F475395

General Info

Members Datasets Scaffolds Average Seq Length
689 370 1378 335

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10016942|Ga0307413_100169423
Length 340
Sequence MYGNDFTPPEPGASAPPPAPADVEPGFEDFWRIIGADGRIEPRDAMPDDYRASLVRQISQHAHSEIIGMQPEGNWISRAPSLRRKAILMAKVQDEAGHGLYLYAAAETLGADRADLLDMLHDGRQKYSSIFNYPTLTWADIGAIGWLVDGAAIVNQVPLCRCSYGPYARAMIRVCKEESFHQRQGFEALYTLSHGTEAQKAMAQDAVNRWWWPSLMMFGPHDSGEAATQGHTAKSMAWGVKRFSNDDLRQRFVDMTVPQAEALGLTLPDPDIAWNEERGHYDFGEIDFAELFEVIKGNGPCNRQRMAHRRRAHEDGAWVREAAAAYADKQEARRTAEAVA

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
155 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
314 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
315 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
316 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
317 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 2501939600 Micromonospora sp. L5 Isolate Unclassified
321 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
322 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
323 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
324 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
325 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
326 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
327 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
328 2643221696 Nocardioides sp. Root140 Isolate Unclassified
329 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
330 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
331 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
332 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
333 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
334 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
335 2855683550 Micromonospora sp. RP3T Isolate Unclassified
336 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
337 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
338 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
339 2858868258 Micromonospora sp. MH33 Isolate Unclassified
340 2858882152 Micromonospora noduli MED15 Isolate Nodule
341 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
342 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
343 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
344 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
345 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
346 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
347 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
348 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
349 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
350 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
351 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
352 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
353 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
354 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
355 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
356 2902582711 Micromonospora sp. AP08 Isolate Unclassified
357 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
358 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
359 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
360 649633069 Micromonospora sp. L5 Isolate Unclassified
361 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
362 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
363 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
364 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
365 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
366 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
367 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
368 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
369 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
370 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.73
Metatranscriptomes 0.87
Isolates 7.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.56
Nodule 1.16
Rhizoplane 6.39
Rhizosphere 74.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10016942 3300031824 Bacteria 3783
2 JGI25152J39213_1011092 3300002773 Bacteria 2014
3 JGI25150J39212_1003962 3300002774 Bacteria 3372
4 JGI25406J46586_10001822 3300003203 Bacteria 9999
5 Ga0055538_1000038 3300003751 Bacteria 186588
6 Ga0055539_1000049 3300003752 Bacteria 186588
7 Ga0055533_1000060 3300003756 Bacteria 186588
8 Ga0055525_1000068 3300003759 Bacteria 186588
9 Ga0055529_1000327 3300003763 Bacteria 53426
10 Ga0055526_1003505 3300003771 Bacteria 9921
11 Ga0055526_1009156 3300003771 Bacteria 4813
12 Ga0055524_1003617 3300003775 Bacteria 7443
13 Ga0055524_1008057 3300003775 Bacteria 4408
14 Ga0055536_1000158 3300003781 Bacteria 58733
15 Ga0055534_1001061 3300003784 Bacteria 11910
16 Ga0055534_1002288 3300003784 Bacteria 6729
17 Ga0055534_1004482 3300003784 Bacteria 4033
18 Ga0055530_10014278 3300003791 Bacteria 2656
19 Ga0055531_10017367 3300003794 Bacteria 3042
20 Ga0055541_1000036 3300003841 Bacteria 186588
21 Ga0070658_10002882 3300005327 Bacteria 14280
22 Ga0070658_10044781 3300005327 Bacteria 3577
23 Ga0070658_10045928 3300005327 Bacteria 3534
24 Ga0070658_10368516 3300005327 Bacteria 1231
25 Ga0070683_100002186 3300005329 Bacteria 15469
26 Ga0070683_100005477 3300005329 Bacteria 10604
27 Ga0070683_100232432 3300005329 Bacteria 1753
28 Ga0070683_100250651 3300005329 Bacteria 1684
29 Ga0070680_100001900 3300005336 Bacteria 15332
30 Ga0070680_100207707 3300005336 Bacteria 1652
31 Ga0070682_100028609 3300005337 Bacteria 3353
32 Ga0070682_100063795 3300005337 Bacteria 2337
33 Ga0070682_100120917 3300005337 Bacteria 1758
34 Ga0070682_100124077 3300005337 Bacteria 1738
35 Ga0068868_100022788 3300005338 Bacteria 4732
36 Ga0070660_100029776 3300005339 Bacteria 4094
37 Ga0070661_100075067 3300005344 Bacteria 2491
38 Ga0070661_100144009 3300005344 Bacteria 1798
39 Ga0070675_100001010 3300005354 Bacteria 20207
40 Ga0070713_100034995 3300005436 Bacteria 4041
41 Ga0070713_100231106 3300005436 Bacteria 1681
42 Ga0070700_100008902 3300005441 Bacteria 5489
43 Ga0070700_100227583 3300005441 Bacteria 1325
44 Ga0070678_100028160 3300005456 Bacteria 3827
45 Ga0070678_100209900 3300005456 Bacteria 1613
46 Ga0070662_100074773 3300005457 Bacteria 2507
47 Ga0070681_10064932 3300005458 Bacteria 3620
48 Ga0068867_100334548 3300005459 Bacteria 1259
49 Ga0070706_100419304 3300005467 Bacteria 1246
50 Ga0070679_100001465 3300005530 Bacteria 20923
51 Ga0070679_100020128 3300005530 Bacteria 6502
52 Ga0070679_100160254 3300005530 Bacteria 2224
53 Ga0070679_100276995 3300005530 Bacteria 1631
54 Ga0070679_100303247 3300005530 Bacteria 1548
55 Ga0070684_100006208 3300005535 Bacteria 9222
56 Ga0070684_100055578 3300005535 Bacteria 3452
57 Ga0070684_100173339 3300005535 Bacteria 1960
58 Ga0070684_100321736 3300005535 Bacteria 1421
59 Ga0068853_100030326 3300005539 Bacteria 4567
60 Ga0068853_100043763 3300005539 Bacteria 3830
61 Ga0070665_100000865 3300005548 Bacteria 39234
62 Ga0070665_100029570 3300005548 Bacteria 5514
63 Ga0070665_100054466 3300005548 Bacteria 4012
64 Ga0068855_100000702 3300005563 Bacteria 40994
65 Ga0068855_100009832 3300005563 Bacteria 11540
66 Ga0068855_100127436 3300005563 Bacteria 2909
67 Ga0068855_100204924 3300005563 Bacteria 2219
68 Ga0070664_100004502 3300005564 Bacteria 11178
69 Ga0070664_100110615 3300005564 Bacteria 2397
70 Ga0070664_100223379 3300005564 Bacteria 1686
71 Ga0068857_100009930 3300005577 Bacteria 8262
72 Ga0068857_100209937 3300005577 Bacteria 1776
73 Ga0068856_100038638 3300005614 Bacteria 4686
74 Ga0068856_100114180 3300005614 Bacteria 2700
75 Ga0068856_100130494 3300005614 Bacteria 2518
76 Ga0068852_100050712 3300005616 Bacteria 3558
77 Ga0068859_100018309 3300005617 Bacteria 7042
78 Ga0068859_100055178 3300005617 Bacteria 3998
79 Ga0068864_100013469 3300005618 Bacteria 6780
80 Ga0068864_100265609 3300005618 Bacteria 1597
81 Ga0068861_100215782 3300005719 Bacteria 1619
82 Ga0068851_10047182 3300005834 Bacteria 2181
83 Ga0068863_100027637 3300005841 Bacteria 5413
84 Ga0068863_100214286 3300005841 Bacteria 1855
85 Ga0068858_100053400 3300005842 Bacteria 3738
86 Ga0068860_100000887 3300005843 Bacteria 33240
87 Ga0068860_100203241 3300005843 Bacteria 1920
88 Ga0068862_100021800 3300005844 Bacteria 5357
89 Ga0081540_1032264 3300005983 Bacteria 2863
90 Ga0081539_10000763 3300005985 Bacteria 63498
91 Ga0070717_10263643 3300006028 Bacteria 1525
92 Ga0075432_10004280 3300006058 Bacteria 4862
93 Ga0075370_10041858 3300006353 Bacteria 2587
94 Ga0075428_100001393 3300006844 Bacteria 25721
95 Ga0075428_100010162 3300006844 Bacteria 10453
96 Ga0075428_100518620 3300006844 Bacteria 1275
97 Ga0075430_100001384 3300006846 Bacteria 19697
98 Ga0075430_100260718 3300006846 Bacteria 1435
99 Ga0075431_100020558 3300006847 Bacteria 6745
100 Ga0075431_100021768 3300006847 Bacteria 6555
101 Ga0075431_100028431 3300006847 Bacteria 5746
102 Ga0075431_100423192 3300006847 Bacteria 1331
103 Ga0075429_100013581 3300006880 Bacteria 7063
104 Ga0068865_100059809 3300006881 Bacteria 2666
105 Ga0068865_100142497 3300006881 Bacteria 1809
106 Ga0097620_100018309 3300006931 Bacteria 7042
107 Ga0097620_100055179 3300006931 Bacteria 3998
108 Ga0079104_1033629 3300006946 Bacteria 1253
109 Ga0105244_10000262 3300009036 Bacteria 53246
110 Ga0105244_10013617 3300009036 Bacteria 4742
111 Ga0105244_10116087 3300009036 Bacteria 1299
112 Ga0105240_10001742 3300009093 Bacteria 36760
113 Ga0105240_10003623 3300009093 Bacteria 23921
114 Ga0105240_10033920 3300009093 Bacteria 6590
115 Ga0105240_10037077 3300009093 Bacteria 6267
116 Ga0105240_10539225 3300009093 Bacteria 1292
117 Ga0111539_10002724 3300009094 Bacteria 23442
118 Ga0105245_10004166 3300009098 Bacteria 12841
119 Ga0105247_10228623 3300009101 Bacteria 1262
120 Ga0114129_10000852 3300009147 Bacteria 39505
121 Ga0114129_10001140 3300009147 Bacteria 35156
122 Ga0114129_10001724 3300009147 Bacteria 29818
123 Ga0114129_10003177 3300009147 Bacteria 23053
124 Ga0105242_10135622 3300009176 Bacteria 2130
125 Ga0105248_10016623 3300009177 Bacteria 8100
126 Ga0105248_10045540 3300009177 Bacteria 4919
127 Ga0105248_10222155 3300009177 Bacteria 2127
128 Ga0105248_10467876 3300009177 Bacteria 1421
129 Ga0105237_10005296 3300009545 Bacteria 14588
130 Ga0105238_10000037 3300009551 Bacteria 163954
131 Ga0105238_10002180 3300009551 Bacteria 19777
132 Ga0105238_10161857 3300009551 Bacteria 2214
133 Ga0105238_10314460 3300009551 Bacteria 1551
134 Ga0105238_10540579 3300009551 Bacteria 1169
135 Ga0105238_10593835 3300009551 Bacteria 1115
136 Ga0105239_10003785 3300010375 Bacteria 18414
137 Ga0105239_10014616 3300010375 Bacteria 8709
138 Ga0105246_10003879 3300011119 Bacteria 9062
139 Ga0105246_10167436 3300011119 Bacteria 1680
140 Ga0157370_10004051 3300013104 Bacteria 17008
141 Ga0157370_10054731 3300013104 Bacteria 3803
142 Ga0157369_10040901 3300013105 Bacteria 5059
143 Ga0157369_10258237 3300013105 Bacteria 1817
144 Ga0163162_10011167 3300013306 Bacteria 8749
145 Ga0163162_10046206 3300013306 Bacteria 4364
146 Ga0163163_10007481 3300014325 Bacteria 9638
147 Ga0163163_10047694 3300014325 Bacteria 4211
148 Ga0163163_10339296 3300014325 Bacteria 1558
149 Ga0182008_10047678 3300014497 Bacteria 2129
150 Ga0157379_10051719 3300014968 Bacteria 3669
151 Ga0157379_10054024 3300014968 Bacteria 3589
152 Ga0157379_10059252 3300014968 Bacteria 3423
153 Ga0157379_10086822 3300014968 Bacteria 2805
154 Ga0157379_10230821 3300014968 Bacteria 1677
155 Ga0157376_10046816 3300014969 Bacteria 3569
156 Ga0182006_1000055 3300015261 Bacteria 173139
157 Ga0182005_1000003 3300015265 Bacteria 683269
158 Ga0206351_10378959 3300020077 Bacteria 1646
159 Ga0206350_10945359 3300020080 Bacteria 2061
160 Ga0206354_11044102 3300020081 Bacteria 1869
161 Ga0206353_11737339 3300020082 Bacteria 1613
162 Ga0213872_10000135 3300021361 Bacteria 67262
163 Ga0213872_10000523 3300021361 Bacteria 30011
164 Ga0213872_10037956 3300021361 Bacteria 2199
165 Ga0213872_10127881 3300021361 Bacteria 1120
166 Ga0213872_10128654 3300021361 Bacteria 1116
167 Ga0213876_10065844 3300021384 Bacteria 1912
168 Ga0224712_10002724 3300022467 Bacteria 4435
169 Ga0224712_10003072 3300022467 Bacteria 4262
170 Ga0209436_100364 3300025208 Bacteria 20479
171 Ga0209784_100021 3300025224 Bacteria 408534
172 Ga0209566_100039 3300025225 Bacteria 303368
173 Ga0209674_100036 3300025226 Bacteria 408534
174 Ga0209563_100040 3300025230 Bacteria 408534
175 Ga0207425_1000006 3300025245 Bacteria 808854
176 Ga0207425_1000062 3300025245 Bacteria 136118
177 Ga0207425_1000764 3300025245 Bacteria 16618
178 Ga0209677_100023 3300025253 Bacteria 408534
179 Ga0209129_1000009 3300025258 Bacteria 633100
180 Ga0209565_1001289 3300025263 Bacteria 11619
181 Ga0209565_1001724 3300025263 Bacteria 8947
182 Ga0209565_1005512 3300025263 Bacteria 3664
183 Ga0209565_1005826 3300025263 Bacteria 3536
184 Ga0209455_1000051 3300025272 Bacteria 369818
185 Ga0209673_1008943 3300025273 Bacteria 4400
186 Ga0209130_1001651 3300025284 Bacteria 13643
187 Ga0209675_1000065 3300025291 Bacteria 174791
188 Ga0209675_1001178 3300025291 Bacteria 15857
189 Ga0209676_1000044 3300025292 Bacteria 416215
190 Ga0209025_1000147 3300025294 Bacteria 180008
191 Ga0209025_1005972 3300025294 Bacteria 9676
192 Ga0209564_1000080 3300025295 Bacteria 263547
193 Ga0209564_1000087 3300025295 Bacteria 250787
194 Ga0209564_1002792 3300025295 Bacteria 13031
195 Ga0209758_1000047 3300025297 Bacteria 360971
196 Ga0209050_1000064 3300025298 Bacteria 314803
197 Ga0209050_1000171 3300025298 Bacteria 150524
198 Ga0209256_1000013 3300025299 Bacteria 689442
199 Ga0209256_1000376 3300025299 Bacteria 71561
200 Ga0209256_1001366 3300025299 Bacteria 25671
201 Ga0209256_1005606 3300025299 Bacteria 7130
202 Ga0207426_1002831 3300025302 Bacteria 10334
203 Ga0209257_1000010 3300025304 Bacteria 1158682
204 Ga0209257_1000998 3300025304 Bacteria 38347
205 Ga0207655_1009662 3300025728 Bacteria 5959
206 Ga0207647_10012942 3300025904 Bacteria 5798
207 Ga0207647_10034671 3300025904 Bacteria 3220
208 Ga0207645_10083574 3300025907 Bacteria 2048
209 Ga0207705_10031911 3300025909 Bacteria 3763
210 Ga0207705_10043065 3300025909 Bacteria 3242
211 Ga0207705_10162532 3300025909 Bacteria 1678
212 Ga0207684_10352549 3300025910 Bacteria 1267
213 Ga0207707_10000755 3300025912 Bacteria 31867
214 Ga0207695_10003945 3300025913 Bacteria 20511
215 Ga0207695_10004040 3300025913 Bacteria 20187
216 Ga0207695_10015369 3300025913 Bacteria 9012
217 Ga0207695_10037963 3300025913 Bacteria 5192
218 Ga0207695_10047179 3300025913 Bacteria 4561
219 Ga0207695_10080957 3300025913 Bacteria 3288
220 Ga0207671_10029678 3300025914 Bacteria 4082
221 Ga0207671_10367963 3300025914 Bacteria 1141
222 Ga0207660_10047499 3300025917 Bacteria 3035
223 Ga0207657_10038635 3300025919 Bacteria 4248
224 Ga0207657_10081985 3300025919 Bacteria 2708
225 Ga0207657_10122757 3300025919 Bacteria 2136
226 Ga0207649_10158196 3300025920 Bacteria 1567
227 Ga0207649_10170337 3300025920 Bacteria 1516
228 Ga0207652_10000446 3300025921 Bacteria 42611
229 Ga0207652_10198746 3300025921 Bacteria 1804
230 Ga0207652_10257890 3300025921 Bacteria 1573
231 Ga0207694_10000054 3300025924 Bacteria 152124
232 Ga0207694_10004016 3300025924 Bacteria 11588
233 Ga0207694_10135515 3300025924 Bacteria 1977
234 Ga0207694_10265106 3300025924 Bacteria 1408
235 Ga0207694_10337107 3300025924 Bacteria 1246
236 Ga0207659_10015546 3300025926 Bacteria 4935
237 Ga0207687_10022961 3300025927 Bacteria 4153
238 Ga0207700_10063766 3300025928 Bacteria 2804
239 Ga0207700_10208318 3300025928 Bacteria 1651
240 Ga0207700_10330571 3300025928 Bacteria 1323
241 Ga0207686_10062351 3300025934 Bacteria 2367
242 Ga0207704_10043074 3300025938 Bacteria 2662
243 Ga0207711_10145759 3300025941 Bacteria 2133
244 Ga0207711_10172352 3300025941 Bacteria 1964
245 Ga0207689_10002995 3300025942 Bacteria 15578
246 Ga0207661_10003752 3300025944 Bacteria 10583
247 Ga0207661_10235410 3300025944 Bacteria 1623
248 Ga0207679_10006186 3300025945 Bacteria 7557
249 Ga0207667_10000043 3300025949 Bacteria 261426
250 Ga0207667_10002611 3300025949 Bacteria 22344
251 Ga0207667_10067508 3300025949 Bacteria 3725
252 Ga0207667_10209694 3300025949 Bacteria 1997
253 Ga0207668_10149910 3300025972 Bacteria 1804
254 Ga0207640_10002069 3300025981 Bacteria 10813
255 Ga0207677_10020664 3300026023 Bacteria 4003
256 Ga0207703_10092146 3300026035 Bacteria 2550
257 Ga0207703_10128986 3300026035 Bacteria 2181
258 Ga0207639_10091560 3300026041 Bacteria 2435
259 Ga0207639_10162980 3300026041 Bacteria 1881
260 Ga0207708_10006164 3300026075 Bacteria 8888
261 Ga0207702_10375743 3300026078 Bacteria 1366
262 Ga0207641_10003017 3300026088 Bacteria 15187
263 Ga0207648_10110349 3300026089 Bacteria 2415
264 Ga0207648_10221797 3300026089 Bacteria 1680
265 Ga0207676_10008379 3300026095 Bacteria 7348
266 Ga0207676_10251000 3300026095 Bacteria 1592
267 Ga0207674_10007418 3300026116 Bacteria 12779
268 Ga0207674_10009443 3300026116 Bacteria 11145
269 Ga0207674_10097428 3300026116 Bacteria 2925
270 Ga0207674_10115213 3300026116 Bacteria 2659
271 Ga0207675_100034358 3300026118 Bacteria 4727
272 Ga0207683_10029092 3300026121 Bacteria 4782
273 Ga0207683_10169716 3300026121 Bacteria 1976
274 Ga0207683_10173090 3300026121 Bacteria 1956
275 Ga0207698_10051691 3300026142 Bacteria 3143
276 Ga0207428_10174979 3300027907 Bacteria 1624
277 Ga0268266_10001168 3300028379 Bacteria 32486
278 Ga0268266_10013240 3300028379 Bacteria 7111
279 Ga0268266_10122867 3300028379 Bacteria 2312
280 Ga0268266_10127663 3300028379 Bacteria 2271
281 Ga0268265_10014154 3300028380 Bacteria 5437
282 Ga0268264_10000373 3300028381 Bacteria 65793
283 Ga0265334_10028936 3300028573 Bacteria 2222
284 Ga0307515_10000150 3300028794 Bacteria 169644
285 Ga0307515_10000471 3300028794 Bacteria 96225
286 Ga0307511_10021653 3300030521 Bacteria 6042
287 Ga0316180_1179088 3300030736 Bacteria 2511
288 Ga0316182_1141376 3300030745 Bacteria 1655
289 Ga0265316_10119334 3300031344 Bacteria 1992
290 Ga0307513_10000038 3300031456 Bacteria 174780
291 Ga0307513_10038776 3300031456 Bacteria 5287
292 Ga0307513_10112093 3300031456 Bacteria 2719
293 Ga0307513_10196689 3300031456 Bacteria 1862
294 Ga0307513_10287952 3300031456 Bacteria 1416
295 Ga0307509_10000001 3300031507 Bacteria 629324
296 Ga0307408_100003439 3300031548 Bacteria 10834
297 Ga0307408_100263157 3300031548 Bacteria 1428
298 Ga0307508_10107257 3300031616 Bacteria 2392
299 Ga0307508_10216942 3300031616 Bacteria 1513
300 Ga0307514_10001386 3300031649 Bacteria 30330
301 Ga0307405_10001384 3300031731 Bacteria 10175
302 Ga0307413_10034920 3300031824 Bacteria 2879
303 Ga0307518_10202009 3300031838 Bacteria 1319
304 Ga0307410_10017908 3300031852 Bacteria 4267
305 Ga0307410_10028858 3300031852 Bacteria 3525
306 Ga0307406_10008234 3300031901 Bacteria 5812
307 Ga0307407_10004078 3300031903 Bacteria 6138
308 Ga0307407_10047888 3300031903 Bacteria 2429
309 Ga0307409_100000409 3300031995 Bacteria 18204
310 Ga0307409_100040103 3300031995 Bacteria 3482
311 Ga0307409_100341407 3300031995 Bacteria 1409
312 Ga0307409_100384114 3300031995 Bacteria 1336
313 Ga0307416_100000277 3300032002 Bacteria 27066
314 Ga0307416_100017585 3300032002 Bacteria 5008
315 Ga0307416_100653574 3300032002 Bacteria 1136
316 Ga0307411_10072572 3300032005 Bacteria 2338
317 Ga0307415_100000021 3300032126 Bacteria 67460
318 Ga0307415_100029500 3300032126 Bacteria 3507
319 Ga0307415_100035799 3300032126 Bacteria 3246
320 Ga0307415_100089534 3300032126 Bacteria 2223
321 Ga0307415_100167619 3300032126 Bacteria 1709
322 Ga0307510_10000015 3300033180 Bacteria 258937
323 Ga0307510_10068821 3300033180 Bacteria 3549
324 Ga0395899_0030670 3300037312 Bacteria 4043
325 Ga0395899_0104288 3300037312 Bacteria 2043
326 Ga0395900_0012381 3300037418 Bacteria 8727
327 Ga0395900_0045239 3300037418 Bacteria 4534
328 Ga0395898_0000023 3300037466 Bacteria 379477
329 Ga0395898_0002237 3300037466 Bacteria 23535
330 Ga0395898_0236371 3300037466 Bacteria 1742
331 Ga0395898_0549604 3300037466 Bacteria 1097
332 Ga0395905_0021857 3300037471 Bacteria 6050
333 Ga0395905_0107885 3300037471 Bacteria 2614
334 Ga0395905_0152771 3300037471 Bacteria 2171
335 Ga0395905_0192008 3300037471 Bacteria 1915
336 Ga0395905_0330566 3300037471 Bacteria 1414
337 Ga0436364_1294156 3300037853 Bacteria 4915
338 Ga0395901_0006877 3300038443 Bacteria 11491
339 Ga0395901_0119876 3300038443 Bacteria 2764
340 Ga0436365_1607053 3300039437 Bacteria 47115
341 Ga0436361_0052332 3300039447 Bacteria 6023
342 Ga0436361_0304034 3300039447 Bacteria 5566
343 Ga0451793_1669292 3300041452 Bacteria 8075
344 Ga0451797_0468990 3300041453 Bacteria 5683
345 Ga0451841_0749764 3300041498 Bacteria 3339
346 Ga0466961_0012402 3300044693 Bacteria 5451
347 Ga0466971_0008173 3300044719 Bacteria 4560
348 Ga0466970_0045460 3300044765 Bacteria 2338
349 Ga0466957_0052743 3300044842 Bacteria 2477
350 Ga0466960_0017790 3300044901 Bacteria 3106
351 Ga0466959_0053621 3300045049 Bacteria 2947
352 Ga0466967_0031186 3300045976 Bacteria 4484
353 Ga0466967_0066294 3300045976 Bacteria 3216
354 Ga0466967_0171515 3300045976 Bacteria 2041
355 Ga0495617_000002 3300046452 Bacteria 710121
356 Ga0495627_000066 3300046453 Bacteria 130363
357 Ga0495627_000176 3300046453 Bacteria 72651
358 Ga0495603_0208618 3300046455 Bacteria 1128
359 Ga0495590_0000044 3300046457 Bacteria 119833
360 Ga0495591_000052 3300046458 Bacteria 136101
361 Ga0495629_0169395 3300046459 Bacteria 1516
362 Ga0495651_0003057 3300046462 Bacteria 12913
363 Ga0495653_0004013 3300046463 Bacteria 11888
364 Ga0495653_0010057 3300046463 Bacteria 7738
365 Ga0495650_0079675 3300046471 Bacteria 1266
366 Ga0495582_0041560 3300046473 Bacteria 2533
367 Ga0495605_0000081 3300046474 Bacteria 125302
368 Ga0495605_0000087 3300046474 Bacteria 120256
369 Ga0495605_0036051 3300046474 Bacteria 2496
370 Ga0495605_0046951 3300046474 Bacteria 2120
371 Ga0495584_0000224 3300046491 Bacteria 40823
372 Ga0495585_0000078 3300046492 Bacteria 100168
373 Ga0495585_0002037 3300046492 Bacteria 14921
374 Ga0495585_0010860 3300046492 Bacteria 5410
375 Ga0495585_0012734 3300046492 Bacteria 4950
376 Ga0495585_0052334 3300046492 Bacteria 2260
377 Ga0495594_0002438 3300046499 Bacteria 9687
378 Ga0495596_0003233 3300046500 Bacteria 8341
379 Ga0495596_0003471 3300046500 Bacteria 7959
380 Ga0495596_0005404 3300046500 Bacteria 6043
381 Ga0495596_0005921 3300046500 Bacteria 5703
382 Ga0495596_0009336 3300046500 Bacteria 4316
383 Ga0495596_0031361 3300046500 Bacteria 2123
384 Ga0495607_0000658 3300046501 Bacteria 33578
385 Ga0495607_0001173 3300046501 Bacteria 23719
386 Ga0495607_0001229 3300046501 Bacteria 23009
387 Ga0495607_0016104 3300046501 Bacteria 4829
388 Ga0495607_0020020 3300046501 Bacteria 4237
389 Ga0495607_0024098 3300046501 Bacteria 3798
390 Ga0495607_0036322 3300046501 Bacteria 2969
391 Ga0495583_0000241 3300046506 Bacteria 90735
392 Ga0495583_0003098 3300046506 Bacteria 13147
393 Ga0495583_0004796 3300046506 Bacteria 9483
394 Ga0495583_0011809 3300046506 Bacteria 4992
395 Ga0495583_0019804 3300046506 Bacteria 3503
396 Ga0495606_0000280 3300046507 Bacteria 88619
397 Ga0495606_0002926 3300046507 Bacteria 18862
398 Ga0495608_0051727 3300046511 Bacteria 2721
399 Ga0495610_0000493 3300046512 Bacteria 40287
400 Ga0495610_0001546 3300046512 Bacteria 20272
401 Ga0495616_0000103 3300046513 Bacteria 73155
402 Ga0495616_0001114 3300046513 Bacteria 19091
403 Ga0495616_0010324 3300046513 Bacteria 5411
404 Ga0495616_0034148 3300046513 Bacteria 2644
405 Ga0495616_0052593 3300046513 Bacteria 2027
406 Ga0495628_0005595 3300046516 Bacteria 11000
407 Ga0495631_0000236 3300046518 Bacteria 37997
408 Ga0495631_0033603 3300046518 Bacteria 2302
409 Ga0495631_0049059 3300046518 Bacteria 1849
410 Ga0495632_0044776 3300046519 Bacteria 2207
411 Ga0495632_0090555 3300046519 Bacteria 1450
412 Ga0495637_0000006 3300046520 Bacteria 435763
413 Ga0495637_0010364 3300046520 Bacteria 4512
414 Ga0495643_0000192 3300046522 Bacteria 96511
415 Ga0495643_0001383 3300046522 Bacteria 22675
416 Ga0495643_0002571 3300046522 Bacteria 14177
417 Ga0495644_0029245 3300046523 Bacteria 2082
418 Ga0495648_0000035 3300046524 Bacteria 196251
419 Ga0495648_0011042 3300046524 Bacteria 6842
420 Ga0495642_0000057 3300046528 Bacteria 66980
421 Ga0495642_0008573 3300046528 Bacteria 3912
422 Ga0495642_0049907 3300046528 Bacteria 1719
423 Ga0495587_0001834 3300046536 Bacteria 14174
424 Ga0495609_0000096 3300046538 Bacteria 104135
425 Ga0495609_0002900 3300046538 Bacteria 10224
426 Ga0495609_0063588 3300046538 Bacteria 1628
427 Ga0495597_0000787 3300046542 Bacteria 25038
428 Ga0495645_0004316 3300046543 Bacteria 9715
429 Ga0495645_0048156 3300046543 Bacteria 3105
430 Ga0495633_0000224 3300046558 Bacteria 70187
431 Ga0495633_0003002 3300046558 Bacteria 11519
432 Ga0495633_0006790 3300046558 Bacteria 6712
433 Ga0495633_0014689 3300046558 Bacteria 4083
434 Ga0495633_0057231 3300046558 Bacteria 1831
435 Ga0495667_0155003 3300046559 Bacteria 1474
436 Ga0495668_0000519 3300046616 Bacteria 47924
437 Ga0495668_0001785 3300046616 Bacteria 19654
438 Ga0495668_0090826 3300046616 Bacteria 1673
439 Ga0495668_0144468 3300046616 Bacteria 1302
440 Ga0495611_0001617 3300046648 Bacteria 10970
441 Ga0495611_0002405 3300046648 Bacteria 8588
442 Ga0495611_0005111 3300046648 Bacteria 5624
443 Ga0495611_0026314 3300046648 Bacteria 2537
444 Ga0495625_0007835 3300046660 Bacteria 9206
445 Ga0495635_0006068 3300046663 Bacteria 8431
446 Ga0495635_0016076 3300046663 Bacteria 5226
447 Ga0495661_0000164 3300046665 Bacteria 78742
448 Ga0495661_0005789 3300046665 Bacteria 8738
449 Ga0495661_0010121 3300046665 Bacteria 6447
450 Ga0495661_0030156 3300046665 Bacteria 3455
451 Ga0495588_0000261 3300046674 Bacteria 42963
452 Ga0495588_0014444 3300046674 Bacteria 3779
453 Ga0495588_0051825 3300046674 Bacteria 2114
454 Ga0495657_0124139 3300046675 Bacteria 1623
455 Ga0495623_0040517 3300046679 Bacteria 2974
456 Ga0495646_0050640 3300046680 Bacteria 2517
457 Ga0495646_0066743 3300046680 Bacteria 2127
458 Ga0495669_0000122 3300046684 Bacteria 50338
459 Ga0495669_0035282 3300046684 Bacteria 2207
460 Ga0495613_0036874 3300046689 Bacteria 3625
461 Ga0495670_0031327 3300046691 Bacteria 2642
462 Ga0495671_0000132 3300046692 Bacteria 67269
463 Ga0495649_0001595 3300046694 Bacteria 16945
464 Ga0495649_0005128 3300046694 Bacteria 8404
465 Ga0495649_0079171 3300046694 Bacteria 1758
466 Ga0495589_0000036 3300046794 Bacteria 153299
467 Ga0495589_0000092 3300046794 Bacteria 85372
468 Ga0495589_0000210 3300046794 Bacteria 49536
469 Ga0495589_0004698 3300046794 Bacteria 7249
470 Ga0495589_0010102 3300046794 Bacteria 4904
471 Ga0495589_0016488 3300046794 Bacteria 3798
472 Ga0495600_0042968 3300046809 Bacteria 2946
473 Ga0495660_0000117 3300046810 Bacteria 85237
474 Ga0495660_0012522 3300046810 Bacteria 4924
475 Ga0495660_0030737 3300046810 Bacteria 3024
476 Ga0495660_0088291 3300046810 Bacteria 1615
477 Ga0495604_0004690 3300047317 Bacteria 10841
478 Ga0495604_0198762 3300047317 Bacteria 1392
479 Ga0495672_0000086 3300047320 Bacteria 155010
480 Ga0495672_0000576 3300047320 Bacteria 41488
481 Ga0495672_0006333 3300047320 Bacteria 9197
482 Ga0495672_0037763 3300047320 Bacteria 2952
483 Ga0495680_0012466 3300047322 Bacteria 7481
484 Ga0495680_0025804 3300047322 Bacteria 4858
485 Ga0495683_0000080 3300047323 Bacteria 95388
486 Ga0495683_0004092 3300047323 Bacteria 8352
487 Ga0495687_000074 3300047443 Bacteria 153464
488 Ga0495687_000154 3300047443 Bacteria 104740
489 Ga0495687_000403 3300047443 Bacteria 53439
490 Ga0495687_002089 3300047443 Bacteria 16789
491 Ga0495677_0000037 3300047445 Bacteria 78595
492 Ga0495677_0002756 3300047445 Bacteria 6858
493 Ga0495677_0002769 3300047445 Bacteria 6836
494 Ga0495677_0011927 3300047445 Bacteria 3172
495 Ga0495677_0096748 3300047445 Bacteria 1115
496 Ga0495679_033288 3300047446 Bacteria 1647
497 Ga0495673_0000135 3300047469 Bacteria 135338
498 Ga0495681_0001633 3300047470 Bacteria 16642
499 Ga0495681_0010158 3300047470 Bacteria 5722
500 Ga0495681_0017119 3300047470 Bacteria 4037
501 Ga0495681_0023566 3300047470 Bacteria 3267
502 Ga0495681_0046317 3300047470 Bacteria 2074
503 Ga0495684_0007844 3300047471 Bacteria 8261
504 Ga0495686_0001199 3300047472 Bacteria 29920
505 Ga0495593_0019068 3300047673 Bacteria 3850
506 Ga0495614_0006138 3300048089 Bacteria 5400
507 Ga0495626_0000006 3300048091 Bacteria 284977
508 Ga0495626_0000454 3300048091 Bacteria 41810
509 Ga0495626_0000663 3300048091 Bacteria 33119
510 Ga0495626_0001808 3300048091 Bacteria 16133
511 Ga0495626_0004944 3300048091 Bacteria 7998
512 Ga0495626_0017541 3300048091 Bacteria 3611
513 Ga0495626_0022868 3300048091 Bacteria 3084
514 Ga0495626_0024611 3300048091 Bacteria 2950
515 Ga0495626_0063411 3300048091 Bacteria 1676
516 Ga0496100_0367087 3300048903 Bacteria 1090
517 Ga0496101_0063748 3300048904 Bacteria 2683
518 Ga0496101_0131003 3300048904 Bacteria 1904
519 Ga0496102_0000152 3300048905 Bacteria 94042
520 Ga0496102_0036573 3300048905 Bacteria 4424
521 Ga0496102_0043029 3300048905 Bacteria 4094
522 Ga0496102_0064768 3300048905 Bacteria 3348
523 Ga0496102_0175080 3300048905 Bacteria 2020
524 Ga0496103_0085400 3300048906 Bacteria 1989
525 Ga0496104_0003816 3300048907 Bacteria 13039
526 Ga0496105_0001511 3300048908 Bacteria 16442
527 Ga0496105_0017804 3300048908 Bacteria 5700
528 Ga0496106_0056792 3300048909 Bacteria 2959
529 Ga0496106_0124279 3300048909 Bacteria 2019
530 Ga0496108_0023071 3300048911 Bacteria 5119
531 Ga0496108_0078825 3300048911 Bacteria 2788
532 Ga0496108_0122020 3300048911 Bacteria 2236
533 Ga0496109_0001861 3300048912 Bacteria 17481
534 Ga0496109_0011804 3300048912 Bacteria 7520
535 Ga0496109_0017144 3300048912 Bacteria 6341
536 Ga0496109_0026349 3300048912 Bacteria 5184
537 Ga0496109_0197578 3300048912 Bacteria 1891
538 Ga0496110_0002113 3300048913 Bacteria 14834
539 Ga0496110_0006953 3300048913 Bacteria 8999
540 Ga0496111_0003704 3300048914 Bacteria 9504
541 Ga0496112_0017239 3300048915 Bacteria 6781
542 Ga0496112_0020107 3300048915 Bacteria 6320
543 Ga0496112_0091218 3300048915 Bacteria 3016
544 Ga0496112_0109627 3300048915 Bacteria 2731
545 Ga0496112_0254214 3300048915 Bacteria 1707
546 Ga0496112_0356315 3300048915 Bacteria 1405
547 Ga0496113_0004194 3300048916 Bacteria 8809
548 Ga0496113_0004884 3300048916 Bacteria 8303
549 Ga0496113_0280595 3300048916 Bacteria 1332
550 Ga0496114_0000705 3300048917 Bacteria 24945
551 Ga0496114_0057994 3300048917 Bacteria 3233
552 Ga0496114_0092346 3300048917 Bacteria 2572
553 Ga0496114_0097382 3300048917 Bacteria 2506
554 Ga0496114_0110897 3300048917 Bacteria 2350
555 Ga0496115_0001802 3300048918 Bacteria 15343
556 Ga0496115_0110253 3300048918 Bacteria 2261
557 Ga0496115_0167592 3300048918 Bacteria 1816
558 Ga0496117_0094087 3300048920 Bacteria 1920
559 Ga0496119_0000983 3300048922 Bacteria 36653
560 Ga0496119_0024910 3300048922 Bacteria 4193
561 Ga0496120_0000199 3300048923 Bacteria 103142
562 Ga0496120_0016999 3300048923 Bacteria 4732
563 Ga0496121_0120887 3300048924 Bacteria 1978
564 Ga0496122_0000942 3300048925 Bacteria 52834
565 Ga0496123_0000819 3300048926 Bacteria 50058
566 Ga0496125_0009738 3300048928 Bacteria 9808
567 Ga0496125_0052790 3300048928 Bacteria 3340
568 Ga0496126_0090471 3300048929 Bacteria 2693
569 Ga0496126_0111411 3300048929 Bacteria 2383
570 Ga0496126_0133539 3300048929 Bacteria 2143
571 Ga0496126_0137156 3300048929 Bacteria 2109
572 Ga0495678_000001 3300049459 Bacteria 1060340
573 Ga0495678_000064 3300049459 Bacteria 138380
574 Ga0495678_017367 3300049459 Bacteria 3263
575 Ga0501031_0003050 3300049568 Bacteria 10709
576 Ga0501032_0028140 3300049569 Bacteria 3862
577 Ga0501036_0000495 3300049572 Bacteria 28158
578 Ga0501036_0002673 3300049572 Bacteria 14064
579 Ga0501037_0023315 3300049573 Bacteria 4577
580 Ga0501038_0011685 3300049574 Bacteria 8009
581 Ga0501038_0028409 3300049574 Bacteria 4970
582 Ga0501038_0076577 3300049574 Bacteria 2825
583 Ga0501039_0008327 3300049575 Bacteria 7900
584 Ga0501040_0000566 3300049576 Bacteria 22462
585 Ga0501041_0004948 3300049577 Bacteria 7748
586 Ga0501041_0129048 3300049577 Bacteria 1575
587 Ga0501042_0007588 3300049578 Bacteria 7116
588 Ga0501042_0081715 3300049578 Bacteria 2316
589 Ga0501043_0086942 3300049579 Bacteria 2457
590 Ga0501046_0086462 3300049580 Bacteria 2417
591 Ga0501046_0095494 3300049580 Bacteria 2284
592 Ga0501047_0208297 3300049581 Bacteria 1814
593 Ga0501047_0413449 3300049581 Bacteria 1181
594 Ga0501048_0009251 3300049582 Bacteria 7403
595 Ga0501067_0171012 3300049583 Bacteria 1210
596 Ga0501068_0010239 3300049584 Bacteria 5262
597 Ga0501070_0248634 3300049586 Bacteria 1455
598 Ga0501071_0004571 3300049587 Bacteria 8778
599 Ga0501071_0016791 3300049587 Bacteria 5035
600 Ga0501072_0000706 3300049588 Bacteria 24232
601 Ga0501075_0001787 3300049591 Bacteria 14152
602 Ga0501076_0000886 3300049592 Bacteria 19467
603 Ga0501076_0009876 3300049592 Bacteria 7055
604 Ga0501077_0012713 3300049593 Bacteria 5272
605 Ga0501079_0000643 3300049741 Bacteria 23261
606 Ga0501081_0018537 3300049743 Bacteria 4624
607 Ga0501044_0240444 3300049823 Bacteria 1754
608 Ga0501045_0007342 3300049824 Bacteria 7663
609 Ga0501045_0122118 3300049824 Bacteria 1934
610 Ga0501045_0232925 3300049824 Bacteria 1371
611 nmdc:mga05p37_170649_c1 3300050507 Bacteria 2653
612 nmdc:mga05p37_2735_c1 3300050507 Bacteria 20505
613 nmdc:mga05p37_31145_c1 3300050507 Bacteria 6515
614 nmdc:mga05p37_322880_c1 3300050507 Bacteria 1826
615 nmdc:mga05p37_36054_c1 3300050507 Bacteria 6069
616 nmdc:mga09592_63062_c1 3300050508 Bacteria 3136
617 nmdc:mga09592_73624_c1 3300050508 Bacteria 2902
618 nmdc:mga09592_87_c3 3300050508 Bacteria 23142
619 nmdc:mga0qj67_509_c1 3300050509 Bacteria 23236
620 nmdc:mga0qj67_6036_c1 3300050509 Bacteria 8872
621 nmdc:mga06r32_1913_c1 3300050510 Bacteria 18545
622 nmdc:mga06r32_34907_c1 3300050510 Bacteria 4744
623 nmdc:mga06r32_363270_c1 3300050510 Bacteria 1431
624 nmdc:mga06r32_46161_c1 3300050510 Bacteria 4157
625 nmdc:mga06r32_8220_c1 3300050510 Bacteria 9394
626 nmdc:mga08y16_88200_c1 3300050511 Bacteria 3233
627 Ga0495601_0100888 3300053077 Bacteria 1864
628 Ga0495601_0198032 3300053077 Bacteria 1313
629 Ga0495612_0000807 3300053078 Bacteria 12764
630 Ga0495619_0036550 3300053085 Bacteria 3199
631 Ga0500646_0000910 3300053090 Bacteria 8158
632 Ga0500556_0000341 3300053104 Bacteria 34888
633 Ga0500618_000737 3300053125 Bacteria 18686
634 Ga0500616_0000016 3300053153 Bacteria 627087
635 Ga0500645_002371 3300053730 Bacteria 8486
636 Ga0501084_0007953 3300054114 Bacteria 8730
637 Ga0501084_0255580 3300054114 Bacteria 1479
638 Ga0530510_0007610 3300061734 Bacteria 7545
639 2501945539 2501939600 Bacteria 6907073
640 2512037940 2511231221 Bacteria 6846400
641 2514040714 2513237165 Bacteria 6771773
642 2515720778 2515154129 Bacteria 5584369
643 2515759002 2515154137 Bacteria 5711575
644 2516085716 2515154202 Bacteria 5471270
645 2516090702 2515154203 Bacteria 5458536
646 2623586140 2622736626 Bacteria 7181580
647 2644531455 2643221696 Bacteria 5431823
648 2676484042 2675903059 Bacteria 8644972
649 2772641334 2772190715 Bacteria 6959372
650 2831938263 2831935698 Bacteria 5963223
651 2832009679 2832004796 Bacteria 6538017
652 2855676695 2855670206 Bacteria 7120389
653 2855683255 2855676851 Bacteria 7063653
654 2855685002 2855683550 Bacteria 7134265
655 2856860037 2856858025 Bacteria 7255264
656 2857289779 2857288857 Bacteria 7189066
657 2858852291 2858848962 Bacteria 6963058
658 2858868898 2858868258 Bacteria 7683772
659 2858888194 2858882152 Bacteria 7230291
660 2858890402 2858888857 Bacteria 7060307
661 2858898943 2858895516 Bacteria 7378898
662 2858905208 2858902515 Bacteria 7086037
663 2866069011 2866065130 Bacteria 6518152
664 2867304323 2867302475 Bacteria 7087181
665 2867313657 2867312974 Bacteria 7058875
666 2867322519 2867319477 Bacteria 7069771
667 2867509711 2867507094 Bacteria 6506033
668 2869052155 2869048445 Bacteria 6875584
669 2869061975 2869061728 Bacteria 7112407
670 2869073983 2869068681 Bacteria 7205615
671 2880494119 2880489317 Bacteria 7096270
672 2880498213 2880495981 Bacteria 7340502
673 2887483534 2887478801 Bacteria 8972725
674 2897807467 2897803580 Bacteria 7000062
675 2902587494 2902582711 Bacteria 6187705
676 2929220255 2929219909 Bacteria 6984360
677 2929226789 2929226422 Bacteria 7248583
678 2996226221 2996221748 Bacteria 6799777
679 649810523 649633069 Bacteria 6962533
680 8001789419 8001781756 Bacteria 9586736
681 8003834826 8003830390 Bacteria 6541657
682 8003862703 8003856774 Bacteria 7675274
683 8003875017 8003870546 Bacteria 7396674
684 8054006891 8054002106 Bacteria 7987183
685 8054707217 8054704163 Bacteria 7247792
686 8054728143 8054727385 Bacteria 7558670
687 8054736494 8054734606 Bacteria 6947278
688 8055412532 8055412473 Bacteria 6257500
689 8057570161 8057568493 Bacteria 7221719
690 Ga0307413_10016942
691 JGI25152J39213_1011092
692 JGI25150J39212_1003962
693 JGI25406J46586_10001822
694 Ga0055538_1000038
695 Ga0055539_1000049
696 Ga0055533_1000060
697 Ga0055525_1000068
698 Ga0055529_1000327
699 Ga0055526_1003505
700 Ga0055526_1009156
701 Ga0055524_1003617
702 Ga0055524_1008057
703 Ga0055536_1000158
704 Ga0055534_1001061
705 Ga0055534_1002288
706 Ga0055534_1004482
707 Ga0055530_10014278
708 Ga0055531_10017367
709 Ga0055541_1000036
710 Ga0070658_10002882
711 Ga0070658_10044781
712 Ga0070658_10045928
713 Ga0070658_10368516
714 Ga0070683_100002186
715 Ga0070683_100005477
716 Ga0070683_100232432
717 Ga0070683_100250651
718 Ga0070680_100001900
719 Ga0070680_100207707
720 Ga0070682_100028609
721 Ga0070682_100063795
722 Ga0070682_100120917
723 Ga0070682_100124077
724 Ga0068868_100022788
725 Ga0070660_100029776
726 Ga0070661_100075067
727 Ga0070661_100144009
728 Ga0070675_100001010
729 Ga0070713_100034995
730 Ga0070713_100231106
731 Ga0070700_100008902
732 Ga0070700_100227583
733 Ga0070678_100028160
734 Ga0070678_100209900
735 Ga0070662_100074773
736 Ga0070681_10064932
737 Ga0068867_100334548
738 Ga0070706_100419304
739 Ga0070679_100001465
740 Ga0070679_100020128
741 Ga0070679_100160254
742 Ga0070679_100276995
743 Ga0070679_100303247
744 Ga0070684_100006208
745 Ga0070684_100055578
746 Ga0070684_100173339
747 Ga0070684_100321736
748 Ga0068853_100030326
749 Ga0068853_100043763
750 Ga0070665_100000865
751 Ga0070665_100029570
752 Ga0070665_100054466
753 Ga0068855_100000702
754 Ga0068855_100009832
755 Ga0068855_100127436
756 Ga0068855_100204924
757 Ga0070664_100004502
758 Ga0070664_100110615
759 Ga0070664_100223379
760 Ga0068857_100009930
761 Ga0068857_100209937
762 Ga0068856_100038638
763 Ga0068856_100114180
764 Ga0068856_100130494
765 Ga0068852_100050712
766 Ga0068859_100018309
767 Ga0068859_100055178
768 Ga0068864_100013469
769 Ga0068864_100265609
770 Ga0068861_100215782
771 Ga0068851_10047182
772 Ga0068863_100027637
773 Ga0068863_100214286
774 Ga0068858_100053400
775 Ga0068860_100000887
776 Ga0068860_100203241
777 Ga0068862_100021800
778 Ga0081540_1032264
779 Ga0081539_10000763
780 Ga0070717_10263643
781 Ga0075432_10004280
782 Ga0075370_10041858
783 Ga0075428_100001393
784 Ga0075428_100010162
785 Ga0075428_100518620
786 Ga0075430_100001384
787 Ga0075430_100260718
788 Ga0075431_100020558
789 Ga0075431_100021768
790 Ga0075431_100028431
791 Ga0075431_100423192
792 Ga0075429_100013581
793 Ga0068865_100059809
794 Ga0068865_100142497
795 Ga0097620_100018309
796 Ga0097620_100055179
797 Ga0079104_1033629
798 Ga0105244_10000262
799 Ga0105244_10013617
800 Ga0105244_10116087
801 Ga0105240_10001742
802 Ga0105240_10003623
803 Ga0105240_10033920
804 Ga0105240_10037077
805 Ga0105240_10539225
806 Ga0111539_10002724
807 Ga0105245_10004166
808 Ga0105247_10228623
809 Ga0114129_10000852
810 Ga0114129_10001140
811 Ga0114129_10001724
812 Ga0114129_10003177
813 Ga0105242_10135622
814 Ga0105248_10016623
815 Ga0105248_10045540
816 Ga0105248_10222155
817 Ga0105248_10467876
818 Ga0105237_10005296
819 Ga0105238_10000037
820 Ga0105238_10002180
821 Ga0105238_10161857
822 Ga0105238_10314460
823 Ga0105238_10540579
824 Ga0105238_10593835
825 Ga0105239_10003785
826 Ga0105239_10014616
827 Ga0105246_10003879
828 Ga0105246_10167436
829 Ga0157370_10004051
830 Ga0157370_10054731
831 Ga0157369_10040901
832 Ga0157369_10258237
833 Ga0163162_10011167
834 Ga0163162_10046206
835 Ga0163163_10007481
836 Ga0163163_10047694
837 Ga0163163_10339296
838 Ga0182008_10047678
839 Ga0157379_10051719
840 Ga0157379_10054024
841 Ga0157379_10059252
842 Ga0157379_10086822
843 Ga0157379_10230821
844 Ga0157376_10046816
845 Ga0182006_1000055
846 Ga0182005_1000003
847 Ga0206351_10378959
848 Ga0206350_10945359
849 Ga0206354_11044102
850 Ga0206353_11737339
851 Ga0213872_10000135
852 Ga0213872_10000523
853 Ga0213872_10037956
854 Ga0213872_10127881
855 Ga0213872_10128654
856 Ga0213876_10065844
857 Ga0224712_10002724
858 Ga0224712_10003072
859 Ga0209436_100364
860 Ga0209784_100021
861 Ga0209566_100039
862 Ga0209674_100036
863 Ga0209563_100040
864 Ga0207425_1000006
865 Ga0207425_1000062
866 Ga0207425_1000764
867 Ga0209677_100023
868 Ga0209129_1000009
869 Ga0209565_1001289
870 Ga0209565_1001724
871 Ga0209565_1005512
872 Ga0209565_1005826
873 Ga0209455_1000051
874 Ga0209673_1008943
875 Ga0209130_1001651
876 Ga0209675_1000065
877 Ga0209675_1001178
878 Ga0209676_1000044
879 Ga0209025_1000147
880 Ga0209025_1005972
881 Ga0209564_1000080
882 Ga0209564_1000087
883 Ga0209564_1002792
884 Ga0209758_1000047
885 Ga0209050_1000064
886 Ga0209050_1000171
887 Ga0209256_1000013
888 Ga0209256_1000376
889 Ga0209256_1001366
890 Ga0209256_1005606
891 Ga0207426_1002831
892 Ga0209257_1000010
893 Ga0209257_1000998
894 Ga0207655_1009662
895 Ga0207647_10012942
896 Ga0207647_10034671
897 Ga0207645_10083574
898 Ga0207705_10031911
899 Ga0207705_10043065
900 Ga0207705_10162532
901 Ga0207684_10352549
902 Ga0207707_10000755
903 Ga0207695_10003945
904 Ga0207695_10004040
905 Ga0207695_10015369
906 Ga0207695_10037963
907 Ga0207695_10047179
908 Ga0207695_10080957
909 Ga0207671_10029678
910 Ga0207671_10367963
911 Ga0207660_10047499
912 Ga0207657_10038635
913 Ga0207657_10081985
914 Ga0207657_10122757
915 Ga0207649_10158196
916 Ga0207649_10170337
917 Ga0207652_10000446
918 Ga0207652_10198746
919 Ga0207652_10257890
920 Ga0207694_10000054
921 Ga0207694_10004016
922 Ga0207694_10135515
923 Ga0207694_10265106
924 Ga0207694_10337107
925 Ga0207659_10015546
926 Ga0207687_10022961
927 Ga0207700_10063766
928 Ga0207700_10208318
929 Ga0207700_10330571
930 Ga0207686_10062351
931 Ga0207704_10043074
932 Ga0207711_10145759
933 Ga0207711_10172352
934 Ga0207689_10002995
935 Ga0207661_10003752
936 Ga0207661_10235410
937 Ga0207679_10006186
938 Ga0207667_10000043
939 Ga0207667_10002611
940 Ga0207667_10067508
941 Ga0207667_10209694
942 Ga0207668_10149910
943 Ga0207640_10002069
944 Ga0207677_10020664
945 Ga0207703_10092146
946 Ga0207703_10128986
947 Ga0207639_10091560
948 Ga0207639_10162980
949 Ga0207708_10006164
950 Ga0207702_10375743
951 Ga0207641_10003017
952 Ga0207648_10110349
953 Ga0207648_10221797
954 Ga0207676_10008379
955 Ga0207676_10251000
956 Ga0207674_10007418
957 Ga0207674_10009443
958 Ga0207674_10097428
959 Ga0207674_10115213
960 Ga0207675_100034358
961 Ga0207683_10029092
962 Ga0207683_10169716
963 Ga0207683_10173090
964 Ga0207698_10051691
965 Ga0207428_10174979
966 Ga0268266_10001168
967 Ga0268266_10013240
968 Ga0268266_10122867
969 Ga0268266_10127663
970 Ga0268265_10014154
971 Ga0268264_10000373
972 Ga0265334_10028936
973 Ga0307515_10000150
974 Ga0307515_10000471
975 Ga0307511_10021653
976 Ga0316180_1179088
977 Ga0316182_1141376
978 Ga0265316_10119334
979 Ga0307513_10000038
980 Ga0307513_10038776
981 Ga0307513_10112093
982 Ga0307513_10196689
983 Ga0307513_10287952
984 Ga0307509_10000001
985 Ga0307408_100003439
986 Ga0307408_100263157
987 Ga0307508_10107257
988 Ga0307508_10216942
989 Ga0307514_10001386
990 Ga0307405_10001384
991 Ga0307413_10034920
992 Ga0307518_10202009
993 Ga0307410_10017908
994 Ga0307410_10028858
995 Ga0307406_10008234
996 Ga0307407_10004078
997 Ga0307407_10047888
998 Ga0307409_100000409
999 Ga0307409_100040103
1000 Ga0307409_100341407
1001 Ga0307409_100384114
1002 Ga0307416_100000277
1003 Ga0307416_100017585
1004 Ga0307416_100653574
1005 Ga0307411_10072572
1006 Ga0307415_100000021
1007 Ga0307415_100029500
1008 Ga0307415_100035799
1009 Ga0307415_100089534
1010 Ga0307415_100167619
1011 Ga0307510_10000015
1012 Ga0307510_10068821
1013 Ga0395899_0030670
1014 Ga0395899_0104288
1015 Ga0395900_0012381
1016 Ga0395900_0045239
1017 Ga0395898_0000023
1018 Ga0395898_0002237
1019 Ga0395898_0236371
1020 Ga0395898_0549604
1021 Ga0395905_0021857
1022 Ga0395905_0107885
1023 Ga0395905_0152771
1024 Ga0395905_0192008
1025 Ga0395905_0330566
1026 Ga0436364_1294156
1027 Ga0395901_0006877
1028 Ga0395901_0119876
1029 Ga0436365_1607053
1030 Ga0436361_0052332
1031 Ga0436361_0304034
1032 Ga0451793_1669292
1033 Ga0451797_0468990
1034 Ga0451841_0749764
1035 Ga0466961_0012402
1036 Ga0466971_0008173
1037 Ga0466970_0045460
1038 Ga0466957_0052743
1039 Ga0466960_0017790
1040 Ga0466959_0053621
1041 Ga0466967_0031186
1042 Ga0466967_0066294
1043 Ga0466967_0171515
1044 Ga0495617_000002
1045 Ga0495627_000066
1046 Ga0495627_000176
1047 Ga0495603_0208618
1048 Ga0495590_0000044
1049 Ga0495591_000052
1050 Ga0495629_0169395
1051 Ga0495651_0003057
1052 Ga0495653_0004013
1053 Ga0495653_0010057
1054 Ga0495650_0079675
1055 Ga0495582_0041560
1056 Ga0495605_0000081
1057 Ga0495605_0000087
1058 Ga0495605_0036051
1059 Ga0495605_0046951
1060 Ga0495584_0000224
1061 Ga0495585_0000078
1062 Ga0495585_0002037
1063 Ga0495585_0010860
1064 Ga0495585_0012734
1065 Ga0495585_0052334
1066 Ga0495594_0002438
1067 Ga0495596_0003233
1068 Ga0495596_0003471
1069 Ga0495596_0005404
1070 Ga0495596_0005921
1071 Ga0495596_0009336
1072 Ga0495596_0031361
1073 Ga0495607_0000658
1074 Ga0495607_0001173
1075 Ga0495607_0001229
1076 Ga0495607_0016104
1077 Ga0495607_0020020
1078 Ga0495607_0024098
1079 Ga0495607_0036322
1080 Ga0495583_0000241
1081 Ga0495583_0003098
1082 Ga0495583_0004796
1083 Ga0495583_0011809
1084 Ga0495583_0019804
1085 Ga0495606_0000280
1086 Ga0495606_0002926
1087 Ga0495608_0051727
1088 Ga0495610_0000493
1089 Ga0495610_0001546
1090 Ga0495616_0000103
1091 Ga0495616_0001114
1092 Ga0495616_0010324
1093 Ga0495616_0034148
1094 Ga0495616_0052593
1095 Ga0495628_0005595
1096 Ga0495631_0000236
1097 Ga0495631_0033603
1098 Ga0495631_0049059
1099 Ga0495632_0044776
1100 Ga0495632_0090555
1101 Ga0495637_0000006
1102 Ga0495637_0010364
1103 Ga0495643_0000192
1104 Ga0495643_0001383
1105 Ga0495643_0002571
1106 Ga0495644_0029245
1107 Ga0495648_0000035
1108 Ga0495648_0011042
1109 Ga0495642_0000057
1110 Ga0495642_0008573
1111 Ga0495642_0049907
1112 Ga0495587_0001834
1113 Ga0495609_0000096
1114 Ga0495609_0002900
1115 Ga0495609_0063588
1116 Ga0495597_0000787
1117 Ga0495645_0004316
1118 Ga0495645_0048156
1119 Ga0495633_0000224
1120 Ga0495633_0003002
1121 Ga0495633_0006790
1122 Ga0495633_0014689
1123 Ga0495633_0057231
1124 Ga0495667_0155003
1125 Ga0495668_0000519
1126 Ga0495668_0001785
1127 Ga0495668_0090826
1128 Ga0495668_0144468
1129 Ga0495611_0001617
1130 Ga0495611_0002405
1131 Ga0495611_0005111
1132 Ga0495611_0026314
1133 Ga0495625_0007835
1134 Ga0495635_0006068
1135 Ga0495635_0016076
1136 Ga0495661_0000164
1137 Ga0495661_0005789
1138 Ga0495661_0010121
1139 Ga0495661_0030156
1140 Ga0495588_0000261
1141 Ga0495588_0014444
1142 Ga0495588_0051825
1143 Ga0495657_0124139
1144 Ga0495623_0040517
1145 Ga0495646_0050640
1146 Ga0495646_0066743
1147 Ga0495669_0000122
1148 Ga0495669_0035282
1149 Ga0495613_0036874
1150 Ga0495670_0031327
1151 Ga0495671_0000132
1152 Ga0495649_0001595
1153 Ga0495649_0005128
1154 Ga0495649_0079171
1155 Ga0495589_0000036
1156 Ga0495589_0000092
1157 Ga0495589_0000210
1158 Ga0495589_0004698
1159 Ga0495589_0010102
1160 Ga0495589_0016488
1161 Ga0495600_0042968
1162 Ga0495660_0000117
1163 Ga0495660_0012522
1164 Ga0495660_0030737
1165 Ga0495660_0088291
1166 Ga0495604_0004690
1167 Ga0495604_0198762
1168 Ga0495672_0000086
1169 Ga0495672_0000576
1170 Ga0495672_0006333
1171 Ga0495672_0037763
1172 Ga0495680_0012466
1173 Ga0495680_0025804
1174 Ga0495683_0000080
1175 Ga0495683_0004092
1176 Ga0495687_000074
1177 Ga0495687_000154
1178 Ga0495687_000403
1179 Ga0495687_002089
1180 Ga0495677_0000037
1181 Ga0495677_0002756
1182 Ga0495677_0002769
1183 Ga0495677_0011927
1184 Ga0495677_0096748
1185 Ga0495679_033288
1186 Ga0495673_0000135
1187 Ga0495681_0001633
1188 Ga0495681_0010158
1189 Ga0495681_0017119
1190 Ga0495681_0023566
1191 Ga0495681_0046317
1192 Ga0495684_0007844
1193 Ga0495686_0001199
1194 Ga0495593_0019068
1195 Ga0495614_0006138
1196 Ga0495626_0000006
1197 Ga0495626_0000454
1198 Ga0495626_0000663
1199 Ga0495626_0001808
1200 Ga0495626_0004944
1201 Ga0495626_0017541
1202 Ga0495626_0022868
1203 Ga0495626_0024611
1204 Ga0495626_0063411
1205 Ga0496100_0367087
1206 Ga0496101_0063748
1207 Ga0496101_0131003
1208 Ga0496102_0000152
1209 Ga0496102_0036573
1210 Ga0496102_0043029
1211 Ga0496102_0064768
1212 Ga0496102_0175080
1213 Ga0496103_0085400
1214 Ga0496104_0003816
1215 Ga0496105_0001511
1216 Ga0496105_0017804
1217 Ga0496106_0056792
1218 Ga0496106_0124279
1219 Ga0496108_0023071
1220 Ga0496108_0078825
1221 Ga0496108_0122020
1222 Ga0496109_0001861
1223 Ga0496109_0011804
1224 Ga0496109_0017144
1225 Ga0496109_0026349
1226 Ga0496109_0197578
1227 Ga0496110_0002113
1228 Ga0496110_0006953
1229 Ga0496111_0003704
1230 Ga0496112_0017239
1231 Ga0496112_0020107
1232 Ga0496112_0091218
1233 Ga0496112_0109627
1234 Ga0496112_0254214
1235 Ga0496112_0356315
1236 Ga0496113_0004194
1237 Ga0496113_0004884
1238 Ga0496113_0280595
1239 Ga0496114_0000705
1240 Ga0496114_0057994
1241 Ga0496114_0092346
1242 Ga0496114_0097382
1243 Ga0496114_0110897
1244 Ga0496115_0001802
1245 Ga0496115_0110253
1246 Ga0496115_0167592
1247 Ga0496117_0094087
1248 Ga0496119_0000983
1249 Ga0496119_0024910
1250 Ga0496120_0000199
1251 Ga0496120_0016999
1252 Ga0496121_0120887
1253 Ga0496122_0000942
1254 Ga0496123_0000819
1255 Ga0496125_0009738
1256 Ga0496125_0052790
1257 Ga0496126_0090471
1258 Ga0496126_0111411
1259 Ga0496126_0133539
1260 Ga0496126_0137156
1261 Ga0495678_000001
1262 Ga0495678_000064
1263 Ga0495678_017367
1264 Ga0501031_0003050
1265 Ga0501032_0028140
1266 Ga0501036_0000495
1267 Ga0501036_0002673
1268 Ga0501037_0023315
1269 Ga0501038_0011685
1270 Ga0501038_0028409
1271 Ga0501038_0076577
1272 Ga0501039_0008327
1273 Ga0501040_0000566
1274 Ga0501041_0004948
1275 Ga0501041_0129048
1276 Ga0501042_0007588
1277 Ga0501042_0081715
1278 Ga0501043_0086942
1279 Ga0501046_0086462
1280 Ga0501046_0095494
1281 Ga0501047_0208297
1282 Ga0501047_0413449
1283 Ga0501048_0009251
1284 Ga0501067_0171012
1285 Ga0501068_0010239
1286 Ga0501070_0248634
1287 Ga0501071_0004571
1288 Ga0501071_0016791
1289 Ga0501072_0000706
1290 Ga0501075_0001787
1291 Ga0501076_0000886
1292 Ga0501076_0009876
1293 Ga0501077_0012713
1294 Ga0501079_0000643
1295 Ga0501081_0018537
1296 Ga0501044_0240444
1297 Ga0501045_0007342
1298 Ga0501045_0122118
1299 Ga0501045_0232925
1300 nmdc:mga05p37_170649_c1
1301 nmdc:mga05p37_2735_c1
1302 nmdc:mga05p37_31145_c1
1303 nmdc:mga05p37_322880_c1
1304 nmdc:mga05p37_36054_c1
1305 nmdc:mga09592_63062_c1
1306 nmdc:mga09592_73624_c1
1307 nmdc:mga09592_87_c3
1308 nmdc:mga0qj67_509_c1
1309 nmdc:mga0qj67_6036_c1
1310 nmdc:mga06r32_1913_c1
1311 nmdc:mga06r32_34907_c1
1312 nmdc:mga06r32_363270_c1
1313 nmdc:mga06r32_46161_c1
1314 nmdc:mga06r32_8220_c1
1315 nmdc:mga08y16_88200_c1
1316 Ga0495601_0100888
1317 Ga0495601_0198032
1318 Ga0495612_0000807
1319 Ga0495619_0036550
1320 Ga0500646_0000910
1321 Ga0500556_0000341
1322 Ga0500618_000737
1323 Ga0500616_0000016
1324 Ga0500645_002371
1325 Ga0501084_0007953
1326 Ga0501084_0255580
1327 Ga0530510_0007610
1328 2501945539
1329 2512037940
1330 2514040714
1331 2515720778
1332 2515759002
1333 2516085716
1334 2516090702
1335 2623586140
1336 2644531455
1337 2676484042
1338 2772641334
1339 2831938263
1340 2832009679
1341 2855676695
1342 2855683255
1343 2855685002
1344 2856860037
1345 2857289779
1346 2858852291
1347 2858868898
1348 2858888194
1349 2858890402
1350 2858898943
1351 2858905208
1352 2866069011
1353 2867304323
1354 2867313657
1355 2867322519
1356 2867509711
1357 2869052155
1358 2869061975
1359 2869073983
1360 2880494119
1361 2880498213
1362 2887483534
1363 2897807467
1364 2902587494
1365 2929220255
1366 2929226789
1367 2996226221
1368 649810523
1369 8001789419
1370 8003834826
1371 8003862703
1372 8003875017
1373 8054006891
1374 8054707217
1375 8054728143
1376 8054736494
1377 8055412532
1378 8057570161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

22

318

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iit-assembly1.cif.gz_A-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9865 20 320
3pwq-assembly1.cif.gz_D the phenylacetyl-coa monooxygenase paaac subcomplex 0.9863 20 320
3pvr-assembly1.cif.gz_A the phenylacetyl-coa monooxygenase paaac subcomplex with benzoyl-coa 0.9858 19 320
4ii4-assembly1.cif.gz_A-2 the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.9842 19 320
3pwq-assembly2.cif.gz_H the phenylacetyl-coa monooxygenase paaac subcomplex 0.9839 21 320
ID Description Score Start End Superfamily
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9839 21 320 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9773 21 320 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8274 48 301 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8192 42 258 1.20.1260.10
4l0rB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8186 46 116 1.20.58.90
ID Description Score Start End GO Terms
AF-A0A3B0R0L9-F1-model_v4 1,2-phenylacetyl-CoA epoxidase, subunit A (EC 1.14.13.149) 0.993 21 146 GO:0005829
GO:0010124
GO:0097266
AF-A0A6N9XV05-F1-model_v4 deleted 0.9927 192 283
AF-A0A7C7D0E4-F1-model_v4 1,2-phenylacetyl-CoA epoxidase subunit A 0.9917 22 137 GO:0005829
GO:0010124
AF-A0A534E5X5-F1-model_v4 1,2-phenylacetyl-CoA epoxidase subunit A (EC 1.14.13.149) 0.9915 41 324 GO:0005829
GO:0010124
GO:0097266
AF-A0A538LVS1-F1-model_v4 1,2-phenylacetyl-CoA epoxidase subunit A 0.9911 21 143 GO:0005829
GO:0010124

Map