F475429

General Info

Members Datasets Scaffolds Average Seq Length
690 372 686 209

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100825830|Ga0070678_1008258301
Length 231
Sequence VKDNTHPAPPGRVRILIIDDHYVVRQGLKMILNEQFEHAQFGEAATGQEGLNHVWDHDWDVVLVDISMPGRGGLDVLKDIKHSKPKLPVIILSMHSEDQYAIRALKLGACGYIRKDSVGQELVQAVTTALTGARYITPSIAQKLAVHLQHEQEGPPHDALADREYQVMCMIALGKTVSEIGNELSLSVKTISTHRARILKKLSVANNEQIMRYAVMHGLVDVESGITAREE

Samples

Sample ID Description Type Environment
1 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
2 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
3 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
197 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
202 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
208 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
209 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
210 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
215 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
216 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
217 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
218 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
219 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
223 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
224 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
229 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
230 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
247 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
248 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
249 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
250 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
251 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
252 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
255 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
256 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
257 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
258 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
259 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
260 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
261 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
262 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
263 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
288 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
322 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
346 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
347 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
366 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
367 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
372 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.87
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.3
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10043687 3300003203 Bacteria 1558
2 Ga0058859_10033578 3300004798 Bacteria 2286
3 Ga0058861_10058411 3300004800 Bacteria 1436
4 Ga0058860_12196631 3300004801 Bacteria 943
5 Ga0065715_10560032 3300005293 Unclassified 734
6 Ga0065707_10146536 3300005295 Unclassified 1707
7 Ga0070676_10022726 3300005328 Unclassified 3518
8 Ga0070676_10391663 3300005328 Bacteria 964
9 Ga0070690_100004639 3300005330 Bacteria 7648
10 Ga0070690_100034888 3300005330 Unclassified 3155
11 Ga0070690_100080021 3300005330 Bacteria 2137
12 Ga0070690_100180716 3300005330 Bacteria 1457
13 Ga0070670_100022786 3300005331 Bacteria 5389
14 Ga0070670_100031414 3300005331 Bacteria 4573
15 Ga0070670_100967256 3300005331 Bacteria 773
16 Ga0070677_10042471 3300005333 Unclassified 1801
17 Ga0068869_100001704 3300005334 Bacteria 13134
18 Ga0068869_100552509 3300005334 Unclassified 967
19 Ga0070666_10004229 3300005335 Bacteria 8718
20 Ga0070666_10562615 3300005335 Bacteria 830
21 Ga0070680_100002230 3300005336 Bacteria 14302
22 Ga0070680_100147061 3300005336 Bacteria 1977
23 Ga0070680_100151862 3300005336 Bacteria 1944
24 Ga0070680_100259184 3300005336 Unclassified 1471
25 Ga0070680_100646845 3300005336 Bacteria 909
26 Ga0070682_100000067 3300005337 Bacteria 96458
27 Ga0068868_100044416 3300005338 Unclassified 3474
28 Ga0068868_100057979 3300005338 Bacteria 3060
29 Ga0070689_100057603 3300005340 Bacteria 3016
30 Ga0070689_100221966 3300005340 Bacteria 1550
31 Ga0070691_10001570 3300005341 Bacteria 9865
32 Ga0070687_100000821 3300005343 Bacteria 10354
33 Ga0070687_100141480 3300005343 Bacteria 1402
34 Ga0070687_100506623 3300005343 Bacteria 813
35 Ga0070661_100074138 3300005344 Unclassified 2506
36 Ga0070692_10095755 3300005345 Bacteria 1620
37 Ga0070668_100079471 3300005347 Bacteria 2568
38 Ga0070669_100087566 3300005353 Unclassified 2329
39 Ga0070669_100495355 3300005353 Bacteria 1013
40 Ga0070675_100031415 3300005354 Bacteria 4293
41 Ga0070671_100012951 3300005355 Bacteria 6720
42 Ga0070674_100000282 3300005356 Bacteria 24872
43 Ga0070674_100044977 3300005356 Bacteria 3014
44 Ga0070673_100000027 3300005364 Bacteria 71407
45 Ga0070673_100160848 3300005364 Bacteria 1910
46 Ga0070659_100033076 3300005366 Bacteria 4015
47 Ga0070667_100053508 3300005367 Unclassified 3407
48 Ga0070709_10277519 3300005434 Bacteria 1217
49 Ga0070714_100121445 3300005435 Bacteria 2324
50 Ga0070710_10101677 3300005437 Bacteria 1713
51 Ga0070701_10012125 3300005438 Bacteria 3877
52 Ga0070705_100012874 3300005440 Bacteria 4267
53 Ga0070705_100014567 3300005440 Bacteria 4048
54 Ga0070705_100021347 3300005440 Bacteria 3443
55 Ga0070705_100095597 3300005440 Bacteria 1863
56 Ga0070705_100105337 3300005440 Bacteria 1790
57 Ga0070700_100004048 3300005441 Bacteria 7630
58 Ga0070700_100076611 3300005441 Bacteria 2148
59 Ga0070694_100004096 3300005444 Bacteria 8749
60 Ga0070694_100019702 3300005444 Bacteria 4293
61 Ga0070694_100236780 3300005444 Bacteria 1375
62 Ga0070694_100255878 3300005444 Bacteria 1326
63 Ga0070694_100362047 3300005444 Bacteria 1127
64 Ga0070708_100286305 3300005445 Bacteria 1551
65 Ga0070663_100168805 3300005455 Unclassified 1690
66 Ga0070678_100003474 3300005456 Bacteria 8782
67 Ga0070678_100687157 3300005456 Bacteria 921
68 Ga0070678_100825830 3300005456 Unclassified 843
69 Ga0070662_100069089 3300005457 Unclassified 2599
70 Ga0070681_10000720 3300005458 Bacteria 27395
71 Ga0070681_10181712 3300005458 Bacteria 2025
72 Ga0068867_100006962 3300005459 Bacteria 7995
73 Ga0068867_100007000 3300005459 Bacteria 7969
74 Ga0068867_100688865 3300005459 Bacteria 901
75 Ga0070706_100300453 3300005467 Bacteria 1498
76 Ga0070707_100067608 3300005468 Bacteria 3438
77 Ga0070699_100113399 3300005518 Bacteria 2381
78 Ga0070679_100041060 3300005530 Bacteria 4605
79 Ga0070684_100066324 3300005535 Bacteria 3169
80 Ga0070697_100032296 3300005536 Bacteria 4212
81 Ga0070697_100089743 3300005536 Bacteria 2540
82 Ga0068853_100434192 3300005539 Bacteria 1233
83 Ga0070672_100000655 3300005543 Bacteria 20239
84 Ga0070672_100028480 3300005543 Bacteria 4179
85 Ga0070686_100003451 3300005544 Bacteria 8670
86 Ga0070686_100024914 3300005544 Bacteria 3591
87 Ga0070695_100001782 3300005545 Bacteria 12122
88 Ga0070695_100161565 3300005545 Bacteria 1573
89 Ga0070695_100230913 3300005545 Bacteria 1337
90 Ga0070696_100006269 3300005546 Bacteria 7963
91 Ga0070696_100031211 3300005546 Bacteria 3651
92 Ga0070693_100027535 3300005547 Bacteria 3082
93 Ga0070693_100234627 3300005547 Unclassified 1209
94 Ga0070665_100029569 3300005548 Bacteria 5515
95 Ga0070704_100004949 3300005549 Bacteria 7734
96 Ga0070704_100019763 3300005549 Bacteria 4333
97 Ga0070704_100057954 3300005549 Bacteria 2757
98 Ga0070704_100112577 3300005549 Unclassified 2074
99 Ga0070704_100115794 3300005549 Bacteria 2049
100 Ga0070704_100225158 3300005549 Bacteria 1527
101 Ga0070704_100619072 3300005549 Bacteria 953
102 Ga0068855_100005265 3300005563 Bacteria 15795
103 Ga0070664_100040877 3300005564 Unclassified 3911
104 Ga0068854_100070570 3300005578 Bacteria 2553
105 Ga0068856_100013045 3300005614 Bacteria 8048
106 Ga0068856_100769210 3300005614 Bacteria 983
107 Ga0070702_100001902 3300005615 Bacteria 8761
108 Ga0070702_100033529 3300005615 Bacteria 2824
109 Ga0068852_100221920 3300005616 Bacteria 1798
110 Ga0068852_100347120 3300005616 Unclassified 1448
111 Ga0068859_100033006 3300005617 Bacteria 5199
112 Ga0068859_100050635 3300005617 Bacteria 4172
113 Ga0068859_100258639 3300005617 Bacteria 1832
114 Ga0068864_100104887 3300005618 Bacteria 2512
115 Ga0068866_10001148 3300005718 Bacteria 11632
116 Ga0068866_10021798 3300005718 Bacteria 2955
117 Ga0068866_10642434 3300005718 Bacteria 721
118 Ga0068861_100034873 3300005719 Bacteria 3723
119 Ga0068863_100345866 3300005841 Bacteria 1447
120 Ga0068863_100684378 3300005841 Unclassified 1019
121 Ga0068858_100071360 3300005842 Bacteria 3221
122 Ga0068860_100176973 3300005843 Bacteria 2062
123 Ga0068860_100190370 3300005843 Bacteria 1985
124 Ga0068860_100431537 3300005843 Bacteria 1307
125 Ga0068862_100018223 3300005844 Bacteria 5845
126 Ga0068862_100136303 3300005844 Bacteria 2175
127 Ga0081538_10036883 3300005981 Bacteria 3182
128 Ga0081539_10002158 3300005985 Bacteria 28978
129 Ga0070717_10919836 3300006028 Bacteria 796
130 Ga0070715_10054753 3300006163 Bacteria 1729
131 Ga0097621_100101724 3300006237 Bacteria 2418
132 Ga0097621_100158256 3300006237 Bacteria 1946
133 Ga0097621_100181536 3300006237 Unclassified 1818
134 Ga0068871_100009825 3300006358 Bacteria 6944
135 Ga0068871_100018921 3300006358 Bacteria 5248
136 Ga0068871_100036675 3300006358 Bacteria 3905
137 Ga0068871_100547569 3300006358 Unclassified 1048
138 Ga0075428_100005942 3300006844 Bacteria 13563
139 Ga0075428_100016454 3300006844 Bacteria 8167
140 Ga0075428_100032886 3300006844 Bacteria 5727
141 Ga0075428_100322043 3300006844 Unclassified 1661
142 Ga0075430_100013066 3300006846 Bacteria 7075
143 Ga0075430_100075634 3300006846 Bacteria 2823
144 Ga0075430_100142818 3300006846 Bacteria 1993
145 Ga0075430_100271399 3300006846 Bacteria 1404
146 Ga0075430_100331034 3300006846 Unclassified 1258
147 Ga0075430_100441106 3300006846 Bacteria 1075
148 Ga0075431_100007501 3300006847 Bacteria 10858
149 Ga0075431_100229406 3300006847 Bacteria 1892
150 Ga0075431_100508616 3300006847 Bacteria 1195
151 Ga0075433_10146331 3300006852 Bacteria 2100
152 Ga0075433_10376498 3300006852 Bacteria 1253
153 Ga0075434_100000637 3300006871 Bacteria 27077
154 Ga0075434_100027268 3300006871 Bacteria 5606
155 Ga0075434_100400539 3300006871 Bacteria 1393
156 Ga0075434_100408239 3300006871 Bacteria 1379
157 Ga0075429_100002429 3300006880 Bacteria 15689
158 Ga0075429_100047465 3300006880 Bacteria 3736
159 Ga0075429_100165976 3300006880 Bacteria 1934
160 Ga0075429_100733082 3300006880 Bacteria 866
161 Ga0068865_100020691 3300006881 Bacteria 4270
162 Ga0075436_100002105 3300006914 Bacteria 13742
163 Ga0075436_100009310 3300006914 Bacteria 6717
164 Ga0075436_100020187 3300006914 Bacteria 4573
165 Ga0075436_100333261 3300006914 Bacteria 1092
166 Ga0075436_100355268 3300006914 Bacteria 1056
167 Ga0097620_100033005 3300006931 Bacteria 5199
168 Ga0097620_100050640 3300006931 Bacteria 4172
169 Ga0097620_100258639 3300006931 Bacteria 1832
170 Ga0075435_100011829 3300007076 Bacteria 6442
171 Ga0075435_100022586 3300007076 Bacteria 4853
172 Ga0075435_100219341 3300007076 Bacteria 1615
173 Ga0075435_100481979 3300007076 Bacteria 1071
174 Ga0075435_100648213 3300007076 Bacteria 917
175 Ga0099794_10016647 3300007265 Bacteria 3263
176 Ga0105240_10719459 3300009093 Unclassified 1088
177 Ga0111539_10008078 3300009094 Bacteria 13411
178 Ga0111539_10008809 3300009094 Bacteria 12795
179 Ga0111539_10013111 3300009094 Bacteria 10367
180 Ga0111539_10142557 3300009094 Unclassified 2805
181 Ga0111539_10254824 3300009094 Bacteria 2043
182 Ga0105245_10004171 3300009098 Bacteria 12837
183 Ga0114129_10007266 3300009147 Bacteria 15761
184 Ga0114129_10077350 3300009147 Bacteria 4628
185 Ga0114129_10311632 3300009147 Bacteria 2095
186 Ga0105243_10084982 3300009148 Bacteria 2593
187 Ga0105243_10175536 3300009148 Bacteria 1859
188 Ga0105243_10286988 3300009148 Bacteria 1485
189 Ga0105243_10810670 3300009148 Bacteria 923
190 Ga0105241_10011280 3300009174 Bacteria 6551
191 Ga0105242_10003038 3300009176 Bacteria 13114
192 Ga0105248_10111632 3300009177 Bacteria 3083
193 Ga0105237_10000137 3300009545 Bacteria 102639
194 Ga0105249_10035913 3300009553 Bacteria 4495
195 Ga0105239_10657321 3300010375 Bacteria 1197
196 Ga0157329_1008665 3300012491 Bacteria 765
197 Ga0157371_10017208 3300013102 Bacteria 5374
198 Ga0157370_10268514 3300013104 Bacteria 1576
199 Ga0157369_10778625 3300013105 Bacteria 983
200 Ga0157374_10057328 3300013296 Unclassified 3638
201 Ga0157378_10000235 3300013297 Bacteria 53980
202 Ga0157378_10011451 3300013297 Bacteria 7762
203 Ga0157378_10023055 3300013297 Bacteria 5479
204 Ga0163162_10134166 3300013306 Bacteria 2586
205 Ga0163162_10527884 3300013306 Bacteria 1309
206 Ga0157375_10256775 3300013308 Unclassified 1909
207 Ga0157380_10042501 3300014326 Bacteria 3553
208 Ga0157380_10146740 3300014326 Bacteria 2034
209 Ga0157380_10239130 3300014326 Bacteria 1636
210 Ga0157377_10212957 3300014745 Bacteria 1233
211 Ga0157379_10004082 3300014968 Bacteria 12455
212 Ga0157379_10132788 3300014968 Bacteria 2241
213 Ga0157376_10001991 3300014969 Bacteria 13678
214 Ga0157376_10008195 3300014969 Bacteria 7520
215 Ga0157376_10633135 3300014969 Bacteria 1068
216 Ga0163161_10090480 3300017792 Bacteria 2264
217 Ga0163161_10517028 3300017792 Bacteria 974
218 Ga0207697_10048717 3300025315 Unclassified 1748
219 Ga0207653_10013523 3300025885 Bacteria 2555
220 Ga0207682_10017696 3300025893 Bacteria 2783
221 Ga0207682_10085437 3300025893 Unclassified 1359
222 Ga0207692_10072042 3300025898 Bacteria 1824
223 Ga0207642_10019300 3300025899 Bacteria 2638
224 Ga0207642_10019861 3300025899 Bacteria 2611
225 Ga0207680_10117382 3300025903 Unclassified 1735
226 Ga0207685_10003876 3300025905 Bacteria 3708
227 Ga0207645_10017450 3300025907 Unclassified 4737
228 Ga0207645_10059989 3300025907 Bacteria 2430
229 Ga0207645_10279262 3300025907 Bacteria 1109
230 Ga0207643_10022173 3300025908 Bacteria 3494
231 Ga0207643_10087835 3300025908 Bacteria 1809
232 Ga0207707_10015506 3300025912 Bacteria 6638
233 Ga0207671_10001268 3300025914 Bacteria 29771
234 Ga0207660_10036650 3300025917 Bacteria 3411
235 Ga0207660_10096295 3300025917 Bacteria 2203
236 Ga0207660_10251222 3300025917 Bacteria 1396
237 Ga0207660_10543360 3300025917 Bacteria 945
238 Ga0207662_10000163 3300025918 Bacteria 31537
239 Ga0207662_10185761 3300025918 Bacteria 1339
240 Ga0207649_10070531 3300025920 Unclassified 2229
241 Ga0207652_10048128 3300025921 Bacteria 3644
242 Ga0207681_10013598 3300025923 Bacteria 5039
243 Ga0207681_10134109 3300025923 Unclassified 1835
244 Ga0207650_10008640 3300025925 Bacteria 6954
245 Ga0207650_10037338 3300025925 Unclassified 3540
246 Ga0207659_10196133 3300025926 Unclassified 1609
247 Ga0207687_10005036 3300025927 Bacteria 8749
248 Ga0207700_10492873 3300025928 Bacteria 1084
249 Ga0207690_10174189 3300025932 Unclassified 1614
250 Ga0207706_10233043 3300025933 Unclassified 1610
251 Ga0207706_10364202 3300025933 Bacteria 1256
252 Ga0207686_10009441 3300025934 Bacteria 5293
253 Ga0207709_10005265 3300025935 Bacteria 7357
254 Ga0207709_10151407 3300025935 Bacteria 1607
255 Ga0207709_10388809 3300025935 Bacteria 1063
256 Ga0207670_10039813 3300025936 Bacteria 3081
257 Ga0207669_10012036 3300025937 Bacteria 4237
258 Ga0207669_10067790 3300025937 Bacteria 2225
259 Ga0207669_10180198 3300025937 Bacteria 1514
260 Ga0207704_10002799 3300025938 Bacteria 7866
261 Ga0207665_10162150 3300025939 Unclassified 1609
262 Ga0207691_10000759 3300025940 Bacteria 31911
263 Ga0207691_10112465 3300025940 Bacteria 2420
264 Ga0207691_10253063 3300025940 Bacteria 1520
265 Ga0207711_10384812 3300025941 Bacteria 1302
266 Ga0207689_10004260 3300025942 Bacteria 13011
267 Ga0207689_10155942 3300025942 Bacteria 1882
268 Ga0207667_10023823 3300025949 Bacteria 6737
269 Ga0207651_10000073 3300025960 Bacteria 45927
270 Ga0207712_10013646 3300025961 Bacteria 5210
271 Ga0207712_10073959 3300025961 Bacteria 2459
272 Ga0207668_10440326 3300025972 Bacteria 1110
273 Ga0207640_10013576 3300025981 Bacteria 4674
274 Ga0207658_10017462 3300025986 Unclassified 4945
275 Ga0207677_10004527 3300026023 Bacteria 7478
276 Ga0207703_10130021 3300026035 Bacteria 2173
277 Ga0207639_10779526 3300026041 Bacteria 890
278 Ga0207678_10208210 3300026067 Unclassified 1673
279 Ga0207708_10000681 3300026075 Bacteria 25817
280 Ga0207708_10025718 3300026075 Bacteria 4454
281 Ga0207708_10384773 3300026075 Bacteria 1157
282 Ga0207708_10769210 3300026075 Bacteria 827
283 Ga0207702_10245149 3300026078 Bacteria 1680
284 Ga0207702_10416792 3300026078 Bacteria 1298
285 Ga0207648_10003529 3300026089 Bacteria 16372
286 Ga0207648_10024014 3300026089 Bacteria 5449
287 Ga0207648_10032369 3300026089 Bacteria 4617
288 Ga0207674_10276961 3300026116 Bacteria 1625
289 Ga0207675_100008285 3300026118 Bacteria 9791
290 Ga0207675_100036108 3300026118 Bacteria 4609
291 Ga0207675_100456804 3300026118 Bacteria 1266
292 Ga0207683_10000596 3300026121 Bacteria 33293
293 Ga0207683_10475970 3300026121 Bacteria 1152
294 Ga0207698_10137664 3300026142 Bacteria 2098
295 Ga0207698_10204282 3300026142 Unclassified 1772
296 Ga0207698_10776746 3300026142 Unclassified 958
297 Ga0209969_1001056 3300027360 Bacteria 3767
298 Ga0209969_1003774 3300027360 Bacteria 2102
299 Ga0209967_1001952 3300027364 Bacteria 2656
300 Ga0209967_1003896 3300027364 Bacteria 1969
301 Ga0209967_1006633 3300027364 Unclassified 1575
302 Ga0209981_1003912 3300027378 Bacteria 1939
303 Ga0209981_1024359 3300027378 Bacteria 873
304 Ga0210000_1001599 3300027462 Bacteria 3203
305 Ga0209995_1007921 3300027471 Bacteria 1713
306 Ga0209968_1011259 3300027526 Unclassified 1384
307 Ga0209968_1021452 3300027526 Bacteria 1048
308 Ga0209999_1002337 3300027543 Bacteria 3342
309 Ga0209999_1003514 3300027543 Bacteria 2807
310 Ga0209982_1006927 3300027552 Bacteria 1655
311 Ga0209970_1010270 3300027614 Bacteria 1531
312 Ga0209983_1012983 3300027665 Bacteria 1712
313 Ga0209588_1027513 3300027671 Bacteria 1809
314 Ga0209971_1002199 3300027682 Bacteria 4737
315 Ga0209966_1072428 3300027695 Bacteria 756
316 Ga0209974_10023562 3300027876 Bacteria 2037
317 Ga0209974_10034481 3300027876 Bacteria 1681
318 Ga0207428_10009598 3300027907 Bacteria 8669
319 Ga0207428_10014118 3300027907 Bacteria 6954
320 Ga0207428_10104029 3300027907 Bacteria 2192
321 Ga0268266_10162047 3300028379 Unclassified 2024
322 Ga0268265_10009420 3300028380 Bacteria 6595
323 Ga0268265_10023106 3300028380 Bacteria 4379
324 Ga0268264_10063281 3300028381 Bacteria 3109
325 Ga0268264_10536139 3300028381 Bacteria 1146
326 Ga0265319_1000048 3300028563 Bacteria 99817
327 Ga0265318_10001434 3300028577 Bacteria 14053
328 Ga0265330_10000212 3300031235 Bacteria 45086
329 Ga0265332_10000598 3300031238 Bacteria 23662
330 Ga0265328_10003938 3300031239 Bacteria 6531
331 Ga0265320_10030637 3300031240 Bacteria 2771
332 Ga0265325_10015634 3300031241 Bacteria 4263
333 Ga0265340_10008554 3300031247 Bacteria 5521
334 Ga0265339_10004976 3300031249 Bacteria 8947
335 Ga0265331_10001346 3300031250 Bacteria 18107
336 Ga0265316_10000330 3300031344 Bacteria 52881
337 Ga0307513_10427459 3300031456 Bacteria 1053
338 Ga0307509_10012348 3300031507 Bacteria 10227
339 Ga0307509_10038670 3300031507 Bacteria 5203
340 Ga0307509_10121638 3300031507 Bacteria 2586
341 Ga0307408_100109086 3300031548 Unclassified 2123
342 Ga0307408_100185101 3300031548 Bacteria 1673
343 Ga0307408_100623193 3300031548 Bacteria 961
344 Ga0307408_100729174 3300031548 Bacteria 893
345 Ga0265313_10000573 3300031595 Bacteria 38431
346 Ga0307508_10000041 3300031616 Bacteria 147868
347 Ga0307508_10135153 3300031616 Unclassified 2069
348 Ga0316575_10014375 3300031665 Bacteria 2971
349 Ga0316575_10016338 3300031665 Bacteria 2807
350 Ga0316575_10030340 3300031665 Unclassified 2113
351 Ga0316575_10061954 3300031665 Bacteria 1495
352 Ga0316575_10134426 3300031665 Bacteria 1016
353 Ga0316579_10001192 3300031691 Bacteria 9303
354 Ga0316579_10002152 3300031691 Bacteria 7397
355 Ga0316579_10024820 3300031691 Unclassified 2701
356 Ga0316579_10059253 3300031691 Bacteria 1799
357 Ga0265314_10000159 3300031711 Bacteria 102733
358 Ga0265342_10002265 3300031712 Bacteria 16808
359 Ga0316576_10000791 3300031727 Bacteria 15916
360 Ga0316576_10007685 3300031727 Bacteria 6799
361 Ga0316576_10012284 3300031727 Bacteria 5652
362 Ga0316576_10021593 3300031727 Bacteria 4455
363 Ga0316576_10054697 3300031727 Unclassified 2911
364 Ga0316576_10061095 3300031727 Bacteria 2761
365 Ga0316576_10068242 3300031727 Unclassified 2619
366 Ga0316576_10085697 3300031727 Bacteria 2342
367 Ga0316578_10001317 3300031728 Bacteria 9949
368 Ga0316578_10003814 3300031728 Bacteria 6982
369 Ga0316578_10021545 3300031728 Unclassified 3578
370 Ga0316578_10090709 3300031728 Bacteria 1824
371 Ga0316577_10000496 3300031733 Bacteria 15596
372 Ga0316577_10004035 3300031733 Bacteria 7519
373 Ga0316577_10006976 3300031733 Bacteria 6005
374 Ga0316577_10049143 3300031733 Unclassified 2354
375 Ga0316577_10062444 3300031733 Unclassified 2080
376 Ga0316577_10206292 3300031733 Bacteria 1111
377 Ga0307413_10271587 3300031824 Unclassified 1270
378 Ga0307407_10130411 3300031903 Bacteria 1607
379 Ga0307416_100025015 3300032002 Unclassified 4370
380 Ga0307416_100037889 3300032002 Unclassified 3715
381 Ga0307416_100696797 3300032002 Bacteria 1104
382 Ga0307411_10078731 3300032005 Unclassified 2261
383 Ga0316583_10000414 3300032133 Bacteria 12499
384 Ga0316583_10007526 3300032133 Bacteria 3921
385 Ga0316583_10049303 3300032133 Bacteria 1482
386 Ga0316583_10055019 3300032133 Bacteria 1399
387 Ga0316583_10058208 3300032133 Bacteria 1356
388 Ga0316585_10001691 3300032137 Bacteria 5862
389 Ga0316585_10003135 3300032137 Bacteria 4512
390 Ga0316585_10021417 3300032137 Bacteria 1985
391 Ga0316580_10000480 3300032139 Bacteria 9215
392 Ga0316580_10020135 3300032139 Unclassified 2053
393 Ga0316580_10023377 3300032139 Bacteria 1908
394 Ga0316580_10023444 3300032139 Bacteria 1906
395 Ga0316580_10029729 3300032139 Bacteria 1691
396 Ga0316593_10001966 3300032168 Bacteria 4726
397 Ga0307507_10066250 3300033179 Bacteria 3313
398 Ga0316592_1010923 3300033524 Bacteria 1837
399 Ga0316596_1049048 3300033541 Bacteria 1116
400 Ga0373930_0011207 3300034816 Bacteria 1616
401 Ga0373948_0009510 3300034817 Bacteria 1677
402 Ga0373950_0043071 3300034818 Unclassified 869
403 Ga0373959_0031152 3300034820 Unclassified 1078
404 Ga0373926_0026171 3300035083 Bacteria 2039
405 Ga0373934_0014776 3300035086 Bacteria 2957
406 Ga0373934_0169594 3300035086 Unclassified 896
407 Ga0373940_0024035 3300035088 Bacteria 1577
408 Ga0373940_0076769 3300035088 Bacteria 981
409 Ga0373944_0045043 3300035089 Bacteria 1375
410 Ga0373949_0008362 3300035090 Bacteria 2265
411 Ga0373951_0070860 3300035091 Unclassified 888
412 Ga0373932_0012620 3300035112 Bacteria 2083
413 Ga0373936_0012256 3300035113 Bacteria 3259
414 Ga0373939_0026251 3300035114 Bacteria 1640
415 Ga0373941_0175270 3300035115 Unclassified 801
416 Ga0373941_0269533 3300035115 Unclassified 670
417 Ga0373941_0326412 3300035115 Bacteria 619
418 Ga0373945_0020753 3300035116 Bacteria 2252
419 Ga0373953_0081136 3300035117 Bacteria 1348
420 Ga0373954_0000129 3300035118 Bacteria 25852
421 Ga0373956_0034205 3300035119 Bacteria 2238
422 Ga0373956_0120504 3300035119 Bacteria 1225
423 Ga0373956_0131704 3300035119 Unclassified 1171
424 Ga0373960_0031189 3300035121 Bacteria 1489
425 Ga0373943_0030426 3300035170 Bacteria 2554
426 Ga0373946_0000875 3300035171 Bacteria 10362
427 Ga0373942_0009933 3300035207 Bacteria 2231
428 Ga0316574_0040587 3300035398 Bacteria 2866
429 Ga0316574_0128857 3300035398 Bacteria 1627
430 Ga0316574_0205754 3300035398 Bacteria 1263
431 Ga0316574_0245780 3300035398 Bacteria 1143
432 Ga0373924_0002317 3300035410 Bacteria 6391
433 Ga0373924_0120630 3300035410 Bacteria 1137
434 Ga0373931_0007034 3300035691 Bacteria 5294
435 Ga0373931_0029995 3300035691 Bacteria 2797
436 Ga0373931_0047102 3300035691 Bacteria 2281
437 Ga0373931_0049956 3300035691 Bacteria 2224
438 Ga0373931_0073419 3300035691 Bacteria 1872
439 Ga0373935_0071557 3300035692 Bacteria 2237
440 Ga0373927_0038597 3300035695 Bacteria 3100
441 Ga0373927_0207439 3300035695 Bacteria 1287
442 Ga0373933_0034476 3300035724 Bacteria 2950
443 Ga0373933_0138993 3300035724 Bacteria 1532
444 Ga0373933_0459378 3300035724 Unclassified 833
445 Ga0373937_0011632 3300036401 Bacteria 7726
446 Ga0373937_0022637 3300036401 Bacteria 5651
447 Ga0373937_0023653 3300036401 Bacteria 5536
448 Ga0373937_0108522 3300036401 Bacteria 2581
449 Ga0316582_0000895 3300036647 Bacteria 12221
450 Ga0316582_0001725 3300036647 Bacteria 9827
451 Ga0316582_0005625 3300036647 Bacteria 6481
452 Ga0316582_0031205 3300036647 Unclassified 3255
453 Ga0316582_0080297 3300036647 Unclassified 2128
454 Ga0316582_0124810 3300036647 Bacteria 1725
455 Ga0316582_0310280 3300036647 Unclassified 1084
456 Ga0316582_0566369 3300036647 Bacteria 782
457 Ga0316584_0007262 3300036712 Bacteria 7562
458 Ga0316584_0015186 3300036712 Bacteria 5503
459 Ga0316584_0019256 3300036712 Unclassified 4934
460 Ga0316584_0044087 3300036712 Unclassified 3326
461 Ga0316584_0072735 3300036712 Bacteria 2576
462 Ga0316584_0101218 3300036712 Bacteria 2157
463 Ga0316584_0196948 3300036712 Bacteria 1488
464 Ga0316584_0217255 3300036712 Unclassified 1406
465 Ga0316584_0270471 3300036712 Bacteria 1237
466 Ga0316584_0278246 3300036712 Bacteria 1216
467 Ga0316584_0360637 3300036712 Unclassified 1042
468 Ga0316584_0476269 3300036712 Bacteria 880
469 Ga0373925_0062474 3300037068 Bacteria 2800
470 Ga0373925_0070593 3300037068 Bacteria 2641
471 Ga0373925_0429752 3300037068 Bacteria 1080
472 Ga0316581_0043788 3300037588 Bacteria 1366
473 Ga0400491_09172 3300038727 Bacteria 1646
474 Ga0400485_04042 3300038735 Bacteria 23120
475 Ga0400486_04029 3300038742 Bacteria 63930
476 Ga0400483_203037 3300039062 Bacteria 1371
477 Ga0400489_19166 3300039093 Bacteria 10110
478 Ga0400489_83885 3300039093 Bacteria 14482
479 Ga0400487_56445 3300039110 Bacteria 32953
480 Ga0436365_0486298 3300039437 Bacteria 8040
481 Ga0439461_0002003 3300041410 Bacteria 3224
482 Ga0451807_0370026 3300041486 Bacteria 1518
483 Ga0439441_001358 3300042001 Bacteria 3167
484 Ga0439443_003421 3300042003 Bacteria 1998
485 Ga0439443_010585 3300042003 Unclassified 1338
486 Ga0439462_0040778 3300042015 Bacteria 1239
487 Ga0450910_053371 3300042147 Bacteria 671
488 Ga0439434_0000967 3300042435 Bacteria 8277
489 Ga0439435_0000371 3300042436 Bacteria 6877
490 Ga0439435_0000649 3300042436 Bacteria 5726
491 Ga0439435_0013916 3300042436 Bacteria 1979
492 Ga0439444_0005828 3300042437 Bacteria 1840
493 Ga0439460_0000878 3300042461 Bacteria 6875
494 Ga0439460_0011586 3300042461 Bacteria 2276
495 Ga0451577_0179412 3300042876 Bacteria 1909
496 Ga0451577_0410102 3300042876 Bacteria 1230
497 Ga0451577_0905730 3300042876 Bacteria 794
498 Ga0453683_0070980 3300044673 Unclassified 2178
499 Ga0466965_0434744 3300044683 Bacteria 729
500 Ga0453684_0040799 3300044712 Bacteria 6294
501 Ga0453684_0394056 3300044712 Bacteria 1552
502 Ga0466957_0077752 3300044842 Bacteria 2062
503 Ga0466960_0219048 3300044901 Bacteria 1047
504 Ga0451576_0004013 3300045051 Bacteria 19582
505 Ga0451576_0124571 3300045051 Unclassified 2685
506 Ga0451576_0145578 3300045051 Bacteria 2470
507 Ga0451576_0403650 3300045051 Bacteria 1433
508 Ga0466967_0158572 3300045976 Bacteria 2122
509 Ga0495592_0009905 3300046454 Bacteria 7176
510 Ga0495603_0010186 3300046455 Bacteria 5690
511 Ga0495580_0019598 3300046472 Bacteria 5025
512 Ga0495639_0053008 3300046475 Bacteria 1847
513 Ga0495662_0029234 3300046476 Bacteria 2661
514 Ga0495664_0133674 3300046477 Bacteria 1503
515 Ga0495608_0003736 3300046511 Bacteria 10928
516 Ga0495628_0000665 3300046516 Bacteria 31450
517 Ga0495628_0003842 3300046516 Bacteria 13395
518 Ga0495630_0089946 3300046517 Bacteria 2319
519 Ga0495632_0217553 3300046519 Bacteria 865
520 Ga0495666_0053849 3300046526 Bacteria 1930
521 Ga0495666_0078290 3300046526 Unclassified 1566
522 Ga0495642_0182622 3300046528 Bacteria 913
523 Ga0495652_0018806 3300046529 Bacteria 6157
524 Ga0495640_0005611 3300046533 Bacteria 9980
525 Ga0495640_0131338 3300046533 Bacteria 1621
526 Ga0495586_0002877 3300046535 Bacteria 9299
527 Ga0495586_0012202 3300046535 Bacteria 4562
528 Ga0495598_0003954 3300046537 Bacteria 3182
529 Ga0495598_0060408 3300046537 Bacteria 1168
530 Ga0495621_0128236 3300046539 Bacteria 985
531 Ga0495667_0018592 3300046559 Bacteria 4692
532 Ga0495667_0341931 3300046559 Bacteria 946
533 Ga0495634_0003859 3300046642 Bacteria 11899
534 Ga0495611_0128742 3300046648 Bacteria 1181
535 Ga0495635_0124275 3300046663 Bacteria 1759
536 Ga0495659_0073984 3300046664 Bacteria 1281
537 Ga0495588_0102297 3300046674 Bacteria 1506
538 Ga0495657_0112898 3300046675 Bacteria 1720
539 Ga0495599_0048412 3300046678 Bacteria 2665
540 Ga0495623_0220155 3300046679 Bacteria 1082
541 Ga0495647_0004536 3300046681 Bacteria 4518
542 Ga0495658_0002976 3300046683 Bacteria 8485
543 Ga0495658_0034744 3300046683 Bacteria 2768
544 Ga0495669_0018505 3300046684 Bacteria 2995
545 Ga0495613_0022572 3300046689 Bacteria 4687
546 Ga0495670_0240531 3300046691 Bacteria 964
547 Ga0495600_0085276 3300046809 Bacteria 2061
548 Ga0495581_0055652 3300047315 Bacteria 2283
549 Ga0495581_0215584 3300047315 Bacteria 1122
550 Ga0495604_0023166 3300047317 Bacteria 4956
551 Ga0495636_0001503 3300047318 Bacteria 8839
552 Ga0495674_0841876 3300047319 Unclassified 711
553 Ga0495680_0003153 3300047322 Bacteria 16423
554 Ga0495684_0080609 3300047471 Bacteria 2471
555 Ga0495593_0091221 3300047673 Bacteria 1569
556 Ga0495593_0158601 3300047673 Bacteria 1143
557 Ga0495615_0025724 3300048090 Bacteria 1369
558 Ga0495626_0071561 3300048091 Bacteria 1558
559 Ga0496100_0088854 3300048903 Unclassified 2104
560 Ga0496105_0171524 3300048908 Unclassified 1778
561 Ga0496108_0010030 3300048911 Bacteria 7681
562 Ga0496109_0047620 3300048912 Unclassified 3898
563 Ga0496110_0438354 3300048913 Unclassified 1191
564 Ga0496111_0742683 3300048914 Unclassified 712
565 Ga0496112_0435113 3300048915 Unclassified 1250
566 Ga0496114_0047310 3300048917 Unclassified 3578
567 Ga0501295_063308 3300049518 Bacteria 814
568 Ga0501303_020804 3300049526 Bacteria 698
569 Ga0501031_0569402 3300049568 Bacteria 729
570 Ga0501033_0004302 3300049570 Bacteria 11431
571 Ga0501033_0202638 3300049570 Bacteria 1417
572 Ga0501034_0248880 3300049571 Bacteria 1722
573 Ga0501036_0007640 3300049572 Bacteria 8825
574 Ga0501037_0077038 3300049573 Bacteria 2420
575 Ga0501038_0009797 3300049574 Bacteria 8773
576 Ga0501038_0083392 3300049574 Bacteria 2691
577 Ga0501038_0109946 3300049574 Bacteria 2284
578 Ga0501039_0040577 3300049575 Bacteria 3593
579 Ga0501039_0043405 3300049575 Bacteria 3473
580 Ga0501040_0010363 3300049576 Bacteria 6092
581 Ga0501040_0778790 3300049576 Unclassified 692
582 Ga0501041_0022283 3300049577 Bacteria 3791
583 Ga0501041_0072755 3300049577 Bacteria 2112
584 Ga0501041_0158155 3300049577 Bacteria 1416
585 Ga0501041_0423129 3300049577 Bacteria 845
586 Ga0501042_0036886 3300049578 Bacteria 3468
587 Ga0501042_0073104 3300049578 Bacteria 2453
588 Ga0501042_0525863 3300049578 Bacteria 859
589 Ga0501043_0206279 3300049579 Bacteria 1524
590 Ga0501046_0005657 3300049580 Bacteria 11155
591 Ga0501046_0699481 3300049580 Bacteria 714
592 Ga0501047_0039645 3300049581 Bacteria 4555
593 Ga0501048_0000710 3300049582 Bacteria 24338
594 Ga0501048_0049078 3300049582 Bacteria 3009
595 Ga0501068_0111785 3300049584 Bacteria 1699
596 Ga0501068_0122354 3300049584 Bacteria 1623
597 Ga0501071_0003868 3300049587 Bacteria 9430
598 Ga0501071_0006673 3300049587 Bacteria 7499
599 Ga0501071_0095521 3300049587 Bacteria 2187
600 Ga0501072_0005751 3300049588 Bacteria 9443
601 Ga0501072_0083125 3300049588 Bacteria 2538
602 Ga0501072_0138639 3300049588 Bacteria 1939
603 Ga0501073_0095529 3300049589 Bacteria 2064
604 Ga0501074_0012747 3300049590 Bacteria 6112
605 Ga0501075_0015580 3300049591 Bacteria 5456
606 Ga0501075_0020387 3300049591 Bacteria 4822
607 Ga0501075_0114606 3300049591 Bacteria 2049
608 Ga0501076_0006184 3300049592 Bacteria 8666
609 Ga0501076_0008009 3300049592 Bacteria 7717
610 Ga0501076_0016851 3300049592 Bacteria 5547
611 Ga0501076_0463939 3300049592 Bacteria 1043
612 Ga0501077_0023718 3300049593 Bacteria 3889
613 Ga0501077_0371600 3300049593 Unclassified 913
614 Ga0501208_037513 3300049655 Bacteria 884
615 Ga0501249_006974 3300049679 Bacteria 2328
616 Ga0501234_047494 3300049707 Bacteria 710
617 Ga0501079_0010905 3300049741 Bacteria 6922
618 Ga0501079_0022602 3300049741 Bacteria 4823
619 Ga0501079_0167374 3300049741 Bacteria 1714
620 Ga0501080_0007156 3300049742 Bacteria 10071
621 Ga0501080_0062202 3300049742 Bacteria 3474
622 Ga0501080_0227766 3300049742 Bacteria 1704
623 Ga0501081_0000714 3300049743 Bacteria 19270
624 Ga0501081_0006055 3300049743 Bacteria 7835
625 Ga0501081_0179226 3300049743 Bacteria 1532
626 Ga0501081_0933845 3300049743 Bacteria 655
627 Ga0501035_0061537 3300049822 Bacteria 3341
628 Ga0501035_0595198 3300049822 Bacteria 902
629 Ga0501044_0532326 3300049823 Bacteria 1074
630 Ga0501045_0004736 3300049824 Bacteria 9386
631 Ga0501045_0208343 3300049824 Bacteria 1456
632 Ga0501045_0275279 3300049824 Bacteria 1253
633 Ga0501045_0419573 3300049824 Unclassified 995
634 nmdc:mga0k408_206347_c1 3300050493 Unclassified 1173
635 nmdc:mga05p37_159_c1 3300050507 Bacteria 65013
636 nmdc:mga05p37_258357_c1 3300050507 Bacteria 2086
637 nmdc:mga05p37_336349_c1 3300050507 Bacteria 1782
638 nmdc:mga05p37_498195_c1 3300050507 Bacteria 1399
639 nmdc:mga09592_117342_c1 3300050508 Bacteria 2284
640 nmdc:mga09592_1447_c1 3300050508 Bacteria 19043
641 nmdc:mga09592_1672_c1 3300050508 Bacteria 17873
642 nmdc:mga09592_6035_c1 3300050508 Bacteria 9883
643 nmdc:mga09592_877384_c1 3300050508 Unclassified 755
644 nmdc:mga0qj67_145171_c1 3300050509 Bacteria 1924
645 nmdc:mga0qj67_18024_c1 3300050509 Bacteria 5378
646 nmdc:mga0qj67_645753_c1 3300050509 Bacteria 844
647 nmdc:mga0qj67_9360_c1 3300050509 Bacteria 7286
648 nmdc:mga06r32_11486_c1 3300050510 Bacteria 7976
649 nmdc:mga06r32_516208_c1 3300050510 Bacteria 1171
650 nmdc:mga06r32_91110_c1 3300050510 Bacteria 2979
651 nmdc:mga08y16_10893_c1 3300050511 Bacteria 9552
652 nmdc:mga08y16_14255_c1 3300050511 Bacteria 8365
653 nmdc:mga08y16_15839_c1 3300050511 Bacteria 7923
654 nmdc:mga08y16_159352_c1 3300050511 Bacteria 2345
655 nmdc:mga08y16_430243_c1 3300050511 Bacteria 1348
656 nmdc:mga08y16_7728_c1 3300050511 Bacteria 11261
657 nmdc:mga08y16_81071_c1 3300050511 Bacteria 3383
658 nmdc:mga0n895_201894_c1 3300050512 Bacteria 2019
659 nmdc:mga0n895_2433_c1 3300050512 Bacteria 14531
660 nmdc:mga0n895_9411_c1 3300050512 Bacteria 8548
661 nmdc:mga0rr50_210556_c1 3300050513 Bacteria 1601
662 nmdc:mga0rr50_24328_c1 3300050513 Bacteria 4194
663 nmdc:mga0rr50_25242_c1 3300050513 Bacteria 4129
664 nmdc:mga08x19_1548_c1 3300050514 Bacteria 14256
665 nmdc:mga08x19_18755_c1 3300050514 Bacteria 4241
666 nmdc:mga08x19_203710_c1 3300050514 Bacteria 1357
667 nmdc:mga08x19_38836_c1 3300050514 Bacteria 2464
668 nmdc:mga08x19_4750_c1 3300050514 Bacteria 8057
669 nmdc:mga0a205_1388_c1 3300050515 Bacteria 20474
670 nmdc:mga0a205_188178_c1 3300050515 Bacteria 1957
671 nmdc:mga0a205_74483_c1 3300050515 Bacteria 851
672 Ga0495601_0009858 3300053077 Bacteria 5656
673 Ga0495601_0124911 3300053077 Bacteria 1674
674 Ga0495619_0507850 3300053085 Bacteria 829
675 Ga0500583_0271088 3300053092 Bacteria 835
676 Ga0500594_0061966 3300053118 Unclassified 1081
677 Ga0501084_0031840 3300054114 Bacteria 4410
678 Ga0501084_0064215 3300054114 Bacteria 3073
679 Ga0501084_0105588 3300054114 Bacteria 2366
680 Ga0501084_0988669 3300054114 Bacteria 707
681 Ga0590071_062098 3300059421 Bacteria 914
682 Ga0501082_0215835 3300060353 Bacteria 1669
683 Ga0501082_0270301 3300060353 Bacteria 1479
684 Ga0501082_0343780 3300060353 Bacteria 1300
685 Ga0530510_0000803 3300061734 Bacteria 20450
686 Ga0530510_0003054 3300061734 Bacteria 11495

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10778625 Ga0157369_107786252 181
2 3300046519 Ga0495632_0217553 Ga0495632_0217553_17_583 181
3 3300031665 Ga0316575_10134426 Ga0316575_101344262 183
4 3300036712 Ga0316584_0196948 Ga0316584_0196948_351_989 183
5 3300005331 Ga0070670_100031414 Ga0070670_1000314143 184
6 3300006871 Ga0075434_100408239 Ga0075434_1004082391 184
7 3300006880 Ga0075429_100733082 Ga0075429_1007330822 184
8 3300025925 Ga0207650_10037338 Ga0207650_100373382 184
9 3300031733 Ga0316577_10000496 Ga0316577_100004966 184
10 3300032133 Ga0316583_10058208 Ga0316583_100582082 184
11 3300037588 Ga0316581_0043788 Ga0316581_0043788_793_1353 184
12 3300050515 nmdc:mga0a205_74483_c1 nmdc:mga0a205_74483_c1_128_760 184
13 3300031665 Ga0316575_10014375 Ga0316575_100143752 185
14 3300031727 Ga0316576_10061095 Ga0316576_100610952 189
15 3300005328 Ga0070676_10391663 Ga0070676_103916631 191
16 3300005331 Ga0070670_100967256 Ga0070670_1009672561 191
17 3300005336 Ga0070680_100646845 Ga0070680_1006468451 191
18 3300005435 Ga0070714_100121445 Ga0070714_1001214452 191
19 3300005535 Ga0070684_100066324 Ga0070684_1000663242 191
20 3300005539 Ga0068853_100434192 Ga0068853_1004341922 191
21 3300006846 Ga0075430_100075634 Ga0075430_1000756343 191
22 3300009148 Ga0105243_10810670 Ga0105243_108106701 191
23 3300013104 Ga0157370_10268514 Ga0157370_102685141 191
24 3300026121 Ga0207683_10475970 Ga0207683_104759702 191
25 3300027876 Ga0209974_10034481 Ga0209974_100344813 191
26 3300031548 Ga0307408_100109086 Ga0307408_1001090862 191
27 3300031824 Ga0307413_10271587 Ga0307413_102715872 191
28 3300032002 Ga0307416_100025015 Ga0307416_1000250153 191
29 3300032002 Ga0307416_100037889 Ga0307416_1000378893 191
30 3300032005 Ga0307411_10078731 Ga0307411_100787312 191
31 3300035088 Ga0373940_0024035 Ga0373940_0024035_956_1531 191
32 3300035115 Ga0373941_0269533 Ga0373941_0269533_61_636 191
33 3300035115 Ga0373941_0326412 Ga0373941_0326412_24_599 191
34 3300035207 Ga0373942_0009933 Ga0373942_0009933_26_601 191
35 3300035724 Ga0373933_0138993 Ga0373933_0138993_947_1522 191
36 3300036712 Ga0316584_0476269 Ga0316584_0476269_119_832 191
37 3300042147 Ga0450910_053371 Ga0450910_053371_62_637 191
38 3300049518 Ga0501295_063308 Ga0501295_063308_47_679 191
39 3300049526 Ga0501303_020804 Ga0501303_020804_33_665 191
40 3300049576 Ga0501040_0778790 Ga0501040_0778790_17_592 191
41 3300049679 Ga0501249_006974 Ga0501249_006974_1676_2308 191
42 3300049743 Ga0501081_0933845 Ga0501081_0933845_54_629 191
43 3300017792 Ga0163161_10517028 Ga0163161_105170282 192
44 3300031548 Ga0307408_100729174 Ga0307408_1007291741 194
45 iso_pu_bacteria 8022948649 8022954019 203
46 3300009545 Ga0105237_10000137 Ga0105237_1000013785 204
47 3300025914 Ga0207671_10001268 Ga0207671_1000126823 204
48 3300053085 Ga0495619_0507850 Ga0495619_0507850_109_723 204
49 iso_pu_bacteria 2857604169 2857607966 204
50 iso_pu_bacteria 2945991243 2945991989 204
51 iso_pu_bacteria 2946053406 2946054235 204
52 3300044673 Ga0453683_0070980 Ga0453683_0070980_1359_1994 207
53 3300044712 Ga0453684_0040799 Ga0453684_0040799_4784_5419 207
54 3300039062 Ga0400483_203037 Ga0400483_203037_689_1327 208
55 3300045051 Ga0451576_0124571 Ga0451576_0124571_143_775 208
56 3300004798 Ga0058859_10033578 Ga0058859_100335782 209
57 3300004800 Ga0058861_10058411 Ga0058861_100584111 209
58 3300004801 Ga0058860_12196631 Ga0058860_121966311 209
59 3300005295 Ga0065707_10146536 Ga0065707_101465362 209
60 3300005330 Ga0070690_100004639 Ga0070690_1000046397 209
61 3300005330 Ga0070690_100180716 Ga0070690_1001807162 209
62 3300005334 Ga0068869_100001704 Ga0068869_1000017047 209
63 3300005335 Ga0070666_10562615 Ga0070666_105626151 209
64 3300005336 Ga0070680_100002230 Ga0070680_1000022302 209
65 3300005336 Ga0070680_100147061 Ga0070680_1001470612 209
66 3300005336 Ga0070680_100151862 Ga0070680_1001518622 209
67 3300005337 Ga0070682_100000067 Ga0070682_10000006752 209
68 3300005338 Ga0068868_100057979 Ga0068868_1000579792 209
69 3300005340 Ga0070689_100057603 Ga0070689_1000576032 209
70 3300005340 Ga0070689_100221966 Ga0070689_1002219662 209
71 3300005341 Ga0070691_10001570 Ga0070691_1000157010 209
72 3300005343 Ga0070687_100000821 Ga0070687_1000008213 209
73 3300005343 Ga0070687_100506623 Ga0070687_1005066232 209
74 3300005345 Ga0070692_10095755 Ga0070692_100957551 209
75 3300005353 Ga0070669_100495355 Ga0070669_1004953552 209
76 3300005356 Ga0070674_100044977 Ga0070674_1000449773 209
77 3300005364 Ga0070673_100160848 Ga0070673_1001608482 209
78 3300005438 Ga0070701_10012125 Ga0070701_100121254 209
79 3300005440 Ga0070705_100012874 Ga0070705_1000128744 209
80 3300005440 Ga0070705_100014567 Ga0070705_1000145674 209
81 3300005440 Ga0070705_100021347 Ga0070705_1000213473 209
82 3300005440 Ga0070705_100095597 Ga0070705_1000955972 209
83 3300005440 Ga0070705_100105337 Ga0070705_1001053372 209
84 3300005441 Ga0070700_100004048 Ga0070700_1000040487 209
85 3300005441 Ga0070700_100076611 Ga0070700_1000766112 209
86 3300005444 Ga0070694_100004096 Ga0070694_1000040963 209
87 3300005444 Ga0070694_100019702 Ga0070694_1000197024 209
88 3300005444 Ga0070694_100236780 Ga0070694_1002367802 209
89 3300005444 Ga0070694_100255878 Ga0070694_1002558781 209
90 3300005444 Ga0070694_100362047 Ga0070694_1003620472 209
91 3300005445 Ga0070708_100286305 Ga0070708_1002863052 209
92 3300005456 Ga0070678_100687157 Ga0070678_1006871571 209
93 3300005458 Ga0070681_10000720 Ga0070681_1000072014 209
94 3300005458 Ga0070681_10181712 Ga0070681_101817122 209
95 3300005459 Ga0068867_100006962 Ga0068867_1000069627 209
96 3300005459 Ga0068867_100007000 Ga0068867_1000070006 209
97 3300005459 Ga0068867_100688865 Ga0068867_1006888652 209
98 3300005467 Ga0070706_100300453 Ga0070706_1003004532 209
99 3300005468 Ga0070707_100067608 Ga0070707_1000676081 209
100 3300005530 Ga0070679_100041060 Ga0070679_1000410605 209
101 3300005536 Ga0070697_100089743 Ga0070697_1000897432 209
102 3300005543 Ga0070672_100028480 Ga0070672_1000284802 209
103 3300005544 Ga0070686_100003451 Ga0070686_1000034512 209
104 3300005544 Ga0070686_100024914 Ga0070686_1000249144 209
105 3300005545 Ga0070695_100001782 Ga0070695_1000017822 209
106 3300005545 Ga0070695_100161565 Ga0070695_1001615652 209
107 3300005545 Ga0070695_100230913 Ga0070695_1002309131 209
108 3300005546 Ga0070696_100031211 Ga0070696_1000312115 209
109 3300005547 Ga0070693_100027535 Ga0070693_1000275353 209
110 3300005547 Ga0070693_100234627 Ga0070693_1002346272 209
111 3300005549 Ga0070704_100004949 Ga0070704_1000049499 209
112 3300005549 Ga0070704_100019763 Ga0070704_1000197634 209
113 3300005549 Ga0070704_100115794 Ga0070704_1001157942 209
114 3300005549 Ga0070704_100225158 Ga0070704_1002251582 209
115 3300005563 Ga0068855_100005265 Ga0068855_1000052652 209
116 3300005578 Ga0068854_100070570 Ga0068854_1000705703 209
117 3300005614 Ga0068856_100013045 Ga0068856_1000130457 209
118 3300005614 Ga0068856_100769210 Ga0068856_1007692101 209
119 3300005615 Ga0070702_100001902 Ga0070702_1000019028 209
120 3300005615 Ga0070702_100033529 Ga0070702_1000335293 209
121 3300005616 Ga0068852_100221920 Ga0068852_1002219202 209
122 3300005617 Ga0068859_100033006 Ga0068859_1000330064 209
123 3300005617 Ga0068859_100050635 Ga0068859_1000506355 209
124 3300005617 Ga0068859_100258639 Ga0068859_1002586392 209
125 3300005618 Ga0068864_100104887 Ga0068864_1001048872 209
126 3300005718 Ga0068866_10001148 Ga0068866_100011486 209
127 3300005718 Ga0068866_10021798 Ga0068866_100217983 209
128 3300005719 Ga0068861_100034873 Ga0068861_1000348733 209
129 3300005841 Ga0068863_100345866 Ga0068863_1003458662 209
130 3300005841 Ga0068863_100684378 Ga0068863_1006843781 209
131 3300005842 Ga0068858_100071360 Ga0068858_1000713603 209
132 3300005843 Ga0068860_100190370 Ga0068860_1001903701 209
133 3300005843 Ga0068860_100431537 Ga0068860_1004315372 209
134 3300005844 Ga0068862_100018223 Ga0068862_1000182233 209
135 3300005844 Ga0068862_100136303 Ga0068862_1001363032 209
136 3300005981 Ga0081538_10036883 Ga0081538_100368833 209
137 3300005985 Ga0081539_10002158 Ga0081539_100021585 209
138 3300006163 Ga0070715_10054753 Ga0070715_100547532 209
139 3300006237 Ga0097621_100101724 Ga0097621_1001017242 209
140 3300006237 Ga0097621_100158256 Ga0097621_1001582562 209
141 3300006358 Ga0068871_100009825 Ga0068871_1000098252 209
142 3300006358 Ga0068871_100036675 Ga0068871_1000366752 209
143 3300006844 Ga0075428_100005942 Ga0075428_1000059422 209
144 3300006844 Ga0075428_100016454 Ga0075428_1000164544 209
145 3300006844 Ga0075428_100032886 Ga0075428_1000328866 209
146 3300006846 Ga0075430_100013066 Ga0075430_1000130665 209
147 3300006846 Ga0075430_100142818 Ga0075430_1001428182 209
148 3300006846 Ga0075430_100271399 Ga0075430_1002713992 209
149 3300006846 Ga0075430_100331034 Ga0075430_1003310342 209
150 3300006846 Ga0075430_100441106 Ga0075430_1004411062 209
151 3300006847 Ga0075431_100007501 Ga0075431_1000075014 209
152 3300006847 Ga0075431_100229406 Ga0075431_1002294062 209
153 3300006847 Ga0075431_100508616 Ga0075431_1005086162 209
154 3300006871 Ga0075434_100000637 Ga0075434_10000063728 209
155 3300006871 Ga0075434_100027268 Ga0075434_1000272685 209
156 3300006880 Ga0075429_100002429 Ga0075429_10000242910 209
157 3300006880 Ga0075429_100165976 Ga0075429_1001659762 209
158 3300006881 Ga0068865_100020691 Ga0068865_1000206914 209
159 3300006914 Ga0075436_100002105 Ga0075436_10000210511 209
160 3300006914 Ga0075436_100009310 Ga0075436_1000093107 209
161 3300006914 Ga0075436_100333261 Ga0075436_1003332612 209
162 3300006914 Ga0075436_100355268 Ga0075436_1003552682 209
163 3300006931 Ga0097620_100033005 Ga0097620_1000330056 209
164 3300006931 Ga0097620_100050640 Ga0097620_1000506405 209
165 3300006931 Ga0097620_100258639 Ga0097620_1002586392 209
166 3300007076 Ga0075435_100011829 Ga0075435_1000118297 209
167 3300007076 Ga0075435_100022586 Ga0075435_1000225863 209
168 3300007076 Ga0075435_100219341 Ga0075435_1002193412 209
169 3300007265 Ga0099794_10016647 Ga0099794_100166472 209
170 3300009093 Ga0105240_10719459 Ga0105240_107194592 209
171 3300009094 Ga0111539_10254824 Ga0111539_102548242 209
172 3300009098 Ga0105245_10004171 Ga0105245_100041712 209
173 3300009147 Ga0114129_10007266 Ga0114129_100072667 209
174 3300009147 Ga0114129_10311632 Ga0114129_103116322 209
175 3300009148 Ga0105243_10084982 Ga0105243_100849822 209
176 3300009148 Ga0105243_10286988 Ga0105243_102869882 209
177 3300009174 Ga0105241_10011280 Ga0105241_100112802 209
178 3300009176 Ga0105242_10003038 Ga0105242_100030382 209
179 3300009177 Ga0105248_10111632 Ga0105248_101116322 209
180 3300009553 Ga0105249_10035913 Ga0105249_100359135 209
181 3300010375 Ga0105239_10657321 Ga0105239_106573212 209
182 3300013297 Ga0157378_10011451 Ga0157378_100114512 209
183 3300013297 Ga0157378_10023055 Ga0157378_100230552 209
184 3300013306 Ga0163162_10134166 Ga0163162_101341663 209
185 3300014326 Ga0157380_10042501 Ga0157380_100425013 209
186 3300014326 Ga0157380_10239130 Ga0157380_102391301 209
187 3300014745 Ga0157377_10212957 Ga0157377_102129572 209
188 3300014968 Ga0157379_10132788 Ga0157379_101327882 209
189 3300014969 Ga0157376_10008195 Ga0157376_100081957 209
190 3300014969 Ga0157376_10633135 Ga0157376_106331351 209
191 3300017792 Ga0163161_10090480 Ga0163161_100904801 209
192 3300025885 Ga0207653_10013523 Ga0207653_100135232 209
193 3300025893 Ga0207682_10017696 Ga0207682_100176963 209
194 3300025899 Ga0207642_10019300 Ga0207642_100193002 209
195 3300025899 Ga0207642_10019861 Ga0207642_100198612 209
196 3300025905 Ga0207685_10003876 Ga0207685_100038764 209
197 3300025907 Ga0207645_10059989 Ga0207645_100599892 209
198 3300025907 Ga0207645_10279262 Ga0207645_102792622 209
199 3300025908 Ga0207643_10022173 Ga0207643_100221733 209
200 3300025908 Ga0207643_10087835 Ga0207643_100878352 209
201 3300025912 Ga0207707_10015506 Ga0207707_100155062 209
202 3300025917 Ga0207660_10036650 Ga0207660_100366503 209
203 3300025917 Ga0207660_10096295 Ga0207660_100962952 209
204 3300025917 Ga0207660_10543360 Ga0207660_105433602 209
205 3300025918 Ga0207662_10000163 Ga0207662_100001632 209
206 3300025918 Ga0207662_10185761 Ga0207662_101857611 209
207 3300025921 Ga0207652_10048128 Ga0207652_100481283 209
208 3300025923 Ga0207681_10013598 Ga0207681_100135983 209
209 3300025927 Ga0207687_10005036 Ga0207687_100050362 209
210 3300025933 Ga0207706_10364202 Ga0207706_103642022 209
211 3300025934 Ga0207686_10009441 Ga0207686_100094412 209
212 3300025935 Ga0207709_10005265 Ga0207709_100052657 209
213 3300025935 Ga0207709_10151407 Ga0207709_101514072 209
214 3300025935 Ga0207709_10388809 Ga0207709_103888091 209
215 3300025936 Ga0207670_10039813 Ga0207670_100398133 209
216 3300025937 Ga0207669_10067790 Ga0207669_100677903 209
217 3300025937 Ga0207669_10180198 Ga0207669_101801982 209
218 3300025938 Ga0207704_10002799 Ga0207704_100027992 209
219 3300025940 Ga0207691_10112465 Ga0207691_101124652 209
220 3300025940 Ga0207691_10253063 Ga0207691_102530632 209
221 3300025941 Ga0207711_10384812 Ga0207711_103848121 209
222 3300025942 Ga0207689_10004260 Ga0207689_1000426012 209
223 3300025942 Ga0207689_10155942 Ga0207689_101559423 209
224 3300025949 Ga0207667_10023823 Ga0207667_100238236 209
225 3300025961 Ga0207712_10013646 Ga0207712_100136462 209
226 3300025961 Ga0207712_10073959 Ga0207712_100739593 209
227 3300025981 Ga0207640_10013576 Ga0207640_100135762 209
228 3300026023 Ga0207677_10004527 Ga0207677_100045277 209
229 3300026035 Ga0207703_10130021 Ga0207703_101300212 209
230 3300026041 Ga0207639_10779526 Ga0207639_107795261 209
231 3300026075 Ga0207708_10000681 Ga0207708_1000068127 209
232 3300026075 Ga0207708_10025718 Ga0207708_100257183 209
233 3300026075 Ga0207708_10384773 Ga0207708_103847732 209
234 3300026075 Ga0207708_10769210 Ga0207708_107692101 209
235 3300026078 Ga0207702_10245149 Ga0207702_102451492 209
236 3300026078 Ga0207702_10416792 Ga0207702_104167922 209
237 3300026089 Ga0207648_10003529 Ga0207648_1000352915 209
238 3300026089 Ga0207648_10032369 Ga0207648_100323694 209
239 3300026116 Ga0207674_10276961 Ga0207674_102769611 209
240 3300026118 Ga0207675_100008285 Ga0207675_1000082853 209
241 3300026118 Ga0207675_100036108 Ga0207675_1000361082 209
242 3300026142 Ga0207698_10137664 Ga0207698_101376642 209
243 3300027360 Ga0209969_1001056 Ga0209969_10010562 209
244 3300027360 Ga0209969_1003774 Ga0209969_10037742 209
245 3300027364 Ga0209967_1001952 Ga0209967_10019522 209
246 3300027364 Ga0209967_1003896 Ga0209967_10038962 209
247 3300027364 Ga0209967_1006633 Ga0209967_10066332 209
248 3300027378 Ga0209981_1003912 Ga0209981_10039122 209
249 3300027378 Ga0209981_1024359 Ga0209981_10243592 209
250 3300027462 Ga0210000_1001599 Ga0210000_10015992 209
251 3300027471 Ga0209995_1007921 Ga0209995_10079212 209
252 3300027526 Ga0209968_1011259 Ga0209968_10112592 209
253 3300027526 Ga0209968_1021452 Ga0209968_10214522 209
254 3300027543 Ga0209999_1002337 Ga0209999_10023372 209
255 3300027543 Ga0209999_1003514 Ga0209999_10035142 209
256 3300027552 Ga0209982_1006927 Ga0209982_10069272 209
257 3300027614 Ga0209970_1010270 Ga0209970_10102702 209
258 3300027665 Ga0209983_1012983 Ga0209983_10129832 209
259 3300027671 Ga0209588_1027513 Ga0209588_10275132 209
260 3300027682 Ga0209971_1002199 Ga0209971_10021992 209
261 3300027695 Ga0209966_1072428 Ga0209966_10724281 209
262 3300027876 Ga0209974_10023562 Ga0209974_100235622 209
263 3300027907 Ga0207428_10009598 Ga0207428_100095986 209
264 3300027907 Ga0207428_10104029 Ga0207428_101040292 209
265 3300028380 Ga0268265_10009420 Ga0268265_100094206 209
266 3300028380 Ga0268265_10023106 Ga0268265_100231062 209
267 3300028381 Ga0268264_10063281 Ga0268264_100632813 209
268 3300028381 Ga0268264_10536139 Ga0268264_105361392 209
269 3300031548 Ga0307408_100185101 Ga0307408_1001851012 209
270 3300031548 Ga0307408_100623193 Ga0307408_1006231932 209
271 3300032002 Ga0307416_100696797 Ga0307416_1006967972 209
272 3300034816 Ga0373930_0011207 Ga0373930_0011207_352_981 209
273 3300034817 Ga0373948_0009510 Ga0373948_0009510_49_678 209
274 3300034818 Ga0373950_0043071 Ga0373950_0043071_127_756 209
275 3300034820 Ga0373959_0031152 Ga0373959_0031152_260_889 209
276 3300035083 Ga0373926_0026171 Ga0373926_0026171_573_1202 209
277 3300035086 Ga0373934_0169594 Ga0373934_0169594_58_687 209
278 3300035089 Ga0373944_0045043 Ga0373944_0045043_708_1337 209
279 3300035090 Ga0373949_0008362 Ga0373949_0008362_359_988 209
280 3300035091 Ga0373951_0070860 Ga0373951_0070860_163_792 209
281 3300035112 Ga0373932_0012620 Ga0373932_0012620_1285_1914 209
282 3300035113 Ga0373936_0012256 Ga0373936_0012256_594_1223 209
283 3300035114 Ga0373939_0026251 Ga0373939_0026251_928_1557 209
284 3300035115 Ga0373941_0175270 Ga0373941_0175270_139_768 209
285 3300035116 Ga0373945_0020753 Ga0373945_0020753_824_1453 209
286 3300035118 Ga0373954_0000129 Ga0373954_0000129_19451_20080 209
287 3300035119 Ga0373956_0120504 Ga0373956_0120504_74_703 209
288 3300035119 Ga0373956_0131704 Ga0373956_0131704_394_1023 209
289 3300035121 Ga0373960_0031189 Ga0373960_0031189_218_847 209
290 3300035170 Ga0373943_0030426 Ga0373943_0030426_594_1223 209
291 3300035171 Ga0373946_0000875 Ga0373946_0000875_710_1339 209
292 3300035410 Ga0373924_0120630 Ga0373924_0120630_447_1076 209
293 3300035691 Ga0373931_0007034 Ga0373931_0007034_968_1597 209
294 3300035691 Ga0373931_0047102 Ga0373931_0047102_653_1282 209
295 3300035691 Ga0373931_0073419 Ga0373931_0073419_784_1413 209
296 3300035692 Ga0373935_0071557 Ga0373935_0071557_827_1456 209
297 3300035695 Ga0373927_0038597 Ga0373927_0038597_675_1304 209
298 3300035724 Ga0373933_0034476 Ga0373933_0034476_1286_1915 209
299 3300035724 Ga0373933_0459378 Ga0373933_0459378_147_776 209
300 3300036401 Ga0373937_0011632 Ga0373937_0011632_768_1397 209
301 3300036401 Ga0373937_0023653 Ga0373937_0023653_610_1239 209
302 3300036401 Ga0373937_0108522 Ga0373937_0108522_1849_2478 209
303 3300037068 Ga0373925_0062474 Ga0373925_0062474_1352_1981 209
304 3300037068 Ga0373925_0429752 Ga0373925_0429752_300_929 209
305 3300041410 Ga0439461_0002003 Ga0439461_0002003_1996_2625 209
306 3300042001 Ga0439441_001358 Ga0439441_001358_629_1258 209
307 3300042003 Ga0439443_003421 Ga0439443_003421_627_1256 209
308 3300042003 Ga0439443_010585 Ga0439443_010585_646_1275 209
309 3300042015 Ga0439462_0040778 Ga0439462_0040778_526_1155 209
310 3300042435 Ga0439434_0000967 Ga0439434_0000967_3374_4003 209
311 3300042436 Ga0439435_0000371 Ga0439435_0000371_2057_2686 209
312 3300042436 Ga0439435_0000649 Ga0439435_0000649_2497_3126 209
313 3300042436 Ga0439435_0013916 Ga0439435_0013916_852_1481 209
314 3300042437 Ga0439444_0005828 Ga0439444_0005828_1095_1724 209
315 3300042461 Ga0439460_0000878 Ga0439460_0000878_5494_6123 209
316 3300042461 Ga0439460_0011586 Ga0439460_0011586_206_835 209
317 3300042876 Ga0451577_0179412 Ga0451577_0179412_985_1614 209
318 3300042876 Ga0451577_0410102 Ga0451577_0410102_314_943 209
319 3300044683 Ga0466965_0434744 Ga0466965_0434744_40_669 209
320 3300044842 Ga0466957_0077752 Ga0466957_0077752_735_1364 209
321 3300044901 Ga0466960_0219048 Ga0466960_0219048_400_1029 209
322 3300045051 Ga0451576_0004013 Ga0451576_0004013_17439_18068 209
323 3300045051 Ga0451576_0403650 Ga0451576_0403650_426_1055 209
324 3300045976 Ga0466967_0158572 Ga0466967_0158572_588_1217 209
325 3300046454 Ga0495592_0009905 Ga0495592_0009905_1436_2065 209
326 3300046455 Ga0495603_0010186 Ga0495603_0010186_174_803 209
327 3300046472 Ga0495580_0019598 Ga0495580_0019598_3844_4473 209
328 3300046475 Ga0495639_0053008 Ga0495639_0053008_989_1618 209
329 3300046476 Ga0495662_0029234 Ga0495662_0029234_1640_2269 209
330 3300046511 Ga0495608_0003736 Ga0495608_0003736_3223_3852 209
331 3300046516 Ga0495628_0003842 Ga0495628_0003842_5642_6271 209
332 3300046517 Ga0495630_0089946 Ga0495630_0089946_244_873 209
333 3300046526 Ga0495666_0053849 Ga0495666_0053849_478_1107 209
334 3300046528 Ga0495642_0182622 Ga0495642_0182622_112_741 209
335 3300046529 Ga0495652_0018806 Ga0495652_0018806_1338_1967 209
336 3300046533 Ga0495640_0005611 Ga0495640_0005611_4998_5627 209
337 3300046533 Ga0495640_0131338 Ga0495640_0131338_349_978 209
338 3300046535 Ga0495586_0002877 Ga0495586_0002877_7496_8125 209
339 3300046535 Ga0495586_0012202 Ga0495586_0012202_3047_3676 209
340 3300046537 Ga0495598_0003954 Ga0495598_0003954_65_694 209
341 3300046537 Ga0495598_0060408 Ga0495598_0060408_348_977 209
342 3300046559 Ga0495667_0018592 Ga0495667_0018592_1093_1722 209
343 3300046642 Ga0495634_0003859 Ga0495634_0003859_4764_5393 209
344 3300046663 Ga0495635_0124275 Ga0495635_0124275_919_1548 209
345 3300046664 Ga0495659_0073984 Ga0495659_0073984_195_824 209
346 3300046674 Ga0495588_0102297 Ga0495588_0102297_749_1384 209
347 3300046678 Ga0495599_0048412 Ga0495599_0048412_1132_1761 209
348 3300046679 Ga0495623_0220155 Ga0495623_0220155_382_1011 209
349 3300046681 Ga0495647_0004536 Ga0495647_0004536_1093_1722 209
350 3300046683 Ga0495658_0002976 Ga0495658_0002976_6830_7459 209
351 3300046683 Ga0495658_0034744 Ga0495658_0034744_885_1514 209
352 3300046689 Ga0495613_0022572 Ga0495613_0022572_3449_4078 209
353 3300046691 Ga0495670_0240531 Ga0495670_0240531_141_770 209
354 3300047315 Ga0495581_0055652 Ga0495581_0055652_691_1320 209
355 3300047317 Ga0495604_0023166 Ga0495604_0023166_3131_3760 209
356 3300047318 Ga0495636_0001503 Ga0495636_0001503_3605_4234 209
357 3300047322 Ga0495680_0003153 Ga0495680_0003153_4610_5239 209
358 3300047471 Ga0495684_0080609 Ga0495684_0080609_406_1035 209
359 3300047673 Ga0495593_0091221 Ga0495593_0091221_573_1202 209
360 3300047673 Ga0495593_0158601 Ga0495593_0158601_436_1065 209
361 3300048090 Ga0495615_0025724 Ga0495615_0025724_64_693 209
362 3300049568 Ga0501031_0569402 Ga0501031_0569402_66_695 209
363 3300049570 Ga0501033_0004302 Ga0501033_0004302_835_1464 209
364 3300049570 Ga0501033_0202638 Ga0501033_0202638_517_1146 209
365 3300049571 Ga0501034_0248880 Ga0501034_0248880_1072_1701 209
366 3300049572 Ga0501036_0007640 Ga0501036_0007640_2770_3399 209
367 3300049573 Ga0501037_0077038 Ga0501037_0077038_78_707 209
368 3300049574 Ga0501038_0009797 Ga0501038_0009797_7288_7917 209
369 3300049574 Ga0501038_0083392 Ga0501038_0083392_1475_2104 209
370 3300049574 Ga0501038_0109946 Ga0501038_0109946_1468_2097 209
371 3300049575 Ga0501039_0040577 Ga0501039_0040577_2489_3118 209
372 3300049575 Ga0501039_0043405 Ga0501039_0043405_1397_2026 209
373 3300049576 Ga0501040_0010363 Ga0501040_0010363_835_1464 209
374 3300049577 Ga0501041_0022283 Ga0501041_0022283_2079_2708 209
375 3300049577 Ga0501041_0072755 Ga0501041_0072755_777_1406 209
376 3300049577 Ga0501041_0158155 Ga0501041_0158155_332_961 209
377 3300049577 Ga0501041_0423129 Ga0501041_0423129_178_807 209
378 3300049578 Ga0501042_0036886 Ga0501042_0036886_780_1409 209
379 3300049578 Ga0501042_0073104 Ga0501042_0073104_1357_1986 209
380 3300049578 Ga0501042_0525863 Ga0501042_0525863_108_737 209
381 3300049579 Ga0501043_0206279 Ga0501043_0206279_589_1218 209
382 3300049580 Ga0501046_0005657 Ga0501046_0005657_9616_10245 209
383 3300049580 Ga0501046_0699481 Ga0501046_0699481_60_689 209
384 3300049581 Ga0501047_0039645 Ga0501047_0039645_3117_3746 209
385 3300049582 Ga0501048_0000710 Ga0501048_0000710_22722_23351 209
386 3300049582 Ga0501048_0049078 Ga0501048_0049078_1398_2027 209
387 3300049584 Ga0501068_0111785 Ga0501068_0111785_135_764 209
388 3300049584 Ga0501068_0122354 Ga0501068_0122354_921_1550 209
389 3300049587 Ga0501071_0003868 Ga0501071_0003868_933_1562 209
390 3300049587 Ga0501071_0006673 Ga0501071_0006673_1103_1732 209
391 3300049587 Ga0501071_0095521 Ga0501071_0095521_1533_2162 209
392 3300049588 Ga0501072_0005751 Ga0501072_0005751_1808_2437 209
393 3300049588 Ga0501072_0083125 Ga0501072_0083125_1584_2213 209
394 3300049588 Ga0501072_0138639 Ga0501072_0138639_635_1264 209
395 3300049589 Ga0501073_0095529 Ga0501073_0095529_436_1065 209
396 3300049590 Ga0501074_0012747 Ga0501074_0012747_1371_2000 209
397 3300049591 Ga0501075_0015580 Ga0501075_0015580_831_1460 209
398 3300049591 Ga0501075_0020387 Ga0501075_0020387_1887_2516 209
399 3300049591 Ga0501075_0114606 Ga0501075_0114606_268_897 209
400 3300049592 Ga0501076_0006184 Ga0501076_0006184_6989_7618 209
401 3300049592 Ga0501076_0008009 Ga0501076_0008009_6458_7087 209
402 3300049592 Ga0501076_0016851 Ga0501076_0016851_2340_2969 209
403 3300049592 Ga0501076_0463939 Ga0501076_0463939_194_823 209
404 3300049593 Ga0501077_0023718 Ga0501077_0023718_3155_3784 209
405 3300049593 Ga0501077_0371600 Ga0501077_0371600_17_646 209
406 3300049655 Ga0501208_037513 Ga0501208_037513_207_836 209
407 3300049707 Ga0501234_047494 Ga0501234_047494_32_661 209
408 3300049741 Ga0501079_0010905 Ga0501079_0010905_4929_5558 209
409 3300049741 Ga0501079_0022602 Ga0501079_0022602_2337_2966 209
410 3300049741 Ga0501079_0167374 Ga0501079_0167374_895_1524 209
411 3300049742 Ga0501080_0007156 Ga0501080_0007156_749_1378 209
412 3300049742 Ga0501080_0062202 Ga0501080_0062202_1762_2391 209
413 3300049742 Ga0501080_0227766 Ga0501080_0227766_263_892 209
414 3300049743 Ga0501081_0000714 Ga0501081_0000714_3450_4079 209
415 3300049743 Ga0501081_0006055 Ga0501081_0006055_2187_2816 209
416 3300049743 Ga0501081_0179226 Ga0501081_0179226_344_973 209
417 3300049822 Ga0501035_0061537 Ga0501035_0061537_1320_1949 209
418 3300049822 Ga0501035_0595198 Ga0501035_0595198_92_721 209
419 3300049823 Ga0501044_0532326 Ga0501044_0532326_247_876 209
420 3300049824 Ga0501045_0004736 Ga0501045_0004736_7310_7939 209
421 3300049824 Ga0501045_0208343 Ga0501045_0208343_801_1430 209
422 3300049824 Ga0501045_0275279 Ga0501045_0275279_361_990 209
423 3300049824 Ga0501045_0419573 Ga0501045_0419573_206_835 209
424 3300050507 nmdc:mga05p37_159_c1 nmdc:mga05p37_159_c1_15671_16300 209
425 3300050507 nmdc:mga05p37_336349_c1 nmdc:mga05p37_336349_c1_335_964 209
426 3300050508 nmdc:mga09592_1447_c1 nmdc:mga09592_1447_c1_7090_7719 209
427 3300050508 nmdc:mga09592_1672_c1 nmdc:mga09592_1672_c1_12520_13149 209
428 3300050508 nmdc:mga09592_6035_c1 nmdc:mga09592_6035_c1_4181_4810 209
429 3300050509 nmdc:mga0qj67_145171_c1 nmdc:mga0qj67_145171_c1_508_1137 209
430 3300050509 nmdc:mga0qj67_18024_c1 nmdc:mga0qj67_18024_c1_2296_2925 209
431 3300050509 nmdc:mga0qj67_645753_c1 nmdc:mga0qj67_645753_c1_190_819 209
432 3300050509 nmdc:mga0qj67_9360_c1 nmdc:mga0qj67_9360_c1_2919_3548 209
433 3300050510 nmdc:mga06r32_11486_c1 nmdc:mga06r32_11486_c1_183_812 209
434 3300050510 nmdc:mga06r32_516208_c1 nmdc:mga06r32_516208_c1_200_829 209
435 3300050510 nmdc:mga06r32_91110_c1 nmdc:mga06r32_91110_c1_2298_2927 209
436 3300050511 nmdc:mga08y16_10893_c1 nmdc:mga08y16_10893_c1_5154_5783 209
437 3300050511 nmdc:mga08y16_159352_c1 nmdc:mga08y16_159352_c1_197_826 209
438 3300050512 nmdc:mga0n895_201894_c1 nmdc:mga0n895_201894_c1_957_1586 209
439 3300050512 nmdc:mga0n895_9411_c1 nmdc:mga0n895_9411_c1_2644_3273 209
440 3300050513 nmdc:mga0rr50_24328_c1 nmdc:mga0rr50_24328_c1_902_1531 209
441 3300050514 nmdc:mga08x19_18755_c1 nmdc:mga08x19_18755_c1_2480_3109 209
442 3300050515 nmdc:mga0a205_1388_c1 nmdc:mga0a205_1388_c1_17351_17980 209
443 3300053077 Ga0495601_0009858 Ga0495601_0009858_2087_2716 209
444 3300054114 Ga0501084_0031840 Ga0501084_0031840_2684_3313 209
445 3300054114 Ga0501084_0064215 Ga0501084_0064215_1226_1855 209
446 3300054114 Ga0501084_0105588 Ga0501084_0105588_1020_1649 209
447 3300054114 Ga0501084_0988669 Ga0501084_0988669_31_660 209
448 3300059421 Ga0590071_062098 Ga0590071_062098_49_678 209
449 3300060353 Ga0501082_0215835 Ga0501082_0215835_188_817 209
450 3300060353 Ga0501082_0270301 Ga0501082_0270301_43_672 209
451 3300060353 Ga0501082_0343780 Ga0501082_0343780_650_1279 209
452 3300061734 Ga0530510_0000803 Ga0530510_0000803_10125_10754 209
453 3300061734 Ga0530510_0003054 Ga0530510_0003054_787_1416 209
454 3300005328 Ga0070676_10022726 Ga0070676_100227262 210
455 3300005330 Ga0070690_100034888 Ga0070690_1000348881 210
456 3300005331 Ga0070670_100022786 Ga0070670_1000227862 210
457 3300005333 Ga0070677_10042471 Ga0070677_100424712 210
458 3300005334 Ga0068869_100552509 Ga0068869_1005525091 210
459 3300005335 Ga0070666_10004229 Ga0070666_100042297 210
460 3300005336 Ga0070680_100259184 Ga0070680_1002591842 210
461 3300005338 Ga0068868_100044416 Ga0068868_1000444162 210
462 3300005344 Ga0070661_100074138 Ga0070661_1000741382 210
463 3300005347 Ga0070668_100079471 Ga0070668_1000794712 210
464 3300005353 Ga0070669_100087566 Ga0070669_1000875662 210
465 3300005354 Ga0070675_100031415 Ga0070675_1000314152 210
466 3300005355 Ga0070671_100012951 Ga0070671_1000129514 210
467 3300005356 Ga0070674_100000282 Ga0070674_10000028220 210
468 3300005364 Ga0070673_100000027 Ga0070673_10000002729 210
469 3300005366 Ga0070659_100033076 Ga0070659_1000330762 210
470 3300005367 Ga0070667_100053508 Ga0070667_1000535081 210
471 3300005455 Ga0070663_100168805 Ga0070663_1001688051 210
472 3300005456 Ga0070678_100003474 Ga0070678_1000034743 210
473 3300005456 Ga0070678_100825830 Ga0070678_1008258301 210
474 3300005457 Ga0070662_100069089 Ga0070662_1000690893 210
475 3300005543 Ga0070672_100000655 Ga0070672_10000065511 210
476 3300005548 Ga0070665_100029569 Ga0070665_1000295695 210
477 3300005549 Ga0070704_100057954 Ga0070704_1000579543 210
478 3300005549 Ga0070704_100112577 Ga0070704_1001125772 210
479 3300005549 Ga0070704_100619072 Ga0070704_1006190721 210
480 3300005564 Ga0070664_100040877 Ga0070664_1000408772 210
481 3300005616 Ga0068852_100347120 Ga0068852_1003471202 210
482 3300006028 Ga0070717_10919836 Ga0070717_109198361 210
483 3300006237 Ga0097621_100181536 Ga0097621_1001815362 210
484 3300006358 Ga0068871_100018921 Ga0068871_1000189214 210
485 3300006358 Ga0068871_100547569 Ga0068871_1005475692 210
486 3300006880 Ga0075429_100047465 Ga0075429_1000474652 210
487 3300009094 Ga0111539_10008809 Ga0111539_100088092 210
488 3300009094 Ga0111539_10013111 Ga0111539_100131113 210
489 3300009147 Ga0114129_10077350 Ga0114129_100773503 210
490 3300009148 Ga0105243_10175536 Ga0105243_101755362 210
491 3300012491 Ga0157329_1008665 Ga0157329_10086652 210
492 3300025315 Ga0207697_10048717 Ga0207697_100487172 210
493 3300025893 Ga0207682_10085437 Ga0207682_100854372 210
494 3300025903 Ga0207680_10117382 Ga0207680_101173822 210
495 3300025907 Ga0207645_10017450 Ga0207645_100174502 210
496 3300025917 Ga0207660_10251222 Ga0207660_102512221 210
497 3300025920 Ga0207649_10070531 Ga0207649_100705312 210
498 3300025923 Ga0207681_10134109 Ga0207681_101341092 210
499 3300025925 Ga0207650_10008640 Ga0207650_100086402 210
500 3300025926 Ga0207659_10196133 Ga0207659_101961332 210
501 3300025932 Ga0207690_10174189 Ga0207690_101741891 210
502 3300025933 Ga0207706_10233043 Ga0207706_102330432 210
503 3300025937 Ga0207669_10012036 Ga0207669_100120362 210
504 3300025940 Ga0207691_10000759 Ga0207691_100007593 210
505 3300025960 Ga0207651_10000073 Ga0207651_100000731 210
506 3300025972 Ga0207668_10440326 Ga0207668_104403262 210
507 3300025986 Ga0207658_10017462 Ga0207658_100174623 210
508 3300026067 Ga0207678_10208210 Ga0207678_102082102 210
509 3300026089 Ga0207648_10024014 Ga0207648_100240141 210
510 3300026118 Ga0207675_100456804 Ga0207675_1004568042 210
511 3300026121 Ga0207683_10000596 Ga0207683_1000059616 210
512 3300026142 Ga0207698_10204282 Ga0207698_102042822 210
513 3300026142 Ga0207698_10776746 Ga0207698_107767462 210
514 3300027907 Ga0207428_10014118 Ga0207428_100141186 210
515 3300028379 Ga0268266_10162047 Ga0268266_101620471 210
516 3300028563 Ga0265319_1000048 Ga0265319_100004862 210
517 3300028577 Ga0265318_10001434 Ga0265318_100014345 210
518 3300031235 Ga0265330_10000212 Ga0265330_1000021226 210
519 3300031238 Ga0265332_10000598 Ga0265332_1000059818 210
520 3300031239 Ga0265328_10003938 Ga0265328_100039384 210
521 3300031240 Ga0265320_10030637 Ga0265320_100306372 210
522 3300031241 Ga0265325_10015634 Ga0265325_100156344 210
523 3300031247 Ga0265340_10008554 Ga0265340_100085542 210
524 3300031249 Ga0265339_10004976 Ga0265339_100049762 210
525 3300031250 Ga0265331_10001346 Ga0265331_100013463 210
526 3300031344 Ga0265316_10000330 Ga0265316_1000033018 210
527 3300031595 Ga0265313_10000573 Ga0265313_100005732 210
528 3300031665 Ga0316575_10016338 Ga0316575_100163383 210
529 3300031665 Ga0316575_10030340 Ga0316575_100303402 210
530 3300031665 Ga0316575_10061954 Ga0316575_100619542 210
531 3300031691 Ga0316579_10001192 Ga0316579_100011924 210
532 3300031691 Ga0316579_10002152 Ga0316579_100021522 210
533 3300031691 Ga0316579_10024820 Ga0316579_100248201 210
534 3300031691 Ga0316579_10059253 Ga0316579_100592532 210
535 3300031711 Ga0265314_10000159 Ga0265314_1000015955 210
536 3300031712 Ga0265342_10002265 Ga0265342_1000226516 210
537 3300031727 Ga0316576_10000791 Ga0316576_1000079110 210
538 3300031727 Ga0316576_10007685 Ga0316576_100076851 210
539 3300031727 Ga0316576_10012284 Ga0316576_100122845 210
540 3300031727 Ga0316576_10021593 Ga0316576_100215932 210
541 3300031727 Ga0316576_10054697 Ga0316576_100546972 210
542 3300031727 Ga0316576_10068242 Ga0316576_100682422 210
543 3300031727 Ga0316576_10085697 Ga0316576_100856972 210
544 3300031728 Ga0316578_10001317 Ga0316578_100013179 210
545 3300031728 Ga0316578_10003814 Ga0316578_100038142 210
546 3300031728 Ga0316578_10021545 Ga0316578_100215451 210
547 3300031728 Ga0316578_10090709 Ga0316578_100907092 210
548 3300031733 Ga0316577_10004035 Ga0316577_100040357 210
549 3300031733 Ga0316577_10006976 Ga0316577_100069762 210
550 3300031733 Ga0316577_10049143 Ga0316577_100491432 210
551 3300031733 Ga0316577_10062444 Ga0316577_100624442 210
552 3300031733 Ga0316577_10206292 Ga0316577_102062921 210
553 3300031903 Ga0307407_10130411 Ga0307407_101304112 210
554 3300032133 Ga0316583_10000414 Ga0316583_100004146 210
555 3300032133 Ga0316583_10007526 Ga0316583_100075262 210
556 3300032133 Ga0316583_10049303 Ga0316583_100493032 210
557 3300032133 Ga0316583_10055019 Ga0316583_100550191 210
558 3300032137 Ga0316585_10001691 Ga0316585_100016912 210
559 3300032137 Ga0316585_10003135 Ga0316585_100031353 210
560 3300032137 Ga0316585_10021417 Ga0316585_100214172 210
561 3300032139 Ga0316580_10000480 Ga0316580_100004802 210
562 3300032139 Ga0316580_10020135 Ga0316580_100201352 210
563 3300032139 Ga0316580_10023377 Ga0316580_100233772 210
564 3300032139 Ga0316580_10023444 Ga0316580_100234442 210
565 3300032139 Ga0316580_10029729 Ga0316580_100297291 210
566 3300032168 Ga0316593_10001966 Ga0316593_100019663 210
567 3300033524 Ga0316592_1010923 Ga0316592_10109232 210
568 3300033541 Ga0316596_1049048 Ga0316596_10490481 210
569 3300035398 Ga0316574_0040587 Ga0316574_0040587_1141_1779 210
570 3300035398 Ga0316574_0128857 Ga0316574_0128857_786_1424 210
571 3300035398 Ga0316574_0205754 Ga0316574_0205754_79_717 210
572 3300035398 Ga0316574_0245780 Ga0316574_0245780_21_659 210
573 3300036647 Ga0316582_0000895 Ga0316582_0000895_5639_6277 210
574 3300036647 Ga0316582_0001725 Ga0316582_0001725_5479_6117 210
575 3300036647 Ga0316582_0031205 Ga0316582_0031205_2406_3044 210
576 3300036647 Ga0316582_0080297 Ga0316582_0080297_36_674 210
577 3300036647 Ga0316582_0124810 Ga0316582_0124810_377_1015 210
578 3300036647 Ga0316582_0310280 Ga0316582_0310280_345_983 210
579 3300036647 Ga0316582_0566369 Ga0316582_0566369_63_701 210
580 3300036712 Ga0316584_0015186 Ga0316584_0015186_2329_2967 210
581 3300036712 Ga0316584_0019256 Ga0316584_0019256_1200_1838 210
582 3300036712 Ga0316584_0044087 Ga0316584_0044087_593_1231 210
583 3300036712 Ga0316584_0072735 Ga0316584_0072735_1796_2434 210
584 3300036712 Ga0316584_0101218 Ga0316584_0101218_1079_1717 210
585 3300036712 Ga0316584_0217255 Ga0316584_0217255_693_1331 210
586 3300036712 Ga0316584_0270471 Ga0316584_0270471_369_1001 210
587 3300036712 Ga0316584_0278246 Ga0316584_0278246_51_689 210
588 3300036712 Ga0316584_0360637 Ga0316584_0360637_304_942 210
589 3300038727 Ga0400491_09172 Ga0400491_09172_720_1358 210
590 3300038735 Ga0400485_04042 Ga0400485_04042_398_1036 210
591 3300038742 Ga0400486_04029 Ga0400486_04029_398_1036 210
592 3300039093 Ga0400489_19166 Ga0400489_19166_8900_9538 210
593 3300039110 Ga0400487_56445 Ga0400487_56445_10611_11249 210
594 3300042876 Ga0451577_0905730 Ga0451577_0905730_91_723 210
595 3300044712 Ga0453684_0394056 Ga0453684_0394056_140_772 210
596 3300046516 Ga0495628_0000665 Ga0495628_0000665_8885_9517 210
597 3300047315 Ga0495581_0215584 Ga0495581_0215584_233_865 210
598 3300050507 nmdc:mga05p37_258357_c1 nmdc:mga05p37_258357_c1_1210_1842 210
599 3300050508 nmdc:mga09592_117342_c1 nmdc:mga09592_117342_c1_337_969 210
600 3300050508 nmdc:mga09592_877384_c1 nmdc:mga09592_877384_c1_36_668 210
601 3300050511 nmdc:mga08y16_14255_c1 nmdc:mga08y16_14255_c1_59_691 210
602 3300050511 nmdc:mga08y16_15839_c1 nmdc:mga08y16_15839_c1_2350_2982 210
603 3300005293 Ga0065715_10560032 Ga0065715_105600321 211
604 3300005330 Ga0070690_100080021 Ga0070690_1000800212 211
605 3300005343 Ga0070687_100141480 Ga0070687_1001414802 211
606 3300005437 Ga0070710_10101677 Ga0070710_101016772 211
607 3300005718 Ga0068866_10642434 Ga0068866_106424341 211
608 3300005843 Ga0068860_100176973 Ga0068860_1001769732 211
609 3300006844 Ga0075428_100322043 Ga0075428_1003220432 211
610 3300009094 Ga0111539_10008078 Ga0111539_100080789 211
611 3300009094 Ga0111539_10142557 Ga0111539_101425572 211
612 3300013102 Ga0157371_10017208 Ga0157371_100172083 211
613 3300013296 Ga0157374_10057328 Ga0157374_100573283 211
614 3300013297 Ga0157378_10000235 Ga0157378_1000023513 211
615 3300013306 Ga0163162_10527884 Ga0163162_105278842 211
616 3300013308 Ga0157375_10256775 Ga0157375_102567752 211
617 3300014326 Ga0157380_10146740 Ga0157380_101467402 211
618 3300014968 Ga0157379_10004082 Ga0157379_1000408210 211
619 3300014969 Ga0157376_10001991 Ga0157376_100019915 211
620 3300025898 Ga0207692_10072042 Ga0207692_100720422 211
621 3300025939 Ga0207665_10162150 Ga0207665_101621502 211
622 3300031456 Ga0307513_10427459 Ga0307513_104274591 211
623 3300031507 Ga0307509_10012348 Ga0307509_1001234810 211
624 3300031507 Ga0307509_10038670 Ga0307509_100386702 211
625 3300031507 Ga0307509_10121638 Ga0307509_101216382 211
626 3300031616 Ga0307508_10000041 Ga0307508_10000041101 211
627 3300031616 Ga0307508_10135153 Ga0307508_101351532 211
628 3300033179 Ga0307507_10066250 Ga0307507_100662502 211
629 3300035086 Ga0373934_0014776 Ga0373934_0014776_1573_2208 211
630 3300035117 Ga0373953_0081136 Ga0373953_0081136_676_1311 211
631 3300035119 Ga0373956_0034205 Ga0373956_0034205_123_758 211
632 3300035410 Ga0373924_0002317 Ga0373924_0002317_660_1295 211
633 3300035691 Ga0373931_0049956 Ga0373931_0049956_1280_1915 211
634 3300036401 Ga0373937_0022637 Ga0373937_0022637_2299_2934 211
635 3300036647 Ga0316582_0005625 Ga0316582_0005625_302_961 211
636 3300036712 Ga0316584_0007262 Ga0316584_0007262_5394_6053 211
637 3300037068 Ga0373925_0070593 Ga0373925_0070593_1005_1640 211
638 3300039093 Ga0400489_83885 Ga0400489_83885_8453_9148 211
639 3300039437 Ga0436365_0486298 Ga0436365_0486298_2021_2806 211
640 3300041486 Ga0451807_0370026 Ga0451807_0370026_582_1217 211
641 3300046477 Ga0495664_0133674 Ga0495664_0133674_561_1196 211
642 3300046526 Ga0495666_0078290 Ga0495666_0078290_858_1493 211
643 3300046559 Ga0495667_0341931 Ga0495667_0341931_14_649 211
644 3300046648 Ga0495611_0128742 Ga0495611_0128742_310_945 211
645 3300046675 Ga0495657_0112898 Ga0495657_0112898_750_1385 211
646 3300046809 Ga0495600_0085276 Ga0495600_0085276_739_1374 211
647 3300047319 Ga0495674_0841876 Ga0495674_0841876_20_655 211
648 3300048091 Ga0495626_0071561 Ga0495626_0071561_704_1339 211
649 3300048903 Ga0496100_0088854 Ga0496100_0088854_142_792 211
650 3300048908 Ga0496105_0171524 Ga0496105_0171524_222_872 211
651 3300048911 Ga0496108_0010030 Ga0496108_0010030_3181_3831 211
652 3300048912 Ga0496109_0047620 Ga0496109_0047620_3114_3764 211
653 3300048913 Ga0496110_0438354 Ga0496110_0438354_336_986 211
654 3300048914 Ga0496111_0742683 Ga0496111_0742683_33_683 211
655 3300048915 Ga0496112_0435113 Ga0496112_0435113_52_702 211
656 3300048917 Ga0496114_0047310 Ga0496114_0047310_273_923 211
657 3300050493 nmdc:mga0k408_206347_c1 nmdc:mga0k408_206347_c1_300_953 211
658 3300050511 nmdc:mga08y16_430243_c1 nmdc:mga08y16_430243_c1_523_1176 211
659 3300050511 nmdc:mga08y16_7728_c1 nmdc:mga08y16_7728_c1_9543_10193 211
660 3300050511 nmdc:mga08y16_81071_c1 nmdc:mga08y16_81071_c1_2417_3073 211
661 3300053077 Ga0495601_0124911 Ga0495601_0124911_85_720 211
662 3300053092 Ga0500583_0271088 Ga0500583_0271088_156_791 211
663 3300053118 Ga0500594_0061966 Ga0500594_0061966_113_766 211
664 3300003203 JGI25406J46586_10043687 JGI25406J46586_100436872 212
665 3300005434 Ga0070709_10277519 Ga0070709_102775191 212
666 3300005518 Ga0070699_100113399 Ga0070699_1001133992 212
667 3300005536 Ga0070697_100032296 Ga0070697_1000322962 212
668 3300005546 Ga0070696_100006269 Ga0070696_1000062694 212
669 3300006852 Ga0075433_10146331 Ga0075433_101463312 212
670 3300006852 Ga0075433_10376498 Ga0075433_103764982 212
671 3300006871 Ga0075434_100400539 Ga0075434_1004005392 212
672 3300006914 Ga0075436_100020187 Ga0075436_1000201872 212
673 3300007076 Ga0075435_100481979 Ga0075435_1004819791 212
674 3300007076 Ga0075435_100648213 Ga0075435_1006482131 212
675 3300025928 Ga0207700_10492873 Ga0207700_104928732 212
676 3300035088 Ga0373940_0076769 Ga0373940_0076769_182_820 212
677 3300035691 Ga0373931_0029995 Ga0373931_0029995_1705_2343 212
678 3300035695 Ga0373927_0207439 Ga0373927_0207439_482_1120 212
679 3300045051 Ga0451576_0145578 Ga0451576_0145578_618_1256 212
680 3300046539 Ga0495621_0128236 Ga0495621_0128236_169_807 212
681 3300046684 Ga0495669_0018505 Ga0495669_0018505_1000_1638 212
682 3300050507 nmdc:mga05p37_498195_c1 nmdc:mga05p37_498195_c1_134_772 212
683 3300050512 nmdc:mga0n895_2433_c1 nmdc:mga0n895_2433_c1_9440_10078 212
684 3300050513 nmdc:mga0rr50_210556_c1 nmdc:mga0rr50_210556_c1_261_899 212
685 3300050513 nmdc:mga0rr50_25242_c1 nmdc:mga0rr50_25242_c1_606_1244 212
686 3300050514 nmdc:mga08x19_1548_c1 nmdc:mga08x19_1548_c1_10424_11062 212
687 3300050514 nmdc:mga08x19_203710_c1 nmdc:mga08x19_203710_c1_703_1341 212
688 3300050514 nmdc:mga08x19_38836_c1 nmdc:mga08x19_38836_c1_758_1396 212
689 3300050514 nmdc:mga08x19_4750_c1 nmdc:mga08x19_4750_c1_3364_4002 212
690 3300050515 nmdc:mga0a205_188178_c1 nmdc:mga0a205_188178_c1_687_1325 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

158

214

0.97

PF00072

Response_reg

Response regulator receiver domain

15

127

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a5s-assembly1.cif.gz_AAA crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. 0.971 147 206
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9646 148 211
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9607 147 211
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9581 147 212
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9578 147 211
ID Description Score Start End Superfamily
3p7nA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9681 147 206 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9644 151 207 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9499 151 207 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9486 151 207 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9482 145 212 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1G0EEL3-F1-model_v4 DNA-binding response regulator 0.9846 4 140 GO:0000160
GO:0003677
AF-A0A7Z2G7W5-F1-model_v4 Response regulator 0.9803 4 212 GO:0000160
GO:0003677
GO:0006355
AF-A0A3D3PPS9-F1-model_v4 DNA-binding response regulator 0.9768 3 136 GO:0000160
GO:0003677
AF-A0A7J6Z2T9-F1-model_v4 deleted 0.9732 4 212
AF-A0A258NGY1-F1-model_v4 DNA-binding response regulator 0.9727 4 212 GO:0000160
GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
90.82 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map