147625_c1 nmdc:mga0rr50_147625_c1_211_669 146
599 3300050513 nmdc:mga0rr50_421087_c1 nmdc:mga0rr50_421087_c1_125_577 146
600 3300050514 nmdc:mga08x19_6227_c1 nmdc:mga08x19_6227_c1_3649_4104 146
601 3300050515 nmdc:mga0a205_397971_c1 nmdc:mga0a205_397971_c1_629_1096 146
602 3300053077 Ga0495601_0585699 Ga0495601_0585699_162_614 146
603 3300053084 Ga0495595_0037229 Ga0495595_0037229_560_1012 146
604 3300053085 Ga0495619_0000467 Ga0495619_0000467_6421_6873 146
605 3300053085 Ga0495619_0115407 Ga0495619_0115407_572_1024 146
606 3300004799 Ga0058863_11332999 Ga0058863_113329992 147
607 3300005293 Ga0065715_10014205 Ga0065715_100142052 147
608 3300005338 Ga0068868_100497558 Ga0068868_1004975582 147
609 3300005353 Ga0070669_100067210 Ga0070669_1000672103 147
610 3300005353 Ga0070669_100129337 Ga0070669_1001293372 147
611 3300005354 Ga0070675_100149811 Ga0070675_1001498112 147
612 3300005356 Ga0070674_100837878 Ga0070674_1008378781 147
613 3300005436 Ga0070713_102043692 Ga0070713_1020436921 147
614 3300005438 Ga0070701_10248486 Ga0070701_102484862 147
615 3300005438 Ga0070701_10706231 Ga0070701_107062311 147
616 3300005444 Ga0070694_100932405 Ga0070694_1009324051 147
617 3300005457 Ga0070662_100090590 Ga0070662_1000905902 147
618 3300005457 Ga0070662_100261771 Ga0070662_1002617712 147
619 3300005458 Ga0070681_10020213 Ga0070681_100202138 147
620 3300005459 Ga0068867_101680530 Ga0068867_1016805301 147
621 3300005468 Ga0070707_100083186 Ga0070707_1000831862 147
622 3300005468 Ga0070707_100322630 Ga0070707_1003226302 147
623 3300005530 Ga0070679_100031839 Ga0070679_1000318394 147
624 3300005536 Ga0070697_100077672 Ga0070697_1000776723 147
625 3300005536 Ga0070697_100608516 Ga0070697_1006085162 147
626 3300005563 Ga0068855_101133831 Ga0068855_1011338311 147
627 3300005577 Ga0068857_101259772 Ga0068857_1012597721 147
628 3300005719 Ga0068861_100031278 Ga0068861_1000312784 147
629 3300005719 Ga0068861_100096934 Ga0068861_1000969342 147
630 3300005842 Ga0068858_100037321 Ga0068858_1000373214 147
631 3300005843 Ga0068860_100151514 Ga0068860_1001515142 147
632 3300005844 Ga0068862_100078254 Ga0068862_1000782542 147
633 3300006844 Ga0075428_101042020 Ga0075428_1010420201 147
634 3300006846 Ga0075430_100479450 Ga0075430_1004794502 147
635 3300006847 Ga0075431_100364473 Ga0075431_1003644732 147
636 3300006871 Ga0075434_100043057 Ga0075434_1000430572 147
637 3300006871 Ga0075434_101207774 Ga0075434_1012077741 147
638 3300006880 Ga0075429_101556021 Ga0075429_1015560211 147
639 3300006931 Ga0097620_100025646 Ga0097620_1000256467 147
640 3300007076 Ga0075435_100052058 Ga0075435_1000520583 147
641 3300009098 Ga0105245_10216535 Ga0105245_102165352 147
642 3300009101 Ga0105247_10048684 Ga0105247_100486842 147
643 3300009148 Ga0105243_10545627 Ga0105243_105456271 147
644 3300009174 Ga0105241_10799240 Ga0105241_107992402 147
645 3300009177 Ga0105248_11285264 Ga0105248_112852642 147
646 3300009177 Ga0105248_12072581 Ga0105248_120725811 147
647 3300009553 Ga0105249_10345122 Ga0105249_103451222 147
648 3300013307 Ga0157372_11734364 Ga0157372_117343642 147
649 3300014968 Ga0157379_10012294 Ga0157379_100122947 147
650 3300025900 Ga0207710_10223050 Ga0207710_102230502 147
651 3300025922 Ga0207646_10761597 Ga0207646_107615971 147
652 3300025923 Ga0207681_10020770 Ga0207681_100207704 147
653 3300025923 Ga0207681_10221754 Ga0207681_102217542 147
654 3300025926 Ga0207659_10177169 Ga0207659_101771692 147
655 3300025929 Ga0207664_10271190 Ga0207664_102711902 147
656 3300025933 Ga0207706_10088280 Ga0207706_100882803 147
657 3300025933 Ga0207706_10140474 Ga0207706_101404743 147
658 3300025937 Ga0207669_10504017 Ga0207669_105040172 147
659 3300025941 Ga0207711_11277702 Ga0207711_112777021 147
660 3300025972 Ga0207668_10049380 Ga0207668_100493801 147
661 3300026023 Ga0207677_10468657 Ga0207677_104686572 147
662 3300026035 Ga0207703_10184501 Ga0207703_101845012 147
663 3300026075 Ga0207708_10091229 Ga0207708_100912292 147
664 3300026089 Ga0207648_10057452 Ga0207648_100574523 147
665 3300026089 Ga0207648_10881518 Ga0207648_108815182 147
666 3300026116 Ga0207674_10062222 Ga0207674_100622221 147
667 3300026118 Ga0207675_100048433 Ga0207675_1000484332 147
668 3300026118 Ga0207675_100061265 Ga0207675_1000612653 147
669 3300028380 Ga0268265_10019315 Ga0268265_100193154 147
670 3300028380 Ga0268265_10043652 Ga0268265_100436522 147
671 3300028380 Ga0268265_10411584 Ga0268265_104115842 147
672 3300028380 Ga0268265_11214484 Ga0268265_112144841 147
673 3300028381 Ga0268264_10103080 Ga0268264_101030802 147
674 3300028381 Ga0268264_10205267 Ga0268264_102052671 147
675 3300036401 Ga0373937_0649532 Ga0373937_0649532_502_948 147
676 3300046462 Ga0495651_0187952 Ga0495651_0187952_169_615 147
677 3300046615 Ga0495656_0636511 Ga0495656_0636511_60_524 147
678 3300046642 Ga0495634_0151009 Ga0495634_0151009_106_564 147
679 3300048907 Ga0496104_0501925 Ga0496104_0501925_369_812 147
680 3300048907 Ga0496104_0936194 Ga0496104_0936194_226_684 147
681 3300048908 Ga0496105_0853802 Ga0496105_0853802_198_641 147
682 3300048912 Ga0496109_0991075 Ga0496109_0991075_35_478 147
683 3300048915 Ga0496112_0356814 Ga0496112_0356814_65_508 147
684 3300050508 nmdc:mga09592_1391206_c1 nmdc:mga09592_1391206_c1_85_540 147
685 3300050510 nmdc:mga06r32_299855_c1 nmdc:mga06r32_299855_c1_825_1280 147
686 3300050512 nmdc:mga0n895_278071_c1 nmdc:mga0n895_278071_c1_144_602 147
687 3300050512 nmdc:mga0n895_569327_c1 nmdc:mga0n895_569327_c1_654_1127 147
688 3300050513 nmdc:mga0rr50_110142_c1 nmdc:mga0rr50_110142_c1_297_770 147
689 3300050515 nmdc:mga0a205_534994_c1 nmdc:mga0a205_534994_c1_12_485 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

88

161

0.92

PF12973

Cupin_7

ChrR Cupin-like domain

55

167

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9197 57 132
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9179 57 135
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.9049 57 136
1o4t-assembly1.cif.gz_B crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution 0.8938 59 132
3c3v-assembly1.cif.gz_A crystal structure of peanut major allergen ara h 3 0.8904 57 132
ID Description Score Start End Superfamily
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9197 57 132 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9012 57 135 2.60.120.10
1o4tB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8938 59 132 2.60.120.10
af_A1YQH2_38_212_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8856 57 132 2.60.120.10
5cu1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8847 57 144 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q2XCV7-F1-model_v4 Cupin domain-containing protein 0.9552 54 147
AF-A0A255R774-F1-model_v4 Cupin type-2 domain-containing protein 0.9537 55 147
AF-L8MH88-F1-model_v4 deleted 0.9533 57 147
AF-A0A0N9XF37-F1-model_v4 Cupin type-2 domain-containing protein 0.9498 54 147
AF-K2SC26-F1-model_v4 Cupin RmlC-type 0.9487 53 137

Feature Viewer

pLDDT pTM Quality
86.3 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map