F475429
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 372 | 686 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_100825830|Ga0070678_1008258301 |
| Length | 231 |
| Sequence | VKDNTHPAPPGRVRILIIDDHYVVRQGLKMILNEQFEHAQFGEAATGQEGLNHVWDHDWDVVLVDISMPGRGGLDVLKDIKHSKPKLPVIILSMHSEDQYAIRALKLGACGYIRKDSVGQELVQAVTTALTGARYITPSIAQKLAVHLQHEQEGPPHDALADREYQVMCMIALGKTVSEIGNELSLSVKTISTHRARILKKLSVANNEQIMRYAVMHGLVDVESGITAREE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 2 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 3 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 197 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 202 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 208 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 209 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 210 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 212 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 216 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 219 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 244 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 247 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 248 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 249 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 250 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 251 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 252 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 255 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 256 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 257 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 258 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 259 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 260 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 261 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 262 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 263 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 264 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 265 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 322 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 346 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 347 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 355 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 367 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 368 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 372 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.55 |
| Metatranscriptomes | 0.87 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 1.3 |
| Rhizosphere | 95.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10043687 | 3300003203 | Bacteria | 1558 |
| 2 | Ga0058859_10033578 | 3300004798 | Bacteria | 2286 |
| 3 | Ga0058861_10058411 | 3300004800 | Bacteria | 1436 |
| 4 | Ga0058860_12196631 | 3300004801 | Bacteria | 943 |
| 5 | Ga0065715_10560032 | 3300005293 | Unclassified | 734 |
| 6 | Ga0065707_10146536 | 3300005295 | Unclassified | 1707 |
| 7 | Ga0070676_10022726 | 3300005328 | Unclassified | 3518 |
| 8 | Ga0070676_10391663 | 3300005328 | Bacteria | 964 |
| 9 | Ga0070690_100004639 | 3300005330 | Bacteria | 7648 |
| 10 | Ga0070690_100034888 | 3300005330 | Unclassified | 3155 |
| 11 | Ga0070690_100080021 | 3300005330 | Bacteria | 2137 |
| 12 | Ga0070690_100180716 | 3300005330 | Bacteria | 1457 |
| 13 | Ga0070670_100022786 | 3300005331 | Bacteria | 5389 |
| 14 | Ga0070670_100031414 | 3300005331 | Bacteria | 4573 |
| 15 | Ga0070670_100967256 | 3300005331 | Bacteria | 773 |
| 16 | Ga0070677_10042471 | 3300005333 | Unclassified | 1801 |
| 17 | Ga0068869_100001704 | 3300005334 | Bacteria | 13134 |
| 18 | Ga0068869_100552509 | 3300005334 | Unclassified | 967 |
| 19 | Ga0070666_10004229 | 3300005335 | Bacteria | 8718 |
| 20 | Ga0070666_10562615 | 3300005335 | Bacteria | 830 |
| 21 | Ga0070680_100002230 | 3300005336 | Bacteria | 14302 |
| 22 | Ga0070680_100147061 | 3300005336 | Bacteria | 1977 |
| 23 | Ga0070680_100151862 | 3300005336 | Bacteria | 1944 |
| 24 | Ga0070680_100259184 | 3300005336 | Unclassified | 1471 |
| 25 | Ga0070680_100646845 | 3300005336 | Bacteria | 909 |
| 26 | Ga0070682_100000067 | 3300005337 | Bacteria | 96458 |
| 27 | Ga0068868_100044416 | 3300005338 | Unclassified | 3474 |
| 28 | Ga0068868_100057979 | 3300005338 | Bacteria | 3060 |
| 29 | Ga0070689_100057603 | 3300005340 | Bacteria | 3016 |
| 30 | Ga0070689_100221966 | 3300005340 | Bacteria | 1550 |
| 31 | Ga0070691_10001570 | 3300005341 | Bacteria | 9865 |
| 32 | Ga0070687_100000821 | 3300005343 | Bacteria | 10354 |
| 33 | Ga0070687_100141480 | 3300005343 | Bacteria | 1402 |
| 34 | Ga0070687_100506623 | 3300005343 | Bacteria | 813 |
| 35 | Ga0070661_100074138 | 3300005344 | Unclassified | 2506 |
| 36 | Ga0070692_10095755 | 3300005345 | Bacteria | 1620 |
| 37 | Ga0070668_100079471 | 3300005347 | Bacteria | 2568 |
| 38 | Ga0070669_100087566 | 3300005353 | Unclassified | 2329 |
| 39 | Ga0070669_100495355 | 3300005353 | Bacteria | 1013 |
| 40 | Ga0070675_100031415 | 3300005354 | Bacteria | 4293 |
| 41 | Ga0070671_100012951 | 3300005355 | Bacteria | 6720 |
| 42 | Ga0070674_100000282 | 3300005356 | Bacteria | 24872 |
| 43 | Ga0070674_100044977 | 3300005356 | Bacteria | 3014 |
| 44 | Ga0070673_100000027 | 3300005364 | Bacteria | 71407 |
| 45 | Ga0070673_100160848 | 3300005364 | Bacteria | 1910 |
| 46 | Ga0070659_100033076 | 3300005366 | Bacteria | 4015 |
| 47 | Ga0070667_100053508 | 3300005367 | Unclassified | 3407 |
| 48 | Ga0070709_10277519 | 3300005434 | Bacteria | 1217 |
| 49 | Ga0070714_100121445 | 3300005435 | Bacteria | 2324 |
| 50 | Ga0070710_10101677 | 3300005437 | Bacteria | 1713 |
| 51 | Ga0070701_10012125 | 3300005438 | Bacteria | 3877 |
| 52 | Ga0070705_100012874 | 3300005440 | Bacteria | 4267 |
| 53 | Ga0070705_100014567 | 3300005440 | Bacteria | 4048 |
| 54 | Ga0070705_100021347 | 3300005440 | Bacteria | 3443 |
| 55 | Ga0070705_100095597 | 3300005440 | Bacteria | 1863 |
| 56 | Ga0070705_100105337 | 3300005440 | Bacteria | 1790 |
| 57 | Ga0070700_100004048 | 3300005441 | Bacteria | 7630 |
| 58 | Ga0070700_100076611 | 3300005441 | Bacteria | 2148 |
| 59 | Ga0070694_100004096 | 3300005444 | Bacteria | 8749 |
| 60 | Ga0070694_100019702 | 3300005444 | Bacteria | 4293 |
| 61 | Ga0070694_100236780 | 3300005444 | Bacteria | 1375 |
| 62 | Ga0070694_100255878 | 3300005444 | Bacteria | 1326 |
| 63 | Ga0070694_100362047 | 3300005444 | Bacteria | 1127 |
| 64 | Ga0070708_100286305 | 3300005445 | Bacteria | 1551 |
| 65 | Ga0070663_100168805 | 3300005455 | Unclassified | 1690 |
| 66 | Ga0070678_100003474 | 3300005456 | Bacteria | 8782 |
| 67 | Ga0070678_100687157 | 3300005456 | Bacteria | 921 |
| 68 | Ga0070678_100825830 | 3300005456 | Unclassified | 843 |
| 69 | Ga0070662_100069089 | 3300005457 | Unclassified | 2599 |
| 70 | Ga0070681_10000720 | 3300005458 | Bacteria | 27395 |
| 71 | Ga0070681_10181712 | 3300005458 | Bacteria | 2025 |
| 72 | Ga0068867_100006962 | 3300005459 | Bacteria | 7995 |
| 73 | Ga0068867_100007000 | 3300005459 | Bacteria | 7969 |
| 74 | Ga0068867_100688865 | 3300005459 | Bacteria | 901 |
| 75 | Ga0070706_100300453 | 3300005467 | Bacteria | 1498 |
| 76 | Ga0070707_100067608 | 3300005468 | Bacteria | 3438 |
| 77 | Ga0070699_100113399 | 3300005518 | Bacteria | 2381 |
| 78 | Ga0070679_100041060 | 3300005530 | Bacteria | 4605 |
| 79 | Ga0070684_100066324 | 3300005535 | Bacteria | 3169 |
| 80 | Ga0070697_100032296 | 3300005536 | Bacteria | 4212 |
| 81 | Ga0070697_100089743 | 3300005536 | Bacteria | 2540 |
| 82 | Ga0068853_100434192 | 3300005539 | Bacteria | 1233 |
| 83 | Ga0070672_100000655 | 3300005543 | Bacteria | 20239 |
| 84 | Ga0070672_100028480 | 3300005543 | Bacteria | 4179 |
| 85 | Ga0070686_100003451 | 3300005544 | Bacteria | 8670 |
| 86 | Ga0070686_100024914 | 3300005544 | Bacteria | 3591 |
| 87 | Ga0070695_100001782 | 3300005545 | Bacteria | 12122 |
| 88 | Ga0070695_100161565 | 3300005545 | Bacteria | 1573 |
| 89 | Ga0070695_100230913 | 3300005545 | Bacteria | 1337 |
| 90 | Ga0070696_100006269 | 3300005546 | Bacteria | 7963 |
| 91 | Ga0070696_100031211 | 3300005546 | Bacteria | 3651 |
| 92 | Ga0070693_100027535 | 3300005547 | Bacteria | 3082 |
| 93 | Ga0070693_100234627 | 3300005547 | Unclassified | 1209 |
| 94 | Ga0070665_100029569 | 3300005548 | Bacteria | 5515 |
| 95 | Ga0070704_100004949 | 3300005549 | Bacteria | 7734 |
| 96 | Ga0070704_100019763 | 3300005549 | Bacteria | 4333 |
| 97 | Ga0070704_100057954 | 3300005549 | Bacteria | 2757 |
| 98 | Ga0070704_100112577 | 3300005549 | Unclassified | 2074 |
| 99 | Ga0070704_100115794 | 3300005549 | Bacteria | 2049 |
| 100 | Ga0070704_100225158 | 3300005549 | Bacteria | 1527 |
| 101 | Ga0070704_100619072 | 3300005549 | Bacteria | 953 |
| 102 | Ga0068855_100005265 | 3300005563 | Bacteria | 15795 |
| 103 | Ga0070664_100040877 | 3300005564 | Unclassified | 3911 |
| 104 | Ga0068854_100070570 | 3300005578 | Bacteria | 2553 |
| 105 | Ga0068856_100013045 | 3300005614 | Bacteria | 8048 |
| 106 | Ga0068856_100769210 | 3300005614 | Bacteria | 983 |
| 107 | Ga0070702_100001902 | 3300005615 | Bacteria | 8761 |
| 108 | Ga0070702_100033529 | 3300005615 | Bacteria | 2824 |
| 109 | Ga0068852_100221920 | 3300005616 | Bacteria | 1798 |
| 110 | Ga0068852_100347120 | 3300005616 | Unclassified | 1448 |
| 111 | Ga0068859_100033006 | 3300005617 | Bacteria | 5199 |
| 112 | Ga0068859_100050635 | 3300005617 | Bacteria | 4172 |
| 113 | Ga0068859_100258639 | 3300005617 | Bacteria | 1832 |
| 114 | Ga0068864_100104887 | 3300005618 | Bacteria | 2512 |
| 115 | Ga0068866_10001148 | 3300005718 | Bacteria | 11632 |
| 116 | Ga0068866_10021798 | 3300005718 | Bacteria | 2955 |
| 117 | Ga0068866_10642434 | 3300005718 | Bacteria | 721 |
| 118 | Ga0068861_100034873 | 3300005719 | Bacteria | 3723 |
| 119 | Ga0068863_100345866 | 3300005841 | Bacteria | 1447 |
| 120 | Ga0068863_100684378 | 3300005841 | Unclassified | 1019 |
| 121 | Ga0068858_100071360 | 3300005842 | Bacteria | 3221 |
| 122 | Ga0068860_100176973 | 3300005843 | Bacteria | 2062 |
| 123 | Ga0068860_100190370 | 3300005843 | Bacteria | 1985 |
| 124 | Ga0068860_100431537 | 3300005843 | Bacteria | 1307 |
| 125 | Ga0068862_100018223 | 3300005844 | Bacteria | 5845 |
| 126 | Ga0068862_100136303 | 3300005844 | Bacteria | 2175 |
| 127 | Ga0081538_10036883 | 3300005981 | Bacteria | 3182 |
| 128 | Ga0081539_10002158 | 3300005985 | Bacteria | 28978 |
| 129 | Ga0070717_10919836 | 3300006028 | Bacteria | 796 |
| 130 | Ga0070715_10054753 | 3300006163 | Bacteria | 1729 |
| 131 | Ga0097621_100101724 | 3300006237 | Bacteria | 2418 |
| 132 | Ga0097621_100158256 | 3300006237 | Bacteria | 1946 |
| 133 | Ga0097621_100181536 | 3300006237 | Unclassified | 1818 |
| 134 | Ga0068871_100009825 | 3300006358 | Bacteria | 6944 |
| 135 | Ga0068871_100018921 | 3300006358 | Bacteria | 5248 |
| 136 | Ga0068871_100036675 | 3300006358 | Bacteria | 3905 |
| 137 | Ga0068871_100547569 | 3300006358 | Unclassified | 1048 |
| 138 | Ga0075428_100005942 | 3300006844 | Bacteria | 13563 |
| 139 | Ga0075428_100016454 | 3300006844 | Bacteria | 8167 |
| 140 | Ga0075428_100032886 | 3300006844 | Bacteria | 5727 |
| 141 | Ga0075428_100322043 | 3300006844 | Unclassified | 1661 |
| 142 | Ga0075430_100013066 | 3300006846 | Bacteria | 7075 |
| 143 | Ga0075430_100075634 | 3300006846 | Bacteria | 2823 |
| 144 | Ga0075430_100142818 | 3300006846 | Bacteria | 1993 |
| 145 | Ga0075430_100271399 | 3300006846 | Bacteria | 1404 |
| 146 | Ga0075430_100331034 | 3300006846 | Unclassified | 1258 |
| 147 | Ga0075430_100441106 | 3300006846 | Bacteria | 1075 |
| 148 | Ga0075431_100007501 | 3300006847 | Bacteria | 10858 |
| 149 | Ga0075431_100229406 | 3300006847 | Bacteria | 1892 |
| 150 | Ga0075431_100508616 | 3300006847 | Bacteria | 1195 |
| 151 | Ga0075433_10146331 | 3300006852 | Bacteria | 2100 |
| 152 | Ga0075433_10376498 | 3300006852 | Bacteria | 1253 |
| 153 | Ga0075434_100000637 | 3300006871 | Bacteria | 27077 |
| 154 | Ga0075434_100027268 | 3300006871 | Bacteria | 5606 |
| 155 | Ga0075434_100400539 | 3300006871 | Bacteria | 1393 |
| 156 | Ga0075434_100408239 | 3300006871 | Bacteria | 1379 |
| 157 | Ga0075429_100002429 | 3300006880 | Bacteria | 15689 |
| 158 | Ga0075429_100047465 | 3300006880 | Bacteria | 3736 |
| 159 | Ga0075429_100165976 | 3300006880 | Bacteria | 1934 |
| 160 | Ga0075429_100733082 | 3300006880 | Bacteria | 866 |
| 161 | Ga0068865_100020691 | 3300006881 | Bacteria | 4270 |
| 162 | Ga0075436_100002105 | 3300006914 | Bacteria | 13742 |
| 163 | Ga0075436_100009310 | 3300006914 | Bacteria | 6717 |
| 164 | Ga0075436_100020187 | 3300006914 | Bacteria | 4573 |
| 165 | Ga0075436_100333261 | 3300006914 | Bacteria | 1092 |
| 166 | Ga0075436_100355268 | 3300006914 | Bacteria | 1056 |
| 167 | Ga0097620_100033005 | 3300006931 | Bacteria | 5199 |
| 168 | Ga0097620_100050640 | 3300006931 | Bacteria | 4172 |
| 169 | Ga0097620_100258639 | 3300006931 | Bacteria | 1832 |
| 170 | Ga0075435_100011829 | 3300007076 | Bacteria | 6442 |
| 171 | Ga0075435_100022586 | 3300007076 | Bacteria | 4853 |
| 172 | Ga0075435_100219341 | 3300007076 | Bacteria | 1615 |
| 173 | Ga0075435_100481979 | 3300007076 | Bacteria | 1071 |
| 174 | Ga0075435_100648213 | 3300007076 | Bacteria | 917 |
| 175 | Ga0099794_10016647 | 3300007265 | Bacteria | 3263 |
| 176 | Ga0105240_10719459 | 3300009093 | Unclassified | 1088 |
| 177 | Ga0111539_10008078 | 3300009094 | Bacteria | 13411 |
| 178 | Ga0111539_10008809 | 3300009094 | Bacteria | 12795 |
| 179 | Ga0111539_10013111 | 3300009094 | Bacteria | 10367 |
| 180 | Ga0111539_10142557 | 3300009094 | Unclassified | 2805 |
| 181 | Ga0111539_10254824 | 3300009094 | Bacteria | 2043 |
| 182 | Ga0105245_10004171 | 3300009098 | Bacteria | 12837 |
| 183 | Ga0114129_10007266 | 3300009147 | Bacteria | 15761 |
| 184 | Ga0114129_10077350 | 3300009147 | Bacteria | 4628 |
| 185 | Ga0114129_10311632 | 3300009147 | Bacteria | 2095 |
| 186 | Ga0105243_10084982 | 3300009148 | Bacteria | 2593 |
| 187 | Ga0105243_10175536 | 3300009148 | Bacteria | 1859 |
| 188 | Ga0105243_10286988 | 3300009148 | Bacteria | 1485 |
| 189 | Ga0105243_10810670 | 3300009148 | Bacteria | 923 |
| 190 | Ga0105241_10011280 | 3300009174 | Bacteria | 6551 |
| 191 | Ga0105242_10003038 | 3300009176 | Bacteria | 13114 |
| 192 | Ga0105248_10111632 | 3300009177 | Bacteria | 3083 |
| 193 | Ga0105237_10000137 | 3300009545 | Bacteria | 102639 |
| 194 | Ga0105249_10035913 | 3300009553 | Bacteria | 4495 |
| 195 | Ga0105239_10657321 | 3300010375 | Bacteria | 1197 |
| 196 | Ga0157329_1008665 | 3300012491 | Bacteria | 765 |
| 197 | Ga0157371_10017208 | 3300013102 | Bacteria | 5374 |
| 198 | Ga0157370_10268514 | 3300013104 | Bacteria | 1576 |
| 199 | Ga0157369_10778625 | 3300013105 | Bacteria | 983 |
| 200 | Ga0157374_10057328 | 3300013296 | Unclassified | 3638 |
| 201 | Ga0157378_10000235 | 3300013297 | Bacteria | 53980 |
| 202 | Ga0157378_10011451 | 3300013297 | Bacteria | 7762 |
| 203 | Ga0157378_10023055 | 3300013297 | Bacteria | 5479 |
| 204 | Ga0163162_10134166 | 3300013306 | Bacteria | 2586 |
| 205 | Ga0163162_10527884 | 3300013306 | Bacteria | 1309 |
| 206 | Ga0157375_10256775 | 3300013308 | Unclassified | 1909 |
| 207 | Ga0157380_10042501 | 3300014326 | Bacteria | 3553 |
| 208 | Ga0157380_10146740 | 3300014326 | Bacteria | 2034 |
| 209 | Ga0157380_10239130 | 3300014326 | Bacteria | 1636 |
| 210 | Ga0157377_10212957 | 3300014745 | Bacteria | 1233 |
| 211 | Ga0157379_10004082 | 3300014968 | Bacteria | 12455 |
| 212 | Ga0157379_10132788 | 3300014968 | Bacteria | 2241 |
| 213 | Ga0157376_10001991 | 3300014969 | Bacteria | 13678 |
| 214 | Ga0157376_10008195 | 3300014969 | Bacteria | 7520 |
| 215 | Ga0157376_10633135 | 3300014969 | Bacteria | 1068 |
| 216 | Ga0163161_10090480 | 3300017792 | Bacteria | 2264 |
| 217 | Ga0163161_10517028 | 3300017792 | Bacteria | 974 |
| 218 | Ga0207697_10048717 | 3300025315 | Unclassified | 1748 |
| 219 | Ga0207653_10013523 | 3300025885 | Bacteria | 2555 |
| 220 | Ga0207682_10017696 | 3300025893 | Bacteria | 2783 |
| 221 | Ga0207682_10085437 | 3300025893 | Unclassified | 1359 |
| 222 | Ga0207692_10072042 | 3300025898 | Bacteria | 1824 |
| 223 | Ga0207642_10019300 | 3300025899 | Bacteria | 2638 |
| 224 | Ga0207642_10019861 | 3300025899 | Bacteria | 2611 |
| 225 | Ga0207680_10117382 | 3300025903 | Unclassified | 1735 |
| 226 | Ga0207685_10003876 | 3300025905 | Bacteria | 3708 |
| 227 | Ga0207645_10017450 | 3300025907 | Unclassified | 4737 |
| 228 | Ga0207645_10059989 | 3300025907 | Bacteria | 2430 |
| 229 | Ga0207645_10279262 | 3300025907 | Bacteria | 1109 |
| 230 | Ga0207643_10022173 | 3300025908 | Bacteria | 3494 |
| 231 | Ga0207643_10087835 | 3300025908 | Bacteria | 1809 |
| 232 | Ga0207707_10015506 | 3300025912 | Bacteria | 6638 |
| 233 | Ga0207671_10001268 | 3300025914 | Bacteria | 29771 |
| 234 | Ga0207660_10036650 | 3300025917 | Bacteria | 3411 |
| 235 | Ga0207660_10096295 | 3300025917 | Bacteria | 2203 |
| 236 | Ga0207660_10251222 | 3300025917 | Bacteria | 1396 |
| 237 | Ga0207660_10543360 | 3300025917 | Bacteria | 945 |
| 238 | Ga0207662_10000163 | 3300025918 | Bacteria | 31537 |
| 239 | Ga0207662_10185761 | 3300025918 | Bacteria | 1339 |
| 240 | Ga0207649_10070531 | 3300025920 | Unclassified | 2229 |
| 241 | Ga0207652_10048128 | 3300025921 | Bacteria | 3644 |
| 242 | Ga0207681_10013598 | 3300025923 | Bacteria | 5039 |
| 243 | Ga0207681_10134109 | 3300025923 | Unclassified | 1835 |
| 244 | Ga0207650_10008640 | 3300025925 | Bacteria | 6954 |
| 245 | Ga0207650_10037338 | 3300025925 | Unclassified | 3540 |
| 246 | Ga0207659_10196133 | 3300025926 | Unclassified | 1609 |
| 247 | Ga0207687_10005036 | 3300025927 | Bacteria | 8749 |
| 248 | Ga0207700_10492873 | 3300025928 | Bacteria | 1084 |
| 249 | Ga0207690_10174189 | 3300025932 | Unclassified | 1614 |
| 250 | Ga0207706_10233043 | 3300025933 | Unclassified | 1610 |
| 251 | Ga0207706_10364202 | 3300025933 | Bacteria | 1256 |
| 252 | Ga0207686_10009441 | 3300025934 | Bacteria | 5293 |
| 253 | Ga0207709_10005265 | 3300025935 | Bacteria | 7357 |
| 254 | Ga0207709_10151407 | 3300025935 | Bacteria | 1607 |
| 255 | Ga0207709_10388809 | 3300025935 | Bacteria | 1063 |
| 256 | Ga0207670_10039813 | 3300025936 | Bacteria | 3081 |
| 257 | Ga0207669_10012036 | 3300025937 | Bacteria | 4237 |
| 258 | Ga0207669_10067790 | 3300025937 | Bacteria | 2225 |
| 259 | Ga0207669_10180198 | 3300025937 | Bacteria | 1514 |
| 260 | Ga0207704_10002799 | 3300025938 | Bacteria | 7866 |
| 261 | Ga0207665_10162150 | 3300025939 | Unclassified | 1609 |
| 262 | Ga0207691_10000759 | 3300025940 | Bacteria | 31911 |
| 263 | Ga0207691_10112465 | 3300025940 | Bacteria | 2420 |
| 264 | Ga0207691_10253063 | 3300025940 | Bacteria | 1520 |
| 265 | Ga0207711_10384812 | 3300025941 | Bacteria | 1302 |
| 266 | Ga0207689_10004260 | 3300025942 | Bacteria | 13011 |
| 267 | Ga0207689_10155942 | 3300025942 | Bacteria | 1882 |
| 268 | Ga0207667_10023823 | 3300025949 | Bacteria | 6737 |
| 269 | Ga0207651_10000073 | 3300025960 | Bacteria | 45927 |
| 270 | Ga0207712_10013646 | 3300025961 | Bacteria | 5210 |
| 271 | Ga0207712_10073959 | 3300025961 | Bacteria | 2459 |
| 272 | Ga0207668_10440326 | 3300025972 | Bacteria | 1110 |
| 273 | Ga0207640_10013576 | 3300025981 | Bacteria | 4674 |
| 274 | Ga0207658_10017462 | 3300025986 | Unclassified | 4945 |
| 275 | Ga0207677_10004527 | 3300026023 | Bacteria | 7478 |
| 276 | Ga0207703_10130021 | 3300026035 | Bacteria | 2173 |
| 277 | Ga0207639_10779526 | 3300026041 | Bacteria | 890 |
| 278 | Ga0207678_10208210 | 3300026067 | Unclassified | 1673 |
| 279 | Ga0207708_10000681 | 3300026075 | Bacteria | 25817 |
| 280 | Ga0207708_10025718 | 3300026075 | Bacteria | 4454 |
| 281 | Ga0207708_10384773 | 3300026075 | Bacteria | 1157 |
| 282 | Ga0207708_10769210 | 3300026075 | Bacteria | 827 |
| 283 | Ga0207702_10245149 | 3300026078 | Bacteria | 1680 |
| 284 | Ga0207702_10416792 | 3300026078 | Bacteria | 1298 |
| 285 | Ga0207648_10003529 | 3300026089 | Bacteria | 16372 |
| 286 | Ga0207648_10024014 | 3300026089 | Bacteria | 5449 |
| 287 | Ga0207648_10032369 | 3300026089 | Bacteria | 4617 |
| 288 | Ga0207674_10276961 | 3300026116 | Bacteria | 1625 |
| 289 | Ga0207675_100008285 | 3300026118 | Bacteria | 9791 |
| 290 | Ga0207675_100036108 | 3300026118 | Bacteria | 4609 |
| 291 | Ga0207675_100456804 | 3300026118 | Bacteria | 1266 |
| 292 | Ga0207683_10000596 | 3300026121 | Bacteria | 33293 |
| 293 | Ga0207683_10475970 | 3300026121 | Bacteria | 1152 |
| 294 | Ga0207698_10137664 | 3300026142 | Bacteria | 2098 |
| 295 | Ga0207698_10204282 | 3300026142 | Unclassified | 1772 |
| 296 | Ga0207698_10776746 | 3300026142 | Unclassified | 958 |
| 297 | Ga0209969_1001056 | 3300027360 | Bacteria | 3767 |
| 298 | Ga0209969_1003774 | 3300027360 | Bacteria | 2102 |
| 299 | Ga0209967_1001952 | 3300027364 | Bacteria | 2656 |
| 300 | Ga0209967_1003896 | 3300027364 | Bacteria | 1969 |
| 301 | Ga0209967_1006633 | 3300027364 | Unclassified | 1575 |
| 302 | Ga0209981_1003912 | 3300027378 | Bacteria | 1939 |
| 303 | Ga0209981_1024359 | 3300027378 | Bacteria | 873 |
| 304 | Ga0210000_1001599 | 3300027462 | Bacteria | 3203 |
| 305 | Ga0209995_1007921 | 3300027471 | Bacteria | 1713 |
| 306 | Ga0209968_1011259 | 3300027526 | Unclassified | 1384 |
| 307 | Ga0209968_1021452 | 3300027526 | Bacteria | 1048 |
| 308 | Ga0209999_1002337 | 3300027543 | Bacteria | 3342 |
| 309 | Ga0209999_1003514 | 3300027543 | Bacteria | 2807 |
| 310 | Ga0209982_1006927 | 3300027552 | Bacteria | 1655 |
| 311 | Ga0209970_1010270 | 3300027614 | Bacteria | 1531 |
| 312 | Ga0209983_1012983 | 3300027665 | Bacteria | 1712 |
| 313 | Ga0209588_1027513 | 3300027671 | Bacteria | 1809 |
| 314 | Ga0209971_1002199 | 3300027682 | Bacteria | 4737 |
| 315 | Ga0209966_1072428 | 3300027695 | Bacteria | 756 |
| 316 | Ga0209974_10023562 | 3300027876 | Bacteria | 2037 |
| 317 | Ga0209974_10034481 | 3300027876 | Bacteria | 1681 |
| 318 | Ga0207428_10009598 | 3300027907 | Bacteria | 8669 |
| 319 | Ga0207428_10014118 | 3300027907 | Bacteria | 6954 |
| 320 | Ga0207428_10104029 | 3300027907 | Bacteria | 2192 |
| 321 | Ga0268266_10162047 | 3300028379 | Unclassified | 2024 |
| 322 | Ga0268265_10009420 | 3300028380 | Bacteria | 6595 |
| 323 | Ga0268265_10023106 | 3300028380 | Bacteria | 4379 |
| 324 | Ga0268264_10063281 | 3300028381 | Bacteria | 3109 |
| 325 | Ga0268264_10536139 | 3300028381 | Bacteria | 1146 |
| 326 | Ga0265319_1000048 | 3300028563 | Bacteria | 99817 |
| 327 | Ga0265318_10001434 | 3300028577 | Bacteria | 14053 |
| 328 | Ga0265330_10000212 | 3300031235 | Bacteria | 45086 |
| 329 | Ga0265332_10000598 | 3300031238 | Bacteria | 23662 |
| 330 | Ga0265328_10003938 | 3300031239 | Bacteria | 6531 |
| 331 | Ga0265320_10030637 | 3300031240 | Bacteria | 2771 |
| 332 | Ga0265325_10015634 | 3300031241 | Bacteria | 4263 |
| 333 | Ga0265340_10008554 | 3300031247 | Bacteria | 5521 |
| 334 | Ga0265339_10004976 | 3300031249 | Bacteria | 8947 |
| 335 | Ga0265331_10001346 | 3300031250 | Bacteria | 18107 |
| 336 | Ga0265316_10000330 | 3300031344 | Bacteria | 52881 |
| 337 | Ga0307513_10427459 | 3300031456 | Bacteria | 1053 |
| 338 | Ga0307509_10012348 | 3300031507 | Bacteria | 10227 |
| 339 | Ga0307509_10038670 | 3300031507 | Bacteria | 5203 |
| 340 | Ga0307509_10121638 | 3300031507 | Bacteria | 2586 |
| 341 | Ga0307408_100109086 | 3300031548 | Unclassified | 2123 |
| 342 | Ga0307408_100185101 | 3300031548 | Bacteria | 1673 |
| 343 | Ga0307408_100623193 | 3300031548 | Bacteria | 961 |
| 344 | Ga0307408_100729174 | 3300031548 | Bacteria | 893 |
| 345 | Ga0265313_10000573 | 3300031595 | Bacteria | 38431 |
| 346 | Ga0307508_10000041 | 3300031616 | Bacteria | 147868 |
| 347 | Ga0307508_10135153 | 3300031616 | Unclassified | 2069 |
| 348 | Ga0316575_10014375 | 3300031665 | Bacteria | 2971 |
| 349 | Ga0316575_10016338 | 3300031665 | Bacteria | 2807 |
| 350 | Ga0316575_10030340 | 3300031665 | Unclassified | 2113 |
| 351 | Ga0316575_10061954 | 3300031665 | Bacteria | 1495 |
| 352 | Ga0316575_10134426 | 3300031665 | Bacteria | 1016 |
| 353 | Ga0316579_10001192 | 3300031691 | Bacteria | 9303 |
| 354 | Ga0316579_10002152 | 3300031691 | Bacteria | 7397 |
| 355 | Ga0316579_10024820 | 3300031691 | Unclassified | 2701 |
| 356 | Ga0316579_10059253 | 3300031691 | Bacteria | 1799 |
| 357 | Ga0265314_10000159 | 3300031711 | Bacteria | 102733 |
| 358 | Ga0265342_10002265 | 3300031712 | Bacteria | 16808 |
| 359 | Ga0316576_10000791 | 3300031727 | Bacteria | 15916 |
| 360 | Ga0316576_10007685 | 3300031727 | Bacteria | 6799 |
| 361 | Ga0316576_10012284 | 3300031727 | Bacteria | 5652 |
| 362 | Ga0316576_10021593 | 3300031727 | Bacteria | 4455 |
| 363 | Ga0316576_10054697 | 3300031727 | Unclassified | 2911 |
| 364 | Ga0316576_10061095 | 3300031727 | Bacteria | 2761 |
| 365 | Ga0316576_10068242 | 3300031727 | Unclassified | 2619 |
| 366 | Ga0316576_10085697 | 3300031727 | Bacteria | 2342 |
| 367 | Ga0316578_10001317 | 3300031728 | Bacteria | 9949 |
| 368 | Ga0316578_10003814 | 3300031728 | Bacteria | 6982 |
| 369 | Ga0316578_10021545 | 3300031728 | Unclassified | 3578 |
| 370 | Ga0316578_10090709 | 3300031728 | Bacteria | 1824 |
| 371 | Ga0316577_10000496 | 3300031733 | Bacteria | 15596 |
| 372 | Ga0316577_10004035 | 3300031733 | Bacteria | 7519 |
| 373 | Ga0316577_10006976 | 3300031733 | Bacteria | 6005 |
| 374 | Ga0316577_10049143 | 3300031733 | Unclassified | 2354 |
| 375 | Ga0316577_10062444 | 3300031733 | Unclassified | 2080 |
| 376 | Ga0316577_10206292 | 3300031733 | Bacteria | 1111 |
| 377 | Ga0307413_10271587 | 3300031824 | Unclassified | 1270 |
| 378 | Ga0307407_10130411 | 3300031903 | Bacteria | 1607 |
| 379 | Ga0307416_100025015 | 3300032002 | Unclassified | 4370 |
| 380 | Ga0307416_100037889 | 3300032002 | Unclassified | 3715 |
| 381 | Ga0307416_100696797 | 3300032002 | Bacteria | 1104 |
| 382 | Ga0307411_10078731 | 3300032005 | Unclassified | 2261 |
| 383 | Ga0316583_10000414 | 3300032133 | Bacteria | 12499 |
| 384 | Ga0316583_10007526 | 3300032133 | Bacteria | 3921 |
| 385 | Ga0316583_10049303 | 3300032133 | Bacteria | 1482 |
| 386 | Ga0316583_10055019 | 3300032133 | Bacteria | 1399 |
| 387 | Ga0316583_10058208 | 3300032133 | Bacteria | 1356 |
| 388 | Ga0316585_10001691 | 3300032137 | Bacteria | 5862 |
| 389 | Ga0316585_10003135 | 3300032137 | Bacteria | 4512 |
| 390 | Ga0316585_10021417 | 3300032137 | Bacteria | 1985 |
| 391 | Ga0316580_10000480 | 3300032139 | Bacteria | 9215 |
| 392 | Ga0316580_10020135 | 3300032139 | Unclassified | 2053 |
| 393 | Ga0316580_10023377 | 3300032139 | Bacteria | 1908 |
| 394 | Ga0316580_10023444 | 3300032139 | Bacteria | 1906 |
| 395 | Ga0316580_10029729 | 3300032139 | Bacteria | 1691 |
| 396 | Ga0316593_10001966 | 3300032168 | Bacteria | 4726 |
| 397 | Ga0307507_10066250 | 3300033179 | Bacteria | 3313 |
| 398 | Ga0316592_1010923 | 3300033524 | Bacteria | 1837 |
| 399 | Ga0316596_1049048 | 3300033541 | Bacteria | 1116 |
| 400 | Ga0373930_0011207 | 3300034816 | Bacteria | 1616 |
| 401 | Ga0373948_0009510 | 3300034817 | Bacteria | 1677 |
| 402 | Ga0373950_0043071 | 3300034818 | Unclassified | 869 |
| 403 | Ga0373959_0031152 | 3300034820 | Unclassified | 1078 |
| 404 | Ga0373926_0026171 | 3300035083 | Bacteria | 2039 |
| 405 | Ga0373934_0014776 | 3300035086 | Bacteria | 2957 |
| 406 | Ga0373934_0169594 | 3300035086 | Unclassified | 896 |
| 407 | Ga0373940_0024035 | 3300035088 | Bacteria | 1577 |
| 408 | Ga0373940_0076769 | 3300035088 | Bacteria | 981 |
| 409 | Ga0373944_0045043 | 3300035089 | Bacteria | 1375 |
| 410 | Ga0373949_0008362 | 3300035090 | Bacteria | 2265 |
| 411 | Ga0373951_0070860 | 3300035091 | Unclassified | 888 |
| 412 | Ga0373932_0012620 | 3300035112 | Bacteria | 2083 |
| 413 | Ga0373936_0012256 | 3300035113 | Bacteria | 3259 |
| 414 | Ga0373939_0026251 | 3300035114 | Bacteria | 1640 |
| 415 | Ga0373941_0175270 | 3300035115 | Unclassified | 801 |
| 416 | Ga0373941_0269533 | 3300035115 | Unclassified | 670 |
| 417 | Ga0373941_0326412 | 3300035115 | Bacteria | 619 |
| 418 | Ga0373945_0020753 | 3300035116 | Bacteria | 2252 |
| 419 | Ga0373953_0081136 | 3300035117 | Bacteria | 1348 |
| 420 | Ga0373954_0000129 | 3300035118 | Bacteria | 25852 |
| 421 | Ga0373956_0034205 | 3300035119 | Bacteria | 2238 |
| 422 | Ga0373956_0120504 | 3300035119 | Bacteria | 1225 |
| 423 | Ga0373956_0131704 | 3300035119 | Unclassified | 1171 |
| 424 | Ga0373960_0031189 | 3300035121 | Bacteria | 1489 |
| 425 | Ga0373943_0030426 | 3300035170 | Bacteria | 2554 |
| 426 | Ga0373946_0000875 | 3300035171 | Bacteria | 10362 |
| 427 | Ga0373942_0009933 | 3300035207 | Bacteria | 2231 |
| 428 | Ga0316574_0040587 | 3300035398 | Bacteria | 2866 |
| 429 | Ga0316574_0128857 | 3300035398 | Bacteria | 1627 |
| 430 | Ga0316574_0205754 | 3300035398 | Bacteria | 1263 |
| 431 | Ga0316574_0245780 | 3300035398 | Bacteria | 1143 |
| 432 | Ga0373924_0002317 | 3300035410 | Bacteria | 6391 |
| 433 | Ga0373924_0120630 | 3300035410 | Bacteria | 1137 |
| 434 | Ga0373931_0007034 | 3300035691 | Bacteria | 5294 |
| 435 | Ga0373931_0029995 | 3300035691 | Bacteria | 2797 |
| 436 | Ga0373931_0047102 | 3300035691 | Bacteria | 2281 |
| 437 | Ga0373931_0049956 | 3300035691 | Bacteria | 2224 |
| 438 | Ga0373931_0073419 | 3300035691 | Bacteria | 1872 |
| 439 | Ga0373935_0071557 | 3300035692 | Bacteria | 2237 |
| 440 | Ga0373927_0038597 | 3300035695 | Bacteria | 3100 |
| 441 | Ga0373927_0207439 | 3300035695 | Bacteria | 1287 |
| 442 | Ga0373933_0034476 | 3300035724 | Bacteria | 2950 |
| 443 | Ga0373933_0138993 | 3300035724 | Bacteria | 1532 |
| 444 | Ga0373933_0459378 | 3300035724 | Unclassified | 833 |
| 445 | Ga0373937_0011632 | 3300036401 | Bacteria | 7726 |
| 446 | Ga0373937_0022637 | 3300036401 | Bacteria | 5651 |
| 447 | Ga0373937_0023653 | 3300036401 | Bacteria | 5536 |
| 448 | Ga0373937_0108522 | 3300036401 | Bacteria | 2581 |
| 449 | Ga0316582_0000895 | 3300036647 | Bacteria | 12221 |
| 450 | Ga0316582_0001725 | 3300036647 | Bacteria | 9827 |
| 451 | Ga0316582_0005625 | 3300036647 | Bacteria | 6481 |
| 452 | Ga0316582_0031205 | 3300036647 | Unclassified | 3255 |
| 453 | Ga0316582_0080297 | 3300036647 | Unclassified | 2128 |
| 454 | Ga0316582_0124810 | 3300036647 | Bacteria | 1725 |
| 455 | Ga0316582_0310280 | 3300036647 | Unclassified | 1084 |
| 456 | Ga0316582_0566369 | 3300036647 | Bacteria | 782 |
| 457 | Ga0316584_0007262 | 3300036712 | Bacteria | 7562 |
| 458 | Ga0316584_0015186 | 3300036712 | Bacteria | 5503 |
| 459 | Ga0316584_0019256 | 3300036712 | Unclassified | 4934 |
| 460 | Ga0316584_0044087 | 3300036712 | Unclassified | 3326 |
| 461 | Ga0316584_0072735 | 3300036712 | Bacteria | 2576 |
| 462 | Ga0316584_0101218 | 3300036712 | Bacteria | 2157 |
| 463 | Ga0316584_0196948 | 3300036712 | Bacteria | 1488 |
| 464 | Ga0316584_0217255 | 3300036712 | Unclassified | 1406 |
| 465 | Ga0316584_0270471 | 3300036712 | Bacteria | 1237 |
| 466 | Ga0316584_0278246 | 3300036712 | Bacteria | 1216 |
| 467 | Ga0316584_0360637 | 3300036712 | Unclassified | 1042 |
| 468 | Ga0316584_0476269 | 3300036712 | Bacteria | 880 |
| 469 | Ga0373925_0062474 | 3300037068 | Bacteria | 2800 |
| 470 | Ga0373925_0070593 | 3300037068 | Bacteria | 2641 |
| 471 | Ga0373925_0429752 | 3300037068 | Bacteria | 1080 |
| 472 | Ga0316581_0043788 | 3300037588 | Bacteria | 1366 |
| 473 | Ga0400491_09172 | 3300038727 | Bacteria | 1646 |
| 474 | Ga0400485_04042 | 3300038735 | Bacteria | 23120 |
| 475 | Ga0400486_04029 | 3300038742 | Bacteria | 63930 |
| 476 | Ga0400483_203037 | 3300039062 | Bacteria | 1371 |
| 477 | Ga0400489_19166 | 3300039093 | Bacteria | 10110 |
| 478 | Ga0400489_83885 | 3300039093 | Bacteria | 14482 |
| 479 | Ga0400487_56445 | 3300039110 | Bacteria | 32953 |
| 480 | Ga0436365_0486298 | 3300039437 | Bacteria | 8040 |
| 481 | Ga0439461_0002003 | 3300041410 | Bacteria | 3224 |
| 482 | Ga0451807_0370026 | 3300041486 | Bacteria | 1518 |
| 483 | Ga0439441_001358 | 3300042001 | Bacteria | 3167 |
| 484 | Ga0439443_003421 | 3300042003 | Bacteria | 1998 |
| 485 | Ga0439443_010585 | 3300042003 | Unclassified | 1338 |
| 486 | Ga0439462_0040778 | 3300042015 | Bacteria | 1239 |
| 487 | Ga0450910_053371 | 3300042147 | Bacteria | 671 |
| 488 | Ga0439434_0000967 | 3300042435 | Bacteria | 8277 |
| 489 | Ga0439435_0000371 | 3300042436 | Bacteria | 6877 |
| 490 | Ga0439435_0000649 | 3300042436 | Bacteria | 5726 |
| 491 | Ga0439435_0013916 | 3300042436 | Bacteria | 1979 |
| 492 | Ga0439444_0005828 | 3300042437 | Bacteria | 1840 |
| 493 | Ga0439460_0000878 | 3300042461 | Bacteria | 6875 |
| 494 | Ga0439460_0011586 | 3300042461 | Bacteria | 2276 |
| 495 | Ga0451577_0179412 | 3300042876 | Bacteria | 1909 |
| 496 | Ga0451577_0410102 | 3300042876 | Bacteria | 1230 |
| 497 | Ga0451577_0905730 | 3300042876 | Bacteria | 794 |
| 498 | Ga0453683_0070980 | 3300044673 | Unclassified | 2178 |
| 499 | Ga0466965_0434744 | 3300044683 | Bacteria | 729 |
| 500 | Ga0453684_0040799 | 3300044712 | Bacteria | 6294 |
| 501 | Ga0453684_0394056 | 3300044712 | Bacteria | 1552 |
| 502 | Ga0466957_0077752 | 3300044842 | Bacteria | 2062 |
| 503 | Ga0466960_0219048 | 3300044901 | Bacteria | 1047 |
| 504 | Ga0451576_0004013 | 3300045051 | Bacteria | 19582 |
| 505 | Ga0451576_0124571 | 3300045051 | Unclassified | 2685 |
| 506 | Ga0451576_0145578 | 3300045051 | Bacteria | 2470 |
| 507 | Ga0451576_0403650 | 3300045051 | Bacteria | 1433 |
| 508 | Ga0466967_0158572 | 3300045976 | Bacteria | 2122 |
| 509 | Ga0495592_0009905 | 3300046454 | Bacteria | 7176 |
| 510 | Ga0495603_0010186 | 3300046455 | Bacteria | 5690 |
| 511 | Ga0495580_0019598 | 3300046472 | Bacteria | 5025 |
| 512 | Ga0495639_0053008 | 3300046475 | Bacteria | 1847 |
| 513 | Ga0495662_0029234 | 3300046476 | Bacteria | 2661 |
| 514 | Ga0495664_0133674 | 3300046477 | Bacteria | 1503 |
| 515 | Ga0495608_0003736 | 3300046511 | Bacteria | 10928 |
| 516 | Ga0495628_0000665 | 3300046516 | Bacteria | 31450 |
| 517 | Ga0495628_0003842 | 3300046516 | Bacteria | 13395 |
| 518 | Ga0495630_0089946 | 3300046517 | Bacteria | 2319 |
| 519 | Ga0495632_0217553 | 3300046519 | Bacteria | 865 |
| 520 | Ga0495666_0053849 | 3300046526 | Bacteria | 1930 |
| 521 | Ga0495666_0078290 | 3300046526 | Unclassified | 1566 |
| 522 | Ga0495642_0182622 | 3300046528 | Bacteria | 913 |
| 523 | Ga0495652_0018806 | 3300046529 | Bacteria | 6157 |
| 524 | Ga0495640_0005611 | 3300046533 | Bacteria | 9980 |
| 525 | Ga0495640_0131338 | 3300046533 | Bacteria | 1621 |
| 526 | Ga0495586_0002877 | 3300046535 | Bacteria | 9299 |
| 527 | Ga0495586_0012202 | 3300046535 | Bacteria | 4562 |
| 528 | Ga0495598_0003954 | 3300046537 | Bacteria | 3182 |
| 529 | Ga0495598_0060408 | 3300046537 | Bacteria | 1168 |
| 530 | Ga0495621_0128236 | 3300046539 | Bacteria | 985 |
| 531 | Ga0495667_0018592 | 3300046559 | Bacteria | 4692 |
| 532 | Ga0495667_0341931 | 3300046559 | Bacteria | 946 |
| 533 | Ga0495634_0003859 | 3300046642 | Bacteria | 11899 |
| 534 | Ga0495611_0128742 | 3300046648 | Bacteria | 1181 |
| 535 | Ga0495635_0124275 | 3300046663 | Bacteria | 1759 |
| 536 | Ga0495659_0073984 | 3300046664 | Bacteria | 1281 |
| 537 | Ga0495588_0102297 | 3300046674 | Bacteria | 1506 |
| 538 | Ga0495657_0112898 | 3300046675 | Bacteria | 1720 |
| 539 | Ga0495599_0048412 | 3300046678 | Bacteria | 2665 |
| 540 | Ga0495623_0220155 | 3300046679 | Bacteria | 1082 |
| 541 | Ga0495647_0004536 | 3300046681 | Bacteria | 4518 |
| 542 | Ga0495658_0002976 | 3300046683 | Bacteria | 8485 |
| 543 | Ga0495658_0034744 | 3300046683 | Bacteria | 2768 |
| 544 | Ga0495669_0018505 | 3300046684 | Bacteria | 2995 |
| 545 | Ga0495613_0022572 | 3300046689 | Bacteria | 4687 |
| 546 | Ga0495670_0240531 | 3300046691 | Bacteria | 964 |
| 547 | Ga0495600_0085276 | 3300046809 | Bacteria | 2061 |
| 548 | Ga0495581_0055652 | 3300047315 | Bacteria | 2283 |
| 549 | Ga0495581_0215584 | 3300047315 | Bacteria | 1122 |
| 550 | Ga0495604_0023166 | 3300047317 | Bacteria | 4956 |
| 551 | Ga0495636_0001503 | 3300047318 | Bacteria | 8839 |
| 552 | Ga0495674_0841876 | 3300047319 | Unclassified | 711 |
| 553 | Ga0495680_0003153 | 3300047322 | Bacteria | 16423 |
| 554 | Ga0495684_0080609 | 3300047471 | Bacteria | 2471 |
| 555 | Ga0495593_0091221 | 3300047673 | Bacteria | 1569 |
| 556 | Ga0495593_0158601 | 3300047673 | Bacteria | 1143 |
| 557 | Ga0495615_0025724 | 3300048090 | Bacteria | 1369 |
| 558 | Ga0495626_0071561 | 3300048091 | Bacteria | 1558 |
| 559 | Ga0496100_0088854 | 3300048903 | Unclassified | 2104 |
| 560 | Ga0496105_0171524 | 3300048908 | Unclassified | 1778 |
| 561 | Ga0496108_0010030 | 3300048911 | Bacteria | 7681 |
| 562 | Ga0496109_0047620 | 3300048912 | Unclassified | 3898 |
| 563 | Ga0496110_0438354 | 3300048913 | Unclassified | 1191 |
| 564 | Ga0496111_0742683 | 3300048914 | Unclassified | 712 |
| 565 | Ga0496112_0435113 | 3300048915 | Unclassified | 1250 |
| 566 | Ga0496114_0047310 | 3300048917 | Unclassified | 3578 |
| 567 | Ga0501295_063308 | 3300049518 | Bacteria | 814 |
| 568 | Ga0501303_020804 | 3300049526 | Bacteria | 698 |
| 569 | Ga0501031_0569402 | 3300049568 | Bacteria | 729 |
| 570 | Ga0501033_0004302 | 3300049570 | Bacteria | 11431 |
| 571 | Ga0501033_0202638 | 3300049570 | Bacteria | 1417 |
| 572 | Ga0501034_0248880 | 3300049571 | Bacteria | 1722 |
| 573 | Ga0501036_0007640 | 3300049572 | Bacteria | 8825 |
| 574 | Ga0501037_0077038 | 3300049573 | Bacteria | 2420 |
| 575 | Ga0501038_0009797 | 3300049574 | Bacteria | 8773 |
| 576 | Ga0501038_0083392 | 3300049574 | Bacteria | 2691 |
| 577 | Ga0501038_0109946 | 3300049574 | Bacteria | 2284 |
| 578 | Ga0501039_0040577 | 3300049575 | Bacteria | 3593 |
| 579 | Ga0501039_0043405 | 3300049575 | Bacteria | 3473 |
| 580 | Ga0501040_0010363 | 3300049576 | Bacteria | 6092 |
| 581 | Ga0501040_0778790 | 3300049576 | Unclassified | 692 |
| 582 | Ga0501041_0022283 | 3300049577 | Bacteria | 3791 |
| 583 | Ga0501041_0072755 | 3300049577 | Bacteria | 2112 |
| 584 | Ga0501041_0158155 | 3300049577 | Bacteria | 1416 |
| 585 | Ga0501041_0423129 | 3300049577 | Bacteria | 845 |
| 586 | Ga0501042_0036886 | 3300049578 | Bacteria | 3468 |
| 587 | Ga0501042_0073104 | 3300049578 | Bacteria | 2453 |
| 588 | Ga0501042_0525863 | 3300049578 | Bacteria | 859 |
| 589 | Ga0501043_0206279 | 3300049579 | Bacteria | 1524 |
| 590 | Ga0501046_0005657 | 3300049580 | Bacteria | 11155 |
| 591 | Ga0501046_0699481 | 3300049580 | Bacteria | 714 |
| 592 | Ga0501047_0039645 | 3300049581 | Bacteria | 4555 |
| 593 | Ga0501048_0000710 | 3300049582 | Bacteria | 24338 |
| 594 | Ga0501048_0049078 | 3300049582 | Bacteria | 3009 |
| 595 | Ga0501068_0111785 | 3300049584 | Bacteria | 1699 |
| 596 | Ga0501068_0122354 | 3300049584 | Bacteria | 1623 |
| 597 | Ga0501071_0003868 | 3300049587 | Bacteria | 9430 |
| 598 | Ga0501071_0006673 | 3300049587 | Bacteria | 7499 |
| 599 | Ga0501071_0095521 | 3300049587 | Bacteria | 2187 |
| 600 | Ga0501072_0005751 | 3300049588 | Bacteria | 9443 |
| 601 | Ga0501072_0083125 | 3300049588 | Bacteria | 2538 |
| 602 | Ga0501072_0138639 | 3300049588 | Bacteria | 1939 |
| 603 | Ga0501073_0095529 | 3300049589 | Bacteria | 2064 |
| 604 | Ga0501074_0012747 | 3300049590 | Bacteria | 6112 |
| 605 | Ga0501075_0015580 | 3300049591 | Bacteria | 5456 |
| 606 | Ga0501075_0020387 | 3300049591 | Bacteria | 4822 |
| 607 | Ga0501075_0114606 | 3300049591 | Bacteria | 2049 |
| 608 | Ga0501076_0006184 | 3300049592 | Bacteria | 8666 |
| 609 | Ga0501076_0008009 | 3300049592 | Bacteria | 7717 |
| 610 | Ga0501076_0016851 | 3300049592 | Bacteria | 5547 |
| 611 | Ga0501076_0463939 | 3300049592 | Bacteria | 1043 |
| 612 | Ga0501077_0023718 | 3300049593 | Bacteria | 3889 |
| 613 | Ga0501077_0371600 | 3300049593 | Unclassified | 913 |
| 614 | Ga0501208_037513 | 3300049655 | Bacteria | 884 |
| 615 | Ga0501249_006974 | 3300049679 | Bacteria | 2328 |
| 616 | Ga0501234_047494 | 3300049707 | Bacteria | 710 |
| 617 | Ga0501079_0010905 | 3300049741 | Bacteria | 6922 |
| 618 | Ga0501079_0022602 | 3300049741 | Bacteria | 4823 |
| 619 | Ga0501079_0167374 | 3300049741 | Bacteria | 1714 |
| 620 | Ga0501080_0007156 | 3300049742 | Bacteria | 10071 |
| 621 | Ga0501080_0062202 | 3300049742 | Bacteria | 3474 |
| 622 | Ga0501080_0227766 | 3300049742 | Bacteria | 1704 |
| 623 | Ga0501081_0000714 | 3300049743 | Bacteria | 19270 |
| 624 | Ga0501081_0006055 | 3300049743 | Bacteria | 7835 |
| 625 | Ga0501081_0179226 | 3300049743 | Bacteria | 1532 |
| 626 | Ga0501081_0933845 | 3300049743 | Bacteria | 655 |
| 627 | Ga0501035_0061537 | 3300049822 | Bacteria | 3341 |
| 628 | Ga0501035_0595198 | 3300049822 | Bacteria | 902 |
| 629 | Ga0501044_0532326 | 3300049823 | Bacteria | 1074 |
| 630 | Ga0501045_0004736 | 3300049824 | Bacteria | 9386 |
| 631 | Ga0501045_0208343 | 3300049824 | Bacteria | 1456 |
| 632 | Ga0501045_0275279 | 3300049824 | Bacteria | 1253 |
| 633 | Ga0501045_0419573 | 3300049824 | Unclassified | 995 |
| 634 | nmdc:mga0k408_206347_c1 | 3300050493 | Unclassified | 1173 |
| 635 | nmdc:mga05p37_159_c1 | 3300050507 | Bacteria | 65013 |
| 636 | nmdc:mga05p37_258357_c1 | 3300050507 | Bacteria | 2086 |
| 637 | nmdc:mga05p37_336349_c1 | 3300050507 | Bacteria | 1782 |
| 638 | nmdc:mga05p37_498195_c1 | 3300050507 | Bacteria | 1399 |
| 639 | nmdc:mga09592_117342_c1 | 3300050508 | Bacteria | 2284 |
| 640 | nmdc:mga09592_1447_c1 | 3300050508 | Bacteria | 19043 |
| 641 | nmdc:mga09592_1672_c1 | 3300050508 | Bacteria | 17873 |
| 642 | nmdc:mga09592_6035_c1 | 3300050508 | Bacteria | 9883 |
| 643 | nmdc:mga09592_877384_c1 | 3300050508 | Unclassified | 755 |
| 644 | nmdc:mga0qj67_145171_c1 | 3300050509 | Bacteria | 1924 |
| 645 | nmdc:mga0qj67_18024_c1 | 3300050509 | Bacteria | 5378 |
| 646 | nmdc:mga0qj67_645753_c1 | 3300050509 | Bacteria | 844 |
| 647 | nmdc:mga0qj67_9360_c1 | 3300050509 | Bacteria | 7286 |
| 648 | nmdc:mga06r32_11486_c1 | 3300050510 | Bacteria | 7976 |
| 649 | nmdc:mga06r32_516208_c1 | 3300050510 | Bacteria | 1171 |
| 650 | nmdc:mga06r32_91110_c1 | 3300050510 | Bacteria | 2979 |
| 651 | nmdc:mga08y16_10893_c1 | 3300050511 | Bacteria | 9552 |
| 652 | nmdc:mga08y16_14255_c1 | 3300050511 | Bacteria | 8365 |
| 653 | nmdc:mga08y16_15839_c1 | 3300050511 | Bacteria | 7923 |
| 654 | nmdc:mga08y16_159352_c1 | 3300050511 | Bacteria | 2345 |
| 655 | nmdc:mga08y16_430243_c1 | 3300050511 | Bacteria | 1348 |
| 656 | nmdc:mga08y16_7728_c1 | 3300050511 | Bacteria | 11261 |
| 657 | nmdc:mga08y16_81071_c1 | 3300050511 | Bacteria | 3383 |
| 658 | nmdc:mga0n895_201894_c1 | 3300050512 | Bacteria | 2019 |
| 659 | nmdc:mga0n895_2433_c1 | 3300050512 | Bacteria | 14531 |
| 660 | nmdc:mga0n895_9411_c1 | 3300050512 | Bacteria | 8548 |
| 661 | nmdc:mga0rr50_210556_c1 | 3300050513 | Bacteria | 1601 |
| 662 | nmdc:mga0rr50_24328_c1 | 3300050513 | Bacteria | 4194 |
| 663 | nmdc:mga0rr50_25242_c1 | 3300050513 | Bacteria | 4129 |
| 664 | nmdc:mga08x19_1548_c1 | 3300050514 | Bacteria | 14256 |
| 665 | nmdc:mga08x19_18755_c1 | 3300050514 | Bacteria | 4241 |
| 666 | nmdc:mga08x19_203710_c1 | 3300050514 | Bacteria | 1357 |
| 667 | nmdc:mga08x19_38836_c1 | 3300050514 | Bacteria | 2464 |
| 668 | nmdc:mga08x19_4750_c1 | 3300050514 | Bacteria | 8057 |
| 669 | nmdc:mga0a205_1388_c1 | 3300050515 | Bacteria | 20474 |
| 670 | nmdc:mga0a205_188178_c1 | 3300050515 | Bacteria | 1957 |
| 671 | nmdc:mga0a205_74483_c1 | 3300050515 | Bacteria | 851 |
| 672 | Ga0495601_0009858 | 3300053077 | Bacteria | 5656 |
| 673 | Ga0495601_0124911 | 3300053077 | Bacteria | 1674 |
| 674 | Ga0495619_0507850 | 3300053085 | Bacteria | 829 |
| 675 | Ga0500583_0271088 | 3300053092 | Bacteria | 835 |
| 676 | Ga0500594_0061966 | 3300053118 | Unclassified | 1081 |
| 677 | Ga0501084_0031840 | 3300054114 | Bacteria | 4410 |
| 678 | Ga0501084_0064215 | 3300054114 | Bacteria | 3073 |
| 679 | Ga0501084_0105588 | 3300054114 | Bacteria | 2366 |
| 680 | Ga0501084_0988669 | 3300054114 | Bacteria | 707 |
| 681 | Ga0590071_062098 | 3300059421 | Bacteria | 914 |
| 682 | Ga0501082_0215835 | 3300060353 | Bacteria | 1669 |
| 683 | Ga0501082_0270301 | 3300060353 | Bacteria | 1479 |
| 684 | Ga0501082_0343780 | 3300060353 | Bacteria | 1300 |
| 685 | Ga0530510_0000803 | 3300061734 | Bacteria | 20450 |
| 686 | Ga0530510_0003054 | 3300061734 | Bacteria | 11495 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10778625 | Ga0157369_107786252 | 181 |
| 2 | 3300046519 | Ga0495632_0217553 | Ga0495632_0217553_17_583 | 181 |
| 3 | 3300031665 | Ga0316575_10134426 | Ga0316575_101344262 | 183 |
| 4 | 3300036712 | Ga0316584_0196948 | Ga0316584_0196948_351_989 | 183 |
| 5 | 3300005331 | Ga0070670_100031414 | Ga0070670_1000314143 | 184 |
| 6 | 3300006871 | Ga0075434_100408239 | Ga0075434_1004082391 | 184 |
| 7 | 3300006880 | Ga0075429_100733082 | Ga0075429_1007330822 | 184 |
| 8 | 3300025925 | Ga0207650_10037338 | Ga0207650_100373382 | 184 |
| 9 | 3300031733 | Ga0316577_10000496 | Ga0316577_100004966 | 184 |
| 10 | 3300032133 | Ga0316583_10058208 | Ga0316583_100582082 | 184 |
| 11 | 3300037588 | Ga0316581_0043788 | Ga0316581_0043788_793_1353 | 184 |
| 12 | 3300050515 | nmdc:mga0a205_74483_c1 | nmdc:mga0a205_74483_c1_128_760 | 184 |
| 13 | 3300031665 | Ga0316575_10014375 | Ga0316575_100143752 | 185 |
| 14 | 3300031727 | Ga0316576_10061095 | Ga0316576_100610952 | 189 |
| 15 | 3300005328 | Ga0070676_10391663 | Ga0070676_103916631 | 191 |
| 16 | 3300005331 | Ga0070670_100967256 | Ga0070670_1009672561 | 191 |
| 17 | 3300005336 | Ga0070680_100646845 | Ga0070680_1006468451 | 191 |
| 18 | 3300005435 | Ga0070714_100121445 | Ga0070714_1001214452 | 191 |
| 19 | 3300005535 | Ga0070684_100066324 | Ga0070684_1000663242 | 191 |
| 20 | 3300005539 | Ga0068853_100434192 | Ga0068853_1004341922 | 191 |
| 21 | 3300006846 | Ga0075430_100075634 | Ga0075430_1000756343 | 191 |
| 22 | 3300009148 | Ga0105243_10810670 | Ga0105243_108106701 | 191 |
| 23 | 3300013104 | Ga0157370_10268514 | Ga0157370_102685141 | 191 |
| 24 | 3300026121 | Ga0207683_10475970 | Ga0207683_104759702 | 191 |
| 25 | 3300027876 | Ga0209974_10034481 | Ga0209974_100344813 | 191 |
| 26 | 3300031548 | Ga0307408_100109086 | Ga0307408_1001090862 | 191 |
| 27 | 3300031824 | Ga0307413_10271587 | Ga0307413_102715872 | 191 |
| 28 | 3300032002 | Ga0307416_100025015 | Ga0307416_1000250153 | 191 |
| 29 | 3300032002 | Ga0307416_100037889 | Ga0307416_1000378893 | 191 |
| 30 | 3300032005 | Ga0307411_10078731 | Ga0307411_100787312 | 191 |
| 31 | 3300035088 | Ga0373940_0024035 | Ga0373940_0024035_956_1531 | 191 |
| 32 | 3300035115 | Ga0373941_0269533 | Ga0373941_0269533_61_636 | 191 |
| 33 | 3300035115 | Ga0373941_0326412 | Ga0373941_0326412_24_599 | 191 |
| 34 | 3300035207 | Ga0373942_0009933 | Ga0373942_0009933_26_601 | 191 |
| 35 | 3300035724 | Ga0373933_0138993 | Ga0373933_0138993_947_1522 | 191 |
| 36 | 3300036712 | Ga0316584_0476269 | Ga0316584_0476269_119_832 | 191 |
| 37 | 3300042147 | Ga0450910_053371 | Ga0450910_053371_62_637 | 191 |
| 38 | 3300049518 | Ga0501295_063308 | Ga0501295_063308_47_679 | 191 |
| 39 | 3300049526 | Ga0501303_020804 | Ga0501303_020804_33_665 | 191 |
| 40 | 3300049576 | Ga0501040_0778790 | Ga0501040_0778790_17_592 | 191 |
| 41 | 3300049679 | Ga0501249_006974 | Ga0501249_006974_1676_2308 | 191 |
| 42 | 3300049743 | Ga0501081_0933845 | Ga0501081_0933845_54_629 | 191 |
| 43 | 3300017792 | Ga0163161_10517028 | Ga0163161_105170282 | 192 |
| 44 | 3300031548 | Ga0307408_100729174 | Ga0307408_1007291741 | 194 |
| 45 | iso_pu_bacteria | 8022948649 | 8022954019 | 203 |
| 46 | 3300009545 | Ga0105237_10000137 | Ga0105237_1000013785 | 204 |
| 47 | 3300025914 | Ga0207671_10001268 | Ga0207671_1000126823 | 204 |
| 48 | 3300053085 | Ga0495619_0507850 | Ga0495619_0507850_109_723 | 204 |
| 49 | iso_pu_bacteria | 2857604169 | 2857607966 | 204 |
| 50 | iso_pu_bacteria | 2945991243 | 2945991989 | 204 |
| 51 | iso_pu_bacteria | 2946053406 | 2946054235 | 204 |
| 52 | 3300044673 | Ga0453683_0070980 | Ga0453683_0070980_1359_1994 | 207 |
| 53 | 3300044712 | Ga0453684_0040799 | Ga0453684_0040799_4784_5419 | 207 |
| 54 | 3300039062 | Ga0400483_203037 | Ga0400483_203037_689_1327 | 208 |
| 55 | 3300045051 | Ga0451576_0124571 | Ga0451576_0124571_143_775 | 208 |
| 56 | 3300004798 | Ga0058859_10033578 | Ga0058859_100335782 | 209 |
| 57 | 3300004800 | Ga0058861_10058411 | Ga0058861_100584111 | 209 |
| 58 | 3300004801 | Ga0058860_12196631 | Ga0058860_121966311 | 209 |
| 59 | 3300005295 | Ga0065707_10146536 | Ga0065707_101465362 | 209 |
| 60 | 3300005330 | Ga0070690_100004639 | Ga0070690_1000046397 | 209 |
| 61 | 3300005330 | Ga0070690_100180716 | Ga0070690_1001807162 | 209 |
| 62 | 3300005334 | Ga0068869_100001704 | Ga0068869_1000017047 | 209 |
| 63 | 3300005335 | Ga0070666_10562615 | Ga0070666_105626151 | 209 |
| 64 | 3300005336 | Ga0070680_100002230 | Ga0070680_1000022302 | 209 |
| 65 | 3300005336 | Ga0070680_100147061 | Ga0070680_1001470612 | 209 |
| 66 | 3300005336 | Ga0070680_100151862 | Ga0070680_1001518622 | 209 |
| 67 | 3300005337 | Ga0070682_100000067 | Ga0070682_10000006752 | 209 |
| 68 | 3300005338 | Ga0068868_100057979 | Ga0068868_1000579792 | 209 |
| 69 | 3300005340 | Ga0070689_100057603 | Ga0070689_1000576032 | 209 |
| 70 | 3300005340 | Ga0070689_100221966 | Ga0070689_1002219662 | 209 |
| 71 | 3300005341 | Ga0070691_10001570 | Ga0070691_1000157010 | 209 |
| 72 | 3300005343 | Ga0070687_100000821 | Ga0070687_1000008213 | 209 |
| 73 | 3300005343 | Ga0070687_100506623 | Ga0070687_1005066232 | 209 |
| 74 | 3300005345 | Ga0070692_10095755 | Ga0070692_100957551 | 209 |
| 75 | 3300005353 | Ga0070669_100495355 | Ga0070669_1004953552 | 209 |
| 76 | 3300005356 | Ga0070674_100044977 | Ga0070674_1000449773 | 209 |
| 77 | 3300005364 | Ga0070673_100160848 | Ga0070673_1001608482 | 209 |
| 78 | 3300005438 | Ga0070701_10012125 | Ga0070701_100121254 | 209 |
| 79 | 3300005440 | Ga0070705_100012874 | Ga0070705_1000128744 | 209 |
| 80 | 3300005440 | Ga0070705_100014567 | Ga0070705_1000145674 | 209 |
| 81 | 3300005440 | Ga0070705_100021347 | Ga0070705_1000213473 | 209 |
| 82 | 3300005440 | Ga0070705_100095597 | Ga0070705_1000955972 | 209 |
| 83 | 3300005440 | Ga0070705_100105337 | Ga0070705_1001053372 | 209 |
| 84 | 3300005441 | Ga0070700_100004048 | Ga0070700_1000040487 | 209 |
| 85 | 3300005441 | Ga0070700_100076611 | Ga0070700_1000766112 | 209 |
| 86 | 3300005444 | Ga0070694_100004096 | Ga0070694_1000040963 | 209 |
| 87 | 3300005444 | Ga0070694_100019702 | Ga0070694_1000197024 | 209 |
| 88 | 3300005444 | Ga0070694_100236780 | Ga0070694_1002367802 | 209 |
| 89 | 3300005444 | Ga0070694_100255878 | Ga0070694_1002558781 | 209 |
| 90 | 3300005444 | Ga0070694_100362047 | Ga0070694_1003620472 | 209 |
| 91 | 3300005445 | Ga0070708_100286305 | Ga0070708_1002863052 | 209 |
| 92 | 3300005456 | Ga0070678_100687157 | Ga0070678_1006871571 | 209 |
| 93 | 3300005458 | Ga0070681_10000720 | Ga0070681_1000072014 | 209 |
| 94 | 3300005458 | Ga0070681_10181712 | Ga0070681_101817122 | 209 |
| 95 | 3300005459 | Ga0068867_100006962 | Ga0068867_1000069627 | 209 |
| 96 | 3300005459 | Ga0068867_100007000 | Ga0068867_1000070006 | 209 |
| 97 | 3300005459 | Ga0068867_100688865 | Ga0068867_1006888652 | 209 |
| 98 | 3300005467 | Ga0070706_100300453 | Ga0070706_1003004532 | 209 |
| 99 | 3300005468 | Ga0070707_100067608 | Ga0070707_1000676081 | 209 |
| 100 | 3300005530 | Ga0070679_100041060 | Ga0070679_1000410605 | 209 |
| 101 | 3300005536 | Ga0070697_100089743 | Ga0070697_1000897432 | 209 |
| 102 | 3300005543 | Ga0070672_100028480 | Ga0070672_1000284802 | 209 |
| 103 | 3300005544 | Ga0070686_100003451 | Ga0070686_1000034512 | 209 |
| 104 | 3300005544 | Ga0070686_100024914 | Ga0070686_1000249144 | 209 |
| 105 | 3300005545 | Ga0070695_100001782 | Ga0070695_1000017822 | 209 |
| 106 | 3300005545 | Ga0070695_100161565 | Ga0070695_1001615652 | 209 |
| 107 | 3300005545 | Ga0070695_100230913 | Ga0070695_1002309131 | 209 |
| 108 | 3300005546 | Ga0070696_100031211 | Ga0070696_1000312115 | 209 |
| 109 | 3300005547 | Ga0070693_100027535 | Ga0070693_1000275353 | 209 |
| 110 | 3300005547 | Ga0070693_100234627 | Ga0070693_1002346272 | 209 |
| 111 | 3300005549 | Ga0070704_100004949 | Ga0070704_1000049499 | 209 |
| 112 | 3300005549 | Ga0070704_100019763 | Ga0070704_1000197634 | 209 |
| 113 | 3300005549 | Ga0070704_100115794 | Ga0070704_1001157942 | 209 |
| 114 | 3300005549 | Ga0070704_100225158 | Ga0070704_1002251582 | 209 |
| 115 | 3300005563 | Ga0068855_100005265 | Ga0068855_1000052652 | 209 |
| 116 | 3300005578 | Ga0068854_100070570 | Ga0068854_1000705703 | 209 |
| 117 | 3300005614 | Ga0068856_100013045 | Ga0068856_1000130457 | 209 |
| 118 | 3300005614 | Ga0068856_100769210 | Ga0068856_1007692101 | 209 |
| 119 | 3300005615 | Ga0070702_100001902 | Ga0070702_1000019028 | 209 |
| 120 | 3300005615 | Ga0070702_100033529 | Ga0070702_1000335293 | 209 |
| 121 | 3300005616 | Ga0068852_100221920 | Ga0068852_1002219202 | 209 |
| 122 | 3300005617 | Ga0068859_100033006 | Ga0068859_1000330064 | 209 |
| 123 | 3300005617 | Ga0068859_100050635 | Ga0068859_1000506355 | 209 |
| 124 | 3300005617 | Ga0068859_100258639 | Ga0068859_1002586392 | 209 |
| 125 | 3300005618 | Ga0068864_100104887 | Ga0068864_1001048872 | 209 |
| 126 | 3300005718 | Ga0068866_10001148 | Ga0068866_100011486 | 209 |
| 127 | 3300005718 | Ga0068866_10021798 | Ga0068866_100217983 | 209 |
| 128 | 3300005719 | Ga0068861_100034873 | Ga0068861_1000348733 | 209 |
| 129 | 3300005841 | Ga0068863_100345866 | Ga0068863_1003458662 | 209 |
| 130 | 3300005841 | Ga0068863_100684378 | Ga0068863_1006843781 | 209 |
| 131 | 3300005842 | Ga0068858_100071360 | Ga0068858_1000713603 | 209 |
| 132 | 3300005843 | Ga0068860_100190370 | Ga0068860_1001903701 | 209 |
| 133 | 3300005843 | Ga0068860_100431537 | Ga0068860_1004315372 | 209 |
| 134 | 3300005844 | Ga0068862_100018223 | Ga0068862_1000182233 | 209 |
| 135 | 3300005844 | Ga0068862_100136303 | Ga0068862_1001363032 | 209 |
| 136 | 3300005981 | Ga0081538_10036883 | Ga0081538_100368833 | 209 |
| 137 | 3300005985 | Ga0081539_10002158 | Ga0081539_100021585 | 209 |
| 138 | 3300006163 | Ga0070715_10054753 | Ga0070715_100547532 | 209 |
| 139 | 3300006237 | Ga0097621_100101724 | Ga0097621_1001017242 | 209 |
| 140 | 3300006237 | Ga0097621_100158256 | Ga0097621_1001582562 | 209 |
| 141 | 3300006358 | Ga0068871_100009825 | Ga0068871_1000098252 | 209 |
| 142 | 3300006358 | Ga0068871_100036675 | Ga0068871_1000366752 | 209 |
| 143 | 3300006844 | Ga0075428_100005942 | Ga0075428_1000059422 | 209 |
| 144 | 3300006844 | Ga0075428_100016454 | Ga0075428_1000164544 | 209 |
| 145 | 3300006844 | Ga0075428_100032886 | Ga0075428_1000328866 | 209 |
| 146 | 3300006846 | Ga0075430_100013066 | Ga0075430_1000130665 | 209 |
| 147 | 3300006846 | Ga0075430_100142818 | Ga0075430_1001428182 | 209 |
| 148 | 3300006846 | Ga0075430_100271399 | Ga0075430_1002713992 | 209 |
| 149 | 3300006846 | Ga0075430_100331034 | Ga0075430_1003310342 | 209 |
| 150 | 3300006846 | Ga0075430_100441106 | Ga0075430_1004411062 | 209 |
| 151 | 3300006847 | Ga0075431_100007501 | Ga0075431_1000075014 | 209 |
| 152 | 3300006847 | Ga0075431_100229406 | Ga0075431_1002294062 | 209 |
| 153 | 3300006847 | Ga0075431_100508616 | Ga0075431_1005086162 | 209 |
| 154 | 3300006871 | Ga0075434_100000637 | Ga0075434_10000063728 | 209 |
| 155 | 3300006871 | Ga0075434_100027268 | Ga0075434_1000272685 | 209 |
| 156 | 3300006880 | Ga0075429_100002429 | Ga0075429_10000242910 | 209 |
| 157 | 3300006880 | Ga0075429_100165976 | Ga0075429_1001659762 | 209 |
| 158 | 3300006881 | Ga0068865_100020691 | Ga0068865_1000206914 | 209 |
| 159 | 3300006914 | Ga0075436_100002105 | Ga0075436_10000210511 | 209 |
| 160 | 3300006914 | Ga0075436_100009310 | Ga0075436_1000093107 | 209 |
| 161 | 3300006914 | Ga0075436_100333261 | Ga0075436_1003332612 | 209 |
| 162 | 3300006914 | Ga0075436_100355268 | Ga0075436_1003552682 | 209 |
| 163 | 3300006931 | Ga0097620_100033005 | Ga0097620_1000330056 | 209 |
| 164 | 3300006931 | Ga0097620_100050640 | Ga0097620_1000506405 | 209 |
| 165 | 3300006931 | Ga0097620_100258639 | Ga0097620_1002586392 | 209 |
| 166 | 3300007076 | Ga0075435_100011829 | Ga0075435_1000118297 | 209 |
| 167 | 3300007076 | Ga0075435_100022586 | Ga0075435_1000225863 | 209 |
| 168 | 3300007076 | Ga0075435_100219341 | Ga0075435_1002193412 | 209 |
| 169 | 3300007265 | Ga0099794_10016647 | Ga0099794_100166472 | 209 |
| 170 | 3300009093 | Ga0105240_10719459 | Ga0105240_107194592 | 209 |
| 171 | 3300009094 | Ga0111539_10254824 | Ga0111539_102548242 | 209 |
| 172 | 3300009098 | Ga0105245_10004171 | Ga0105245_100041712 | 209 |
| 173 | 3300009147 | Ga0114129_10007266 | Ga0114129_100072667 | 209 |
| 174 | 3300009147 | Ga0114129_10311632 | Ga0114129_103116322 | 209 |
| 175 | 3300009148 | Ga0105243_10084982 | Ga0105243_100849822 | 209 |
| 176 | 3300009148 | Ga0105243_10286988 | Ga0105243_102869882 | 209 |
| 177 | 3300009174 | Ga0105241_10011280 | Ga0105241_100112802 | 209 |
| 178 | 3300009176 | Ga0105242_10003038 | Ga0105242_100030382 | 209 |
| 179 | 3300009177 | Ga0105248_10111632 | Ga0105248_101116322 | 209 |
| 180 | 3300009553 | Ga0105249_10035913 | Ga0105249_100359135 | 209 |
| 181 | 3300010375 | Ga0105239_10657321 | Ga0105239_106573212 | 209 |
| 182 | 3300013297 | Ga0157378_10011451 | Ga0157378_100114512 | 209 |
| 183 | 3300013297 | Ga0157378_10023055 | Ga0157378_100230552 | 209 |
| 184 | 3300013306 | Ga0163162_10134166 | Ga0163162_101341663 | 209 |
| 185 | 3300014326 | Ga0157380_10042501 | Ga0157380_100425013 | 209 |
| 186 | 3300014326 | Ga0157380_10239130 | Ga0157380_102391301 | 209 |
| 187 | 3300014745 | Ga0157377_10212957 | Ga0157377_102129572 | 209 |
| 188 | 3300014968 | Ga0157379_10132788 | Ga0157379_101327882 | 209 |
| 189 | 3300014969 | Ga0157376_10008195 | Ga0157376_100081957 | 209 |
| 190 | 3300014969 | Ga0157376_10633135 | Ga0157376_106331351 | 209 |
| 191 | 3300017792 | Ga0163161_10090480 | Ga0163161_100904801 | 209 |
| 192 | 3300025885 | Ga0207653_10013523 | Ga0207653_100135232 | 209 |
| 193 | 3300025893 | Ga0207682_10017696 | Ga0207682_100176963 | 209 |
| 194 | 3300025899 | Ga0207642_10019300 | Ga0207642_100193002 | 209 |
| 195 | 3300025899 | Ga0207642_10019861 | Ga0207642_100198612 | 209 |
| 196 | 3300025905 | Ga0207685_10003876 | Ga0207685_100038764 | 209 |
| 197 | 3300025907 | Ga0207645_10059989 | Ga0207645_100599892 | 209 |
| 198 | 3300025907 | Ga0207645_10279262 | Ga0207645_102792622 | 209 |
| 199 | 3300025908 | Ga0207643_10022173 | Ga0207643_100221733 | 209 |
| 200 | 3300025908 | Ga0207643_10087835 | Ga0207643_100878352 | 209 |
| 201 | 3300025912 | Ga0207707_10015506 | Ga0207707_100155062 | 209 |
| 202 | 3300025917 | Ga0207660_10036650 | Ga0207660_100366503 | 209 |
| 203 | 3300025917 | Ga0207660_10096295 | Ga0207660_100962952 | 209 |
| 204 | 3300025917 | Ga0207660_10543360 | Ga0207660_105433602 | 209 |
| 205 | 3300025918 | Ga0207662_10000163 | Ga0207662_100001632 | 209 |
| 206 | 3300025918 | Ga0207662_10185761 | Ga0207662_101857611 | 209 |
| 207 | 3300025921 | Ga0207652_10048128 | Ga0207652_100481283 | 209 |
| 208 | 3300025923 | Ga0207681_10013598 | Ga0207681_100135983 | 209 |
| 209 | 3300025927 | Ga0207687_10005036 | Ga0207687_100050362 | 209 |
| 210 | 3300025933 | Ga0207706_10364202 | Ga0207706_103642022 | 209 |
| 211 | 3300025934 | Ga0207686_10009441 | Ga0207686_100094412 | 209 |
| 212 | 3300025935 | Ga0207709_10005265 | Ga0207709_100052657 | 209 |
| 213 | 3300025935 | Ga0207709_10151407 | Ga0207709_101514072 | 209 |
| 214 | 3300025935 | Ga0207709_10388809 | Ga0207709_103888091 | 209 |
| 215 | 3300025936 | Ga0207670_10039813 | Ga0207670_100398133 | 209 |
| 216 | 3300025937 | Ga0207669_10067790 | Ga0207669_100677903 | 209 |
| 217 | 3300025937 | Ga0207669_10180198 | Ga0207669_101801982 | 209 |
| 218 | 3300025938 | Ga0207704_10002799 | Ga0207704_100027992 | 209 |
| 219 | 3300025940 | Ga0207691_10112465 | Ga0207691_101124652 | 209 |
| 220 | 3300025940 | Ga0207691_10253063 | Ga0207691_102530632 | 209 |
| 221 | 3300025941 | Ga0207711_10384812 | Ga0207711_103848121 | 209 |
| 222 | 3300025942 | Ga0207689_10004260 | Ga0207689_1000426012 | 209 |
| 223 | 3300025942 | Ga0207689_10155942 | Ga0207689_101559423 | 209 |
| 224 | 3300025949 | Ga0207667_10023823 | Ga0207667_100238236 | 209 |
| 225 | 3300025961 | Ga0207712_10013646 | Ga0207712_100136462 | 209 |
| 226 | 3300025961 | Ga0207712_10073959 | Ga0207712_100739593 | 209 |
| 227 | 3300025981 | Ga0207640_10013576 | Ga0207640_100135762 | 209 |
| 228 | 3300026023 | Ga0207677_10004527 | Ga0207677_100045277 | 209 |
| 229 | 3300026035 | Ga0207703_10130021 | Ga0207703_101300212 | 209 |
| 230 | 3300026041 | Ga0207639_10779526 | Ga0207639_107795261 | 209 |
| 231 | 3300026075 | Ga0207708_10000681 | Ga0207708_1000068127 | 209 |
| 232 | 3300026075 | Ga0207708_10025718 | Ga0207708_100257183 | 209 |
| 233 | 3300026075 | Ga0207708_10384773 | Ga0207708_103847732 | 209 |
| 234 | 3300026075 | Ga0207708_10769210 | Ga0207708_107692101 | 209 |
| 235 | 3300026078 | Ga0207702_10245149 | Ga0207702_102451492 | 209 |
| 236 | 3300026078 | Ga0207702_10416792 | Ga0207702_104167922 | 209 |
| 237 | 3300026089 | Ga0207648_10003529 | Ga0207648_1000352915 | 209 |
| 238 | 3300026089 | Ga0207648_10032369 | Ga0207648_100323694 | 209 |
| 239 | 3300026116 | Ga0207674_10276961 | Ga0207674_102769611 | 209 |
| 240 | 3300026118 | Ga0207675_100008285 | Ga0207675_1000082853 | 209 |
| 241 | 3300026118 | Ga0207675_100036108 | Ga0207675_1000361082 | 209 |
| 242 | 3300026142 | Ga0207698_10137664 | Ga0207698_101376642 | 209 |
| 243 | 3300027360 | Ga0209969_1001056 | Ga0209969_10010562 | 209 |
| 244 | 3300027360 | Ga0209969_1003774 | Ga0209969_10037742 | 209 |
| 245 | 3300027364 | Ga0209967_1001952 | Ga0209967_10019522 | 209 |
| 246 | 3300027364 | Ga0209967_1003896 | Ga0209967_10038962 | 209 |
| 247 | 3300027364 | Ga0209967_1006633 | Ga0209967_10066332 | 209 |
| 248 | 3300027378 | Ga0209981_1003912 | Ga0209981_10039122 | 209 |
| 249 | 3300027378 | Ga0209981_1024359 | Ga0209981_10243592 | 209 |
| 250 | 3300027462 | Ga0210000_1001599 | Ga0210000_10015992 | 209 |
| 251 | 3300027471 | Ga0209995_1007921 | Ga0209995_10079212 | 209 |
| 252 | 3300027526 | Ga0209968_1011259 | Ga0209968_10112592 | 209 |
| 253 | 3300027526 | Ga0209968_1021452 | Ga0209968_10214522 | 209 |
| 254 | 3300027543 | Ga0209999_1002337 | Ga0209999_10023372 | 209 |
| 255 | 3300027543 | Ga0209999_1003514 | Ga0209999_10035142 | 209 |
| 256 | 3300027552 | Ga0209982_1006927 | Ga0209982_10069272 | 209 |
| 257 | 3300027614 | Ga0209970_1010270 | Ga0209970_10102702 | 209 |
| 258 | 3300027665 | Ga0209983_1012983 | Ga0209983_10129832 | 209 |
| 259 | 3300027671 | Ga0209588_1027513 | Ga0209588_10275132 | 209 |
| 260 | 3300027682 | Ga0209971_1002199 | Ga0209971_10021992 | 209 |
| 261 | 3300027695 | Ga0209966_1072428 | Ga0209966_10724281 | 209 |
| 262 | 3300027876 | Ga0209974_10023562 | Ga0209974_100235622 | 209 |
| 263 | 3300027907 | Ga0207428_10009598 | Ga0207428_100095986 | 209 |
| 264 | 3300027907 | Ga0207428_10104029 | Ga0207428_101040292 | 209 |
| 265 | 3300028380 | Ga0268265_10009420 | Ga0268265_100094206 | 209 |
| 266 | 3300028380 | Ga0268265_10023106 | Ga0268265_100231062 | 209 |
| 267 | 3300028381 | Ga0268264_10063281 | Ga0268264_100632813 | 209 |
| 268 | 3300028381 | Ga0268264_10536139 | Ga0268264_105361392 | 209 |
| 269 | 3300031548 | Ga0307408_100185101 | Ga0307408_1001851012 | 209 |
| 270 | 3300031548 | Ga0307408_100623193 | Ga0307408_1006231932 | 209 |
| 271 | 3300032002 | Ga0307416_100696797 | Ga0307416_1006967972 | 209 |
| 272 | 3300034816 | Ga0373930_0011207 | Ga0373930_0011207_352_981 | 209 |
| 273 | 3300034817 | Ga0373948_0009510 | Ga0373948_0009510_49_678 | 209 |
| 274 | 3300034818 | Ga0373950_0043071 | Ga0373950_0043071_127_756 | 209 |
| 275 | 3300034820 | Ga0373959_0031152 | Ga0373959_0031152_260_889 | 209 |
| 276 | 3300035083 | Ga0373926_0026171 | Ga0373926_0026171_573_1202 | 209 |
| 277 | 3300035086 | Ga0373934_0169594 | Ga0373934_0169594_58_687 | 209 |
| 278 | 3300035089 | Ga0373944_0045043 | Ga0373944_0045043_708_1337 | 209 |
| 279 | 3300035090 | Ga0373949_0008362 | Ga0373949_0008362_359_988 | 209 |
| 280 | 3300035091 | Ga0373951_0070860 | Ga0373951_0070860_163_792 | 209 |
| 281 | 3300035112 | Ga0373932_0012620 | Ga0373932_0012620_1285_1914 | 209 |
| 282 | 3300035113 | Ga0373936_0012256 | Ga0373936_0012256_594_1223 | 209 |
| 283 | 3300035114 | Ga0373939_0026251 | Ga0373939_0026251_928_1557 | 209 |
| 284 | 3300035115 | Ga0373941_0175270 | Ga0373941_0175270_139_768 | 209 |
| 285 | 3300035116 | Ga0373945_0020753 | Ga0373945_0020753_824_1453 | 209 |
| 286 | 3300035118 | Ga0373954_0000129 | Ga0373954_0000129_19451_20080 | 209 |
| 287 | 3300035119 | Ga0373956_0120504 | Ga0373956_0120504_74_703 | 209 |
| 288 | 3300035119 | Ga0373956_0131704 | Ga0373956_0131704_394_1023 | 209 |
| 289 | 3300035121 | Ga0373960_0031189 | Ga0373960_0031189_218_847 | 209 |
| 290 | 3300035170 | Ga0373943_0030426 | Ga0373943_0030426_594_1223 | 209 |
| 291 | 3300035171 | Ga0373946_0000875 | Ga0373946_0000875_710_1339 | 209 |
| 292 | 3300035410 | Ga0373924_0120630 | Ga0373924_0120630_447_1076 | 209 |
| 293 | 3300035691 | Ga0373931_0007034 | Ga0373931_0007034_968_1597 | 209 |
| 294 | 3300035691 | Ga0373931_0047102 | Ga0373931_0047102_653_1282 | 209 |
| 295 | 3300035691 | Ga0373931_0073419 | Ga0373931_0073419_784_1413 | 209 |
| 296 | 3300035692 | Ga0373935_0071557 | Ga0373935_0071557_827_1456 | 209 |
| 297 | 3300035695 | Ga0373927_0038597 | Ga0373927_0038597_675_1304 | 209 |
| 298 | 3300035724 | Ga0373933_0034476 | Ga0373933_0034476_1286_1915 | 209 |
| 299 | 3300035724 | Ga0373933_0459378 | Ga0373933_0459378_147_776 | 209 |
| 300 | 3300036401 | Ga0373937_0011632 | Ga0373937_0011632_768_1397 | 209 |
| 301 | 3300036401 | Ga0373937_0023653 | Ga0373937_0023653_610_1239 | 209 |
| 302 | 3300036401 | Ga0373937_0108522 | Ga0373937_0108522_1849_2478 | 209 |
| 303 | 3300037068 | Ga0373925_0062474 | Ga0373925_0062474_1352_1981 | 209 |
| 304 | 3300037068 | Ga0373925_0429752 | Ga0373925_0429752_300_929 | 209 |
| 305 | 3300041410 | Ga0439461_0002003 | Ga0439461_0002003_1996_2625 | 209 |
| 306 | 3300042001 | Ga0439441_001358 | Ga0439441_001358_629_1258 | 209 |
| 307 | 3300042003 | Ga0439443_003421 | Ga0439443_003421_627_1256 | 209 |
| 308 | 3300042003 | Ga0439443_010585 | Ga0439443_010585_646_1275 | 209 |
| 309 | 3300042015 | Ga0439462_0040778 | Ga0439462_0040778_526_1155 | 209 |
| 310 | 3300042435 | Ga0439434_0000967 | Ga0439434_0000967_3374_4003 | 209 |
| 311 | 3300042436 | Ga0439435_0000371 | Ga0439435_0000371_2057_2686 | 209 |
| 312 | 3300042436 | Ga0439435_0000649 | Ga0439435_0000649_2497_3126 | 209 |
| 313 | 3300042436 | Ga0439435_0013916 | Ga0439435_0013916_852_1481 | 209 |
| 314 | 3300042437 | Ga0439444_0005828 | Ga0439444_0005828_1095_1724 | 209 |
| 315 | 3300042461 | Ga0439460_0000878 | Ga0439460_0000878_5494_6123 | 209 |
| 316 | 3300042461 | Ga0439460_0011586 | Ga0439460_0011586_206_835 | 209 |
| 317 | 3300042876 | Ga0451577_0179412 | Ga0451577_0179412_985_1614 | 209 |
| 318 | 3300042876 | Ga0451577_0410102 | Ga0451577_0410102_314_943 | 209 |
| 319 | 3300044683 | Ga0466965_0434744 | Ga0466965_0434744_40_669 | 209 |
| 320 | 3300044842 | Ga0466957_0077752 | Ga0466957_0077752_735_1364 | 209 |
| 321 | 3300044901 | Ga0466960_0219048 | Ga0466960_0219048_400_1029 | 209 |
| 322 | 3300045051 | Ga0451576_0004013 | Ga0451576_0004013_17439_18068 | 209 |
| 323 | 3300045051 | Ga0451576_0403650 | Ga0451576_0403650_426_1055 | 209 |
| 324 | 3300045976 | Ga0466967_0158572 | Ga0466967_0158572_588_1217 | 209 |
| 325 | 3300046454 | Ga0495592_0009905 | Ga0495592_0009905_1436_2065 | 209 |
| 326 | 3300046455 | Ga0495603_0010186 | Ga0495603_0010186_174_803 | 209 |
| 327 | 3300046472 | Ga0495580_0019598 | Ga0495580_0019598_3844_4473 | 209 |
| 328 | 3300046475 | Ga0495639_0053008 | Ga0495639_0053008_989_1618 | 209 |
| 329 | 3300046476 | Ga0495662_0029234 | Ga0495662_0029234_1640_2269 | 209 |
| 330 | 3300046511 | Ga0495608_0003736 | Ga0495608_0003736_3223_3852 | 209 |
| 331 | 3300046516 | Ga0495628_0003842 | Ga0495628_0003842_5642_6271 | 209 |
| 332 | 3300046517 | Ga0495630_0089946 | Ga0495630_0089946_244_873 | 209 |
| 333 | 3300046526 | Ga0495666_0053849 | Ga0495666_0053849_478_1107 | 209 |
| 334 | 3300046528 | Ga0495642_0182622 | Ga0495642_0182622_112_741 | 209 |
| 335 | 3300046529 | Ga0495652_0018806 | Ga0495652_0018806_1338_1967 | 209 |
| 336 | 3300046533 | Ga0495640_0005611 | Ga0495640_0005611_4998_5627 | 209 |
| 337 | 3300046533 | Ga0495640_0131338 | Ga0495640_0131338_349_978 | 209 |
| 338 | 3300046535 | Ga0495586_0002877 | Ga0495586_0002877_7496_8125 | 209 |
| 339 | 3300046535 | Ga0495586_0012202 | Ga0495586_0012202_3047_3676 | 209 |
| 340 | 3300046537 | Ga0495598_0003954 | Ga0495598_0003954_65_694 | 209 |
| 341 | 3300046537 | Ga0495598_0060408 | Ga0495598_0060408_348_977 | 209 |
| 342 | 3300046559 | Ga0495667_0018592 | Ga0495667_0018592_1093_1722 | 209 |
| 343 | 3300046642 | Ga0495634_0003859 | Ga0495634_0003859_4764_5393 | 209 |
| 344 | 3300046663 | Ga0495635_0124275 | Ga0495635_0124275_919_1548 | 209 |
| 345 | 3300046664 | Ga0495659_0073984 | Ga0495659_0073984_195_824 | 209 |
| 346 | 3300046674 | Ga0495588_0102297 | Ga0495588_0102297_749_1384 | 209 |
| 347 | 3300046678 | Ga0495599_0048412 | Ga0495599_0048412_1132_1761 | 209 |
| 348 | 3300046679 | Ga0495623_0220155 | Ga0495623_0220155_382_1011 | 209 |
| 349 | 3300046681 | Ga0495647_0004536 | Ga0495647_0004536_1093_1722 | 209 |
| 350 | 3300046683 | Ga0495658_0002976 | Ga0495658_0002976_6830_7459 | 209 |
| 351 | 3300046683 | Ga0495658_0034744 | Ga0495658_0034744_885_1514 | 209 |
| 352 | 3300046689 | Ga0495613_0022572 | Ga0495613_0022572_3449_4078 | 209 |
| 353 | 3300046691 | Ga0495670_0240531 | Ga0495670_0240531_141_770 | 209 |
| 354 | 3300047315 | Ga0495581_0055652 | Ga0495581_0055652_691_1320 | 209 |
| 355 | 3300047317 | Ga0495604_0023166 | Ga0495604_0023166_3131_3760 | 209 |
| 356 | 3300047318 | Ga0495636_0001503 | Ga0495636_0001503_3605_4234 | 209 |
| 357 | 3300047322 | Ga0495680_0003153 | Ga0495680_0003153_4610_5239 | 209 |
| 358 | 3300047471 | Ga0495684_0080609 | Ga0495684_0080609_406_1035 | 209 |
| 359 | 3300047673 | Ga0495593_0091221 | Ga0495593_0091221_573_1202 | 209 |
| 360 | 3300047673 | Ga0495593_0158601 | Ga0495593_0158601_436_1065 | 209 |
| 361 | 3300048090 | Ga0495615_0025724 | Ga0495615_0025724_64_693 | 209 |
| 362 | 3300049568 | Ga0501031_0569402 | Ga0501031_0569402_66_695 | 209 |
| 363 | 3300049570 | Ga0501033_0004302 | Ga0501033_0004302_835_1464 | 209 |
| 364 | 3300049570 | Ga0501033_0202638 | Ga0501033_0202638_517_1146 | 209 |
| 365 | 3300049571 | Ga0501034_0248880 | Ga0501034_0248880_1072_1701 | 209 |
| 366 | 3300049572 | Ga0501036_0007640 | Ga0501036_0007640_2770_3399 | 209 |
| 367 | 3300049573 | Ga0501037_0077038 | Ga0501037_0077038_78_707 | 209 |
| 368 | 3300049574 | Ga0501038_0009797 | Ga0501038_0009797_7288_7917 | 209 |
| 369 | 3300049574 | Ga0501038_0083392 | Ga0501038_0083392_1475_2104 | 209 |
| 370 | 3300049574 | Ga0501038_0109946 | Ga0501038_0109946_1468_2097 | 209 |
| 371 | 3300049575 | Ga0501039_0040577 | Ga0501039_0040577_2489_3118 | 209 |
| 372 | 3300049575 | Ga0501039_0043405 | Ga0501039_0043405_1397_2026 | 209 |
| 373 | 3300049576 | Ga0501040_0010363 | Ga0501040_0010363_835_1464 | 209 |
| 374 | 3300049577 | Ga0501041_0022283 | Ga0501041_0022283_2079_2708 | 209 |
| 375 | 3300049577 | Ga0501041_0072755 | Ga0501041_0072755_777_1406 | 209 |
| 376 | 3300049577 | Ga0501041_0158155 | Ga0501041_0158155_332_961 | 209 |
| 377 | 3300049577 | Ga0501041_0423129 | Ga0501041_0423129_178_807 | 209 |
| 378 | 3300049578 | Ga0501042_0036886 | Ga0501042_0036886_780_1409 | 209 |
| 379 | 3300049578 | Ga0501042_0073104 | Ga0501042_0073104_1357_1986 | 209 |
| 380 | 3300049578 | Ga0501042_0525863 | Ga0501042_0525863_108_737 | 209 |
| 381 | 3300049579 | Ga0501043_0206279 | Ga0501043_0206279_589_1218 | 209 |
| 382 | 3300049580 | Ga0501046_0005657 | Ga0501046_0005657_9616_10245 | 209 |
| 383 | 3300049580 | Ga0501046_0699481 | Ga0501046_0699481_60_689 | 209 |
| 384 | 3300049581 | Ga0501047_0039645 | Ga0501047_0039645_3117_3746 | 209 |
| 385 | 3300049582 | Ga0501048_0000710 | Ga0501048_0000710_22722_23351 | 209 |
| 386 | 3300049582 | Ga0501048_0049078 | Ga0501048_0049078_1398_2027 | 209 |
| 387 | 3300049584 | Ga0501068_0111785 | Ga0501068_0111785_135_764 | 209 |
| 388 | 3300049584 | Ga0501068_0122354 | Ga0501068_0122354_921_1550 | 209 |
| 389 | 3300049587 | Ga0501071_0003868 | Ga0501071_0003868_933_1562 | 209 |
| 390 | 3300049587 | Ga0501071_0006673 | Ga0501071_0006673_1103_1732 | 209 |
| 391 | 3300049587 | Ga0501071_0095521 | Ga0501071_0095521_1533_2162 | 209 |
| 392 | 3300049588 | Ga0501072_0005751 | Ga0501072_0005751_1808_2437 | 209 |
| 393 | 3300049588 | Ga0501072_0083125 | Ga0501072_0083125_1584_2213 | 209 |
| 394 | 3300049588 | Ga0501072_0138639 | Ga0501072_0138639_635_1264 | 209 |
| 395 | 3300049589 | Ga0501073_0095529 | Ga0501073_0095529_436_1065 | 209 |
| 396 | 3300049590 | Ga0501074_0012747 | Ga0501074_0012747_1371_2000 | 209 |
| 397 | 3300049591 | Ga0501075_0015580 | Ga0501075_0015580_831_1460 | 209 |
| 398 | 3300049591 | Ga0501075_0020387 | Ga0501075_0020387_1887_2516 | 209 |
| 399 | 3300049591 | Ga0501075_0114606 | Ga0501075_0114606_268_897 | 209 |
| 400 | 3300049592 | Ga0501076_0006184 | Ga0501076_0006184_6989_7618 | 209 |
| 401 | 3300049592 | Ga0501076_0008009 | Ga0501076_0008009_6458_7087 | 209 |
| 402 | 3300049592 | Ga0501076_0016851 | Ga0501076_0016851_2340_2969 | 209 |
| 403 | 3300049592 | Ga0501076_0463939 | Ga0501076_0463939_194_823 | 209 |
| 404 | 3300049593 | Ga0501077_0023718 | Ga0501077_0023718_3155_3784 | 209 |
| 405 | 3300049593 | Ga0501077_0371600 | Ga0501077_0371600_17_646 | 209 |
| 406 | 3300049655 | Ga0501208_037513 | Ga0501208_037513_207_836 | 209 |
| 407 | 3300049707 | Ga0501234_047494 | Ga0501234_047494_32_661 | 209 |
| 408 | 3300049741 | Ga0501079_0010905 | Ga0501079_0010905_4929_5558 | 209 |
| 409 | 3300049741 | Ga0501079_0022602 | Ga0501079_0022602_2337_2966 | 209 |
| 410 | 3300049741 | Ga0501079_0167374 | Ga0501079_0167374_895_1524 | 209 |
| 411 | 3300049742 | Ga0501080_0007156 | Ga0501080_0007156_749_1378 | 209 |
| 412 | 3300049742 | Ga0501080_0062202 | Ga0501080_0062202_1762_2391 | 209 |
| 413 | 3300049742 | Ga0501080_0227766 | Ga0501080_0227766_263_892 | 209 |
| 414 | 3300049743 | Ga0501081_0000714 | Ga0501081_0000714_3450_4079 | 209 |
| 415 | 3300049743 | Ga0501081_0006055 | Ga0501081_0006055_2187_2816 | 209 |
| 416 | 3300049743 | Ga0501081_0179226 | Ga0501081_0179226_344_973 | 209 |
| 417 | 3300049822 | Ga0501035_0061537 | Ga0501035_0061537_1320_1949 | 209 |
| 418 | 3300049822 | Ga0501035_0595198 | Ga0501035_0595198_92_721 | 209 |
| 419 | 3300049823 | Ga0501044_0532326 | Ga0501044_0532326_247_876 | 209 |
| 420 | 3300049824 | Ga0501045_0004736 | Ga0501045_0004736_7310_7939 | 209 |
| 421 | 3300049824 | Ga0501045_0208343 | Ga0501045_0208343_801_1430 | 209 |
| 422 | 3300049824 | Ga0501045_0275279 | Ga0501045_0275279_361_990 | 209 |
| 423 | 3300049824 | Ga0501045_0419573 | Ga0501045_0419573_206_835 | 209 |
| 424 | 3300050507 | nmdc:mga05p37_159_c1 | nmdc:mga05p37_159_c1_15671_16300 | 209 |
| 425 | 3300050507 | nmdc:mga05p37_336349_c1 | nmdc:mga05p37_336349_c1_335_964 | 209 |
| 426 | 3300050508 | nmdc:mga09592_1447_c1 | nmdc:mga09592_1447_c1_7090_7719 | 209 |
| 427 | 3300050508 | nmdc:mga09592_1672_c1 | nmdc:mga09592_1672_c1_12520_13149 | 209 |
| 428 | 3300050508 | nmdc:mga09592_6035_c1 | nmdc:mga09592_6035_c1_4181_4810 | 209 |
| 429 | 3300050509 | nmdc:mga0qj67_145171_c1 | nmdc:mga0qj67_145171_c1_508_1137 | 209 |
| 430 | 3300050509 | nmdc:mga0qj67_18024_c1 | nmdc:mga0qj67_18024_c1_2296_2925 | 209 |
| 431 | 3300050509 | nmdc:mga0qj67_645753_c1 | nmdc:mga0qj67_645753_c1_190_819 | 209 |
| 432 | 3300050509 | nmdc:mga0qj67_9360_c1 | nmdc:mga0qj67_9360_c1_2919_3548 | 209 |
| 433 | 3300050510 | nmdc:mga06r32_11486_c1 | nmdc:mga06r32_11486_c1_183_812 | 209 |
| 434 | 3300050510 | nmdc:mga06r32_516208_c1 | nmdc:mga06r32_516208_c1_200_829 | 209 |
| 435 | 3300050510 | nmdc:mga06r32_91110_c1 | nmdc:mga06r32_91110_c1_2298_2927 | 209 |
| 436 | 3300050511 | nmdc:mga08y16_10893_c1 | nmdc:mga08y16_10893_c1_5154_5783 | 209 |
| 437 | 3300050511 | nmdc:mga08y16_159352_c1 | nmdc:mga08y16_159352_c1_197_826 | 209 |
| 438 | 3300050512 | nmdc:mga0n895_201894_c1 | nmdc:mga0n895_201894_c1_957_1586 | 209 |
| 439 | 3300050512 | nmdc:mga0n895_9411_c1 | nmdc:mga0n895_9411_c1_2644_3273 | 209 |
| 440 | 3300050513 | nmdc:mga0rr50_24328_c1 | nmdc:mga0rr50_24328_c1_902_1531 | 209 |
| 441 | 3300050514 | nmdc:mga08x19_18755_c1 | nmdc:mga08x19_18755_c1_2480_3109 | 209 |
| 442 | 3300050515 | nmdc:mga0a205_1388_c1 | nmdc:mga0a205_1388_c1_17351_17980 | 209 |
| 443 | 3300053077 | Ga0495601_0009858 | Ga0495601_0009858_2087_2716 | 209 |
| 444 | 3300054114 | Ga0501084_0031840 | Ga0501084_0031840_2684_3313 | 209 |
| 445 | 3300054114 | Ga0501084_0064215 | Ga0501084_0064215_1226_1855 | 209 |
| 446 | 3300054114 | Ga0501084_0105588 | Ga0501084_0105588_1020_1649 | 209 |
| 447 | 3300054114 | Ga0501084_0988669 | Ga0501084_0988669_31_660 | 209 |
| 448 | 3300059421 | Ga0590071_062098 | Ga0590071_062098_49_678 | 209 |
| 449 | 3300060353 | Ga0501082_0215835 | Ga0501082_0215835_188_817 | 209 |
| 450 | 3300060353 | Ga0501082_0270301 | Ga0501082_0270301_43_672 | 209 |
| 451 | 3300060353 | Ga0501082_0343780 | Ga0501082_0343780_650_1279 | 209 |
| 452 | 3300061734 | Ga0530510_0000803 | Ga0530510_0000803_10125_10754 | 209 |
| 453 | 3300061734 | Ga0530510_0003054 | Ga0530510_0003054_787_1416 | 209 |
| 454 | 3300005328 | Ga0070676_10022726 | Ga0070676_100227262 | 210 |
| 455 | 3300005330 | Ga0070690_100034888 | Ga0070690_1000348881 | 210 |
| 456 | 3300005331 | Ga0070670_100022786 | Ga0070670_1000227862 | 210 |
| 457 | 3300005333 | Ga0070677_10042471 | Ga0070677_100424712 | 210 |
| 458 | 3300005334 | Ga0068869_100552509 | Ga0068869_1005525091 | 210 |
| 459 | 3300005335 | Ga0070666_10004229 | Ga0070666_100042297 | 210 |
| 460 | 3300005336 | Ga0070680_100259184 | Ga0070680_1002591842 | 210 |
| 461 | 3300005338 | Ga0068868_100044416 | Ga0068868_1000444162 | 210 |
| 462 | 3300005344 | Ga0070661_100074138 | Ga0070661_1000741382 | 210 |
| 463 | 3300005347 | Ga0070668_100079471 | Ga0070668_1000794712 | 210 |
| 464 | 3300005353 | Ga0070669_100087566 | Ga0070669_1000875662 | 210 |
| 465 | 3300005354 | Ga0070675_100031415 | Ga0070675_1000314152 | 210 |
| 466 | 3300005355 | Ga0070671_100012951 | Ga0070671_1000129514 | 210 |
| 467 | 3300005356 | Ga0070674_100000282 | Ga0070674_10000028220 | 210 |
| 468 | 3300005364 | Ga0070673_100000027 | Ga0070673_10000002729 | 210 |
| 469 | 3300005366 | Ga0070659_100033076 | Ga0070659_1000330762 | 210 |
| 470 | 3300005367 | Ga0070667_100053508 | Ga0070667_1000535081 | 210 |
| 471 | 3300005455 | Ga0070663_100168805 | Ga0070663_1001688051 | 210 |
| 472 | 3300005456 | Ga0070678_100003474 | Ga0070678_1000034743 | 210 |
| 473 | 3300005456 | Ga0070678_100825830 | Ga0070678_1008258301 | 210 |
| 474 | 3300005457 | Ga0070662_100069089 | Ga0070662_1000690893 | 210 |
| 475 | 3300005543 | Ga0070672_100000655 | Ga0070672_10000065511 | 210 |
| 476 | 3300005548 | Ga0070665_100029569 | Ga0070665_1000295695 | 210 |
| 477 | 3300005549 | Ga0070704_100057954 | Ga0070704_1000579543 | 210 |
| 478 | 3300005549 | Ga0070704_100112577 | Ga0070704_1001125772 | 210 |
| 479 | 3300005549 | Ga0070704_100619072 | Ga0070704_1006190721 | 210 |
| 480 | 3300005564 | Ga0070664_100040877 | Ga0070664_1000408772 | 210 |
| 481 | 3300005616 | Ga0068852_100347120 | Ga0068852_1003471202 | 210 |
| 482 | 3300006028 | Ga0070717_10919836 | Ga0070717_109198361 | 210 |
| 483 | 3300006237 | Ga0097621_100181536 | Ga0097621_1001815362 | 210 |
| 484 | 3300006358 | Ga0068871_100018921 | Ga0068871_1000189214 | 210 |
| 485 | 3300006358 | Ga0068871_100547569 | Ga0068871_1005475692 | 210 |
| 486 | 3300006880 | Ga0075429_100047465 | Ga0075429_1000474652 | 210 |
| 487 | 3300009094 | Ga0111539_10008809 | Ga0111539_100088092 | 210 |
| 488 | 3300009094 | Ga0111539_10013111 | Ga0111539_100131113 | 210 |
| 489 | 3300009147 | Ga0114129_10077350 | Ga0114129_100773503 | 210 |
| 490 | 3300009148 | Ga0105243_10175536 | Ga0105243_101755362 | 210 |
| 491 | 3300012491 | Ga0157329_1008665 | Ga0157329_10086652 | 210 |
| 492 | 3300025315 | Ga0207697_10048717 | Ga0207697_100487172 | 210 |
| 493 | 3300025893 | Ga0207682_10085437 | Ga0207682_100854372 | 210 |
| 494 | 3300025903 | Ga0207680_10117382 | Ga0207680_101173822 | 210 |
| 495 | 3300025907 | Ga0207645_10017450 | Ga0207645_100174502 | 210 |
| 496 | 3300025917 | Ga0207660_10251222 | Ga0207660_102512221 | 210 |
| 497 | 3300025920 | Ga0207649_10070531 | Ga0207649_100705312 | 210 |
| 498 | 3300025923 | Ga0207681_10134109 | Ga0207681_101341092 | 210 |
| 499 | 3300025925 | Ga0207650_10008640 | Ga0207650_100086402 | 210 |
| 500 | 3300025926 | Ga0207659_10196133 | Ga0207659_101961332 | 210 |
| 501 | 3300025932 | Ga0207690_10174189 | Ga0207690_101741891 | 210 |
| 502 | 3300025933 | Ga0207706_10233043 | Ga0207706_102330432 | 210 |
| 503 | 3300025937 | Ga0207669_10012036 | Ga0207669_100120362 | 210 |
| 504 | 3300025940 | Ga0207691_10000759 | Ga0207691_100007593 | 210 |
| 505 | 3300025960 | Ga0207651_10000073 | Ga0207651_100000731 | 210 |
| 506 | 3300025972 | Ga0207668_10440326 | Ga0207668_104403262 | 210 |
| 507 | 3300025986 | Ga0207658_10017462 | Ga0207658_100174623 | 210 |
| 508 | 3300026067 | Ga0207678_10208210 | Ga0207678_102082102 | 210 |
| 509 | 3300026089 | Ga0207648_10024014 | Ga0207648_100240141 | 210 |
| 510 | 3300026118 | Ga0207675_100456804 | Ga0207675_1004568042 | 210 |
| 511 | 3300026121 | Ga0207683_10000596 | Ga0207683_1000059616 | 210 |
| 512 | 3300026142 | Ga0207698_10204282 | Ga0207698_102042822 | 210 |
| 513 | 3300026142 | Ga0207698_10776746 | Ga0207698_107767462 | 210 |
| 514 | 3300027907 | Ga0207428_10014118 | Ga0207428_100141186 | 210 |
| 515 | 3300028379 | Ga0268266_10162047 | Ga0268266_101620471 | 210 |
| 516 | 3300028563 | Ga0265319_1000048 | Ga0265319_100004862 | 210 |
| 517 | 3300028577 | Ga0265318_10001434 | Ga0265318_100014345 | 210 |
| 518 | 3300031235 | Ga0265330_10000212 | Ga0265330_1000021226 | 210 |
| 519 | 3300031238 | Ga0265332_10000598 | Ga0265332_1000059818 | 210 |
| 520 | 3300031239 | Ga0265328_10003938 | Ga0265328_100039384 | 210 |
| 521 | 3300031240 | Ga0265320_10030637 | Ga0265320_100306372 | 210 |
| 522 | 3300031241 | Ga0265325_10015634 | Ga0265325_100156344 | 210 |
| 523 | 3300031247 | Ga0265340_10008554 | Ga0265340_100085542 | 210 |
| 524 | 3300031249 | Ga0265339_10004976 | Ga0265339_100049762 | 210 |
| 525 | 3300031250 | Ga0265331_10001346 | Ga0265331_100013463 | 210 |
| 526 | 3300031344 | Ga0265316_10000330 | Ga0265316_1000033018 | 210 |
| 527 | 3300031595 | Ga0265313_10000573 | Ga0265313_100005732 | 210 |
| 528 | 3300031665 | Ga0316575_10016338 | Ga0316575_100163383 | 210 |
| 529 | 3300031665 | Ga0316575_10030340 | Ga0316575_100303402 | 210 |
| 530 | 3300031665 | Ga0316575_10061954 | Ga0316575_100619542 | 210 |
| 531 | 3300031691 | Ga0316579_10001192 | Ga0316579_100011924 | 210 |
| 532 | 3300031691 | Ga0316579_10002152 | Ga0316579_100021522 | 210 |
| 533 | 3300031691 | Ga0316579_10024820 | Ga0316579_100248201 | 210 |
| 534 | 3300031691 | Ga0316579_10059253 | Ga0316579_100592532 | 210 |
| 535 | 3300031711 | Ga0265314_10000159 | Ga0265314_1000015955 | 210 |
| 536 | 3300031712 | Ga0265342_10002265 | Ga0265342_1000226516 | 210 |
| 537 | 3300031727 | Ga0316576_10000791 | Ga0316576_1000079110 | 210 |
| 538 | 3300031727 | Ga0316576_10007685 | Ga0316576_100076851 | 210 |
| 539 | 3300031727 | Ga0316576_10012284 | Ga0316576_100122845 | 210 |
| 540 | 3300031727 | Ga0316576_10021593 | Ga0316576_100215932 | 210 |
| 541 | 3300031727 | Ga0316576_10054697 | Ga0316576_100546972 | 210 |
| 542 | 3300031727 | Ga0316576_10068242 | Ga0316576_100682422 | 210 |
| 543 | 3300031727 | Ga0316576_10085697 | Ga0316576_100856972 | 210 |
| 544 | 3300031728 | Ga0316578_10001317 | Ga0316578_100013179 | 210 |
| 545 | 3300031728 | Ga0316578_10003814 | Ga0316578_100038142 | 210 |
| 546 | 3300031728 | Ga0316578_10021545 | Ga0316578_100215451 | 210 |
| 547 | 3300031728 | Ga0316578_10090709 | Ga0316578_100907092 | 210 |
| 548 | 3300031733 | Ga0316577_10004035 | Ga0316577_100040357 | 210 |
| 549 | 3300031733 | Ga0316577_10006976 | Ga0316577_100069762 | 210 |
| 550 | 3300031733 | Ga0316577_10049143 | Ga0316577_100491432 | 210 |
| 551 | 3300031733 | Ga0316577_10062444 | Ga0316577_100624442 | 210 |
| 552 | 3300031733 | Ga0316577_10206292 | Ga0316577_102062921 | 210 |
| 553 | 3300031903 | Ga0307407_10130411 | Ga0307407_101304112 | 210 |
| 554 | 3300032133 | Ga0316583_10000414 | Ga0316583_100004146 | 210 |
| 555 | 3300032133 | Ga0316583_10007526 | Ga0316583_100075262 | 210 |
| 556 | 3300032133 | Ga0316583_10049303 | Ga0316583_100493032 | 210 |
| 557 | 3300032133 | Ga0316583_10055019 | Ga0316583_100550191 | 210 |
| 558 | 3300032137 | Ga0316585_10001691 | Ga0316585_100016912 | 210 |
| 559 | 3300032137 | Ga0316585_10003135 | Ga0316585_100031353 | 210 |
| 560 | 3300032137 | Ga0316585_10021417 | Ga0316585_100214172 | 210 |
| 561 | 3300032139 | Ga0316580_10000480 | Ga0316580_100004802 | 210 |
| 562 | 3300032139 | Ga0316580_10020135 | Ga0316580_100201352 | 210 |
| 563 | 3300032139 | Ga0316580_10023377 | Ga0316580_100233772 | 210 |
| 564 | 3300032139 | Ga0316580_10023444 | Ga0316580_100234442 | 210 |
| 565 | 3300032139 | Ga0316580_10029729 | Ga0316580_100297291 | 210 |
| 566 | 3300032168 | Ga0316593_10001966 | Ga0316593_100019663 | 210 |
| 567 | 3300033524 | Ga0316592_1010923 | Ga0316592_10109232 | 210 |
| 568 | 3300033541 | Ga0316596_1049048 | Ga0316596_10490481 | 210 |
| 569 | 3300035398 | Ga0316574_0040587 | Ga0316574_0040587_1141_1779 | 210 |
| 570 | 3300035398 | Ga0316574_0128857 | Ga0316574_0128857_786_1424 | 210 |
| 571 | 3300035398 | Ga0316574_0205754 | Ga0316574_0205754_79_717 | 210 |
| 572 | 3300035398 | Ga0316574_0245780 | Ga0316574_0245780_21_659 | 210 |
| 573 | 3300036647 | Ga0316582_0000895 | Ga0316582_0000895_5639_6277 | 210 |
| 574 | 3300036647 | Ga0316582_0001725 | Ga0316582_0001725_5479_6117 | 210 |
| 575 | 3300036647 | Ga0316582_0031205 | Ga0316582_0031205_2406_3044 | 210 |
| 576 | 3300036647 | Ga0316582_0080297 | Ga0316582_0080297_36_674 | 210 |
| 577 | 3300036647 | Ga0316582_0124810 | Ga0316582_0124810_377_1015 | 210 |
| 578 | 3300036647 | Ga0316582_0310280 | Ga0316582_0310280_345_983 | 210 |
| 579 | 3300036647 | Ga0316582_0566369 | Ga0316582_0566369_63_701 | 210 |
| 580 | 3300036712 | Ga0316584_0015186 | Ga0316584_0015186_2329_2967 | 210 |
| 581 | 3300036712 | Ga0316584_0019256 | Ga0316584_0019256_1200_1838 | 210 |
| 582 | 3300036712 | Ga0316584_0044087 | Ga0316584_0044087_593_1231 | 210 |
| 583 | 3300036712 | Ga0316584_0072735 | Ga0316584_0072735_1796_2434 | 210 |
| 584 | 3300036712 | Ga0316584_0101218 | Ga0316584_0101218_1079_1717 | 210 |
| 585 | 3300036712 | Ga0316584_0217255 | Ga0316584_0217255_693_1331 | 210 |
| 586 | 3300036712 | Ga0316584_0270471 | Ga0316584_0270471_369_1001 | 210 |
| 587 | 3300036712 | Ga0316584_0278246 | Ga0316584_0278246_51_689 | 210 |
| 588 | 3300036712 | Ga0316584_0360637 | Ga0316584_0360637_304_942 | 210 |
| 589 | 3300038727 | Ga0400491_09172 | Ga0400491_09172_720_1358 | 210 |
| 590 | 3300038735 | Ga0400485_04042 | Ga0400485_04042_398_1036 | 210 |
| 591 | 3300038742 | Ga0400486_04029 | Ga0400486_04029_398_1036 | 210 |
| 592 | 3300039093 | Ga0400489_19166 | Ga0400489_19166_8900_9538 | 210 |
| 593 | 3300039110 | Ga0400487_56445 | Ga0400487_56445_10611_11249 | 210 |
| 594 | 3300042876 | Ga0451577_0905730 | Ga0451577_0905730_91_723 | 210 |
| 595 | 3300044712 | Ga0453684_0394056 | Ga0453684_0394056_140_772 | 210 |
| 596 | 3300046516 | Ga0495628_0000665 | Ga0495628_0000665_8885_9517 | 210 |
| 597 | 3300047315 | Ga0495581_0215584 | Ga0495581_0215584_233_865 | 210 |
| 598 | 3300050507 | nmdc:mga05p37_258357_c1 | nmdc:mga05p37_258357_c1_1210_1842 | 210 |
| 599 | 3300050508 | nmdc:mga09592_117342_c1 | nmdc:mga09592_117342_c1_337_969 | 210 |
| 600 | 3300050508 | nmdc:mga09592_877384_c1 | nmdc:mga09592_877384_c1_36_668 | 210 |
| 601 | 3300050511 | nmdc:mga08y16_14255_c1 | nmdc:mga08y16_14255_c1_59_691 | 210 |
| 602 | 3300050511 | nmdc:mga08y16_15839_c1 | nmdc:mga08y16_15839_c1_2350_2982 | 210 |
| 603 | 3300005293 | Ga0065715_10560032 | Ga0065715_105600321 | 211 |
| 604 | 3300005330 | Ga0070690_100080021 | Ga0070690_1000800212 | 211 |
| 605 | 3300005343 | Ga0070687_100141480 | Ga0070687_1001414802 | 211 |
| 606 | 3300005437 | Ga0070710_10101677 | Ga0070710_101016772 | 211 |
| 607 | 3300005718 | Ga0068866_10642434 | Ga0068866_106424341 | 211 |
| 608 | 3300005843 | Ga0068860_100176973 | Ga0068860_1001769732 | 211 |
| 609 | 3300006844 | Ga0075428_100322043 | Ga0075428_1003220432 | 211 |
| 610 | 3300009094 | Ga0111539_10008078 | Ga0111539_100080789 | 211 |
| 611 | 3300009094 | Ga0111539_10142557 | Ga0111539_101425572 | 211 |
| 612 | 3300013102 | Ga0157371_10017208 | Ga0157371_100172083 | 211 |
| 613 | 3300013296 | Ga0157374_10057328 | Ga0157374_100573283 | 211 |
| 614 | 3300013297 | Ga0157378_10000235 | Ga0157378_1000023513 | 211 |
| 615 | 3300013306 | Ga0163162_10527884 | Ga0163162_105278842 | 211 |
| 616 | 3300013308 | Ga0157375_10256775 | Ga0157375_102567752 | 211 |
| 617 | 3300014326 | Ga0157380_10146740 | Ga0157380_101467402 | 211 |
| 618 | 3300014968 | Ga0157379_10004082 | Ga0157379_1000408210 | 211 |
| 619 | 3300014969 | Ga0157376_10001991 | Ga0157376_100019915 | 211 |
| 620 | 3300025898 | Ga0207692_10072042 | Ga0207692_100720422 | 211 |
| 621 | 3300025939 | Ga0207665_10162150 | Ga0207665_101621502 | 211 |
| 622 | 3300031456 | Ga0307513_10427459 | Ga0307513_104274591 | 211 |
| 623 | 3300031507 | Ga0307509_10012348 | Ga0307509_1001234810 | 211 |
| 624 | 3300031507 | Ga0307509_10038670 | Ga0307509_100386702 | 211 |
| 625 | 3300031507 | Ga0307509_10121638 | Ga0307509_101216382 | 211 |
| 626 | 3300031616 | Ga0307508_10000041 | Ga0307508_10000041101 | 211 |
| 627 | 3300031616 | Ga0307508_10135153 | Ga0307508_101351532 | 211 |
| 628 | 3300033179 | Ga0307507_10066250 | Ga0307507_100662502 | 211 |
| 629 | 3300035086 | Ga0373934_0014776 | Ga0373934_0014776_1573_2208 | 211 |
| 630 | 3300035117 | Ga0373953_0081136 | Ga0373953_0081136_676_1311 | 211 |
| 631 | 3300035119 | Ga0373956_0034205 | Ga0373956_0034205_123_758 | 211 |
| 632 | 3300035410 | Ga0373924_0002317 | Ga0373924_0002317_660_1295 | 211 |
| 633 | 3300035691 | Ga0373931_0049956 | Ga0373931_0049956_1280_1915 | 211 |
| 634 | 3300036401 | Ga0373937_0022637 | Ga0373937_0022637_2299_2934 | 211 |
| 635 | 3300036647 | Ga0316582_0005625 | Ga0316582_0005625_302_961 | 211 |
| 636 | 3300036712 | Ga0316584_0007262 | Ga0316584_0007262_5394_6053 | 211 |
| 637 | 3300037068 | Ga0373925_0070593 | Ga0373925_0070593_1005_1640 | 211 |
| 638 | 3300039093 | Ga0400489_83885 | Ga0400489_83885_8453_9148 | 211 |
| 639 | 3300039437 | Ga0436365_0486298 | Ga0436365_0486298_2021_2806 | 211 |
| 640 | 3300041486 | Ga0451807_0370026 | Ga0451807_0370026_582_1217 | 211 |
| 641 | 3300046477 | Ga0495664_0133674 | Ga0495664_0133674_561_1196 | 211 |
| 642 | 3300046526 | Ga0495666_0078290 | Ga0495666_0078290_858_1493 | 211 |
| 643 | 3300046559 | Ga0495667_0341931 | Ga0495667_0341931_14_649 | 211 |
| 644 | 3300046648 | Ga0495611_0128742 | Ga0495611_0128742_310_945 | 211 |
| 645 | 3300046675 | Ga0495657_0112898 | Ga0495657_0112898_750_1385 | 211 |
| 646 | 3300046809 | Ga0495600_0085276 | Ga0495600_0085276_739_1374 | 211 |
| 647 | 3300047319 | Ga0495674_0841876 | Ga0495674_0841876_20_655 | 211 |
| 648 | 3300048091 | Ga0495626_0071561 | Ga0495626_0071561_704_1339 | 211 |
| 649 | 3300048903 | Ga0496100_0088854 | Ga0496100_0088854_142_792 | 211 |
| 650 | 3300048908 | Ga0496105_0171524 | Ga0496105_0171524_222_872 | 211 |
| 651 | 3300048911 | Ga0496108_0010030 | Ga0496108_0010030_3181_3831 | 211 |
| 652 | 3300048912 | Ga0496109_0047620 | Ga0496109_0047620_3114_3764 | 211 |
| 653 | 3300048913 | Ga0496110_0438354 | Ga0496110_0438354_336_986 | 211 |
| 654 | 3300048914 | Ga0496111_0742683 | Ga0496111_0742683_33_683 | 211 |
| 655 | 3300048915 | Ga0496112_0435113 | Ga0496112_0435113_52_702 | 211 |
| 656 | 3300048917 | Ga0496114_0047310 | Ga0496114_0047310_273_923 | 211 |
| 657 | 3300050493 | nmdc:mga0k408_206347_c1 | nmdc:mga0k408_206347_c1_300_953 | 211 |
| 658 | 3300050511 | nmdc:mga08y16_430243_c1 | nmdc:mga08y16_430243_c1_523_1176 | 211 |
| 659 | 3300050511 | nmdc:mga08y16_7728_c1 | nmdc:mga08y16_7728_c1_9543_10193 | 211 |
| 660 | 3300050511 | nmdc:mga08y16_81071_c1 | nmdc:mga08y16_81071_c1_2417_3073 | 211 |
| 661 | 3300053077 | Ga0495601_0124911 | Ga0495601_0124911_85_720 | 211 |
| 662 | 3300053092 | Ga0500583_0271088 | Ga0500583_0271088_156_791 | 211 |
| 663 | 3300053118 | Ga0500594_0061966 | Ga0500594_0061966_113_766 | 211 |
| 664 | 3300003203 | JGI25406J46586_10043687 | JGI25406J46586_100436872 | 212 |
| 665 | 3300005434 | Ga0070709_10277519 | Ga0070709_102775191 | 212 |
| 666 | 3300005518 | Ga0070699_100113399 | Ga0070699_1001133992 | 212 |
| 667 | 3300005536 | Ga0070697_100032296 | Ga0070697_1000322962 | 212 |
| 668 | 3300005546 | Ga0070696_100006269 | Ga0070696_1000062694 | 212 |
| 669 | 3300006852 | Ga0075433_10146331 | Ga0075433_101463312 | 212 |
| 670 | 3300006852 | Ga0075433_10376498 | Ga0075433_103764982 | 212 |
| 671 | 3300006871 | Ga0075434_100400539 | Ga0075434_1004005392 | 212 |
| 672 | 3300006914 | Ga0075436_100020187 | Ga0075436_1000201872 | 212 |
| 673 | 3300007076 | Ga0075435_100481979 | Ga0075435_1004819791 | 212 |
| 674 | 3300007076 | Ga0075435_100648213 | Ga0075435_1006482131 | 212 |
| 675 | 3300025928 | Ga0207700_10492873 | Ga0207700_104928732 | 212 |
| 676 | 3300035088 | Ga0373940_0076769 | Ga0373940_0076769_182_820 | 212 |
| 677 | 3300035691 | Ga0373931_0029995 | Ga0373931_0029995_1705_2343 | 212 |
| 678 | 3300035695 | Ga0373927_0207439 | Ga0373927_0207439_482_1120 | 212 |
| 679 | 3300045051 | Ga0451576_0145578 | Ga0451576_0145578_618_1256 | 212 |
| 680 | 3300046539 | Ga0495621_0128236 | Ga0495621_0128236_169_807 | 212 |
| 681 | 3300046684 | Ga0495669_0018505 | Ga0495669_0018505_1000_1638 | 212 |
| 682 | 3300050507 | nmdc:mga05p37_498195_c1 | nmdc:mga05p37_498195_c1_134_772 | 212 |
| 683 | 3300050512 | nmdc:mga0n895_2433_c1 | nmdc:mga0n895_2433_c1_9440_10078 | 212 |
| 684 | 3300050513 | nmdc:mga0rr50_210556_c1 | nmdc:mga0rr50_210556_c1_261_899 | 212 |
| 685 | 3300050513 | nmdc:mga0rr50_25242_c1 | nmdc:mga0rr50_25242_c1_606_1244 | 212 |
| 686 | 3300050514 | nmdc:mga08x19_1548_c1 | nmdc:mga08x19_1548_c1_10424_11062 | 212 |
| 687 | 3300050514 | nmdc:mga08x19_203710_c1 | nmdc:mga08x19_203710_c1_703_1341 | 212 |
| 688 | 3300050514 | nmdc:mga08x19_38836_c1 | nmdc:mga08x19_38836_c1_758_1396 | 212 |
| 689 | 3300050514 | nmdc:mga08x19_4750_c1 | nmdc:mga08x19_4750_c1_3364_4002 | 212 |
| 690 | 3300050515 | nmdc:mga0a205_188178_c1 | nmdc:mga0a205_188178_c1_687_1325 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a5s-assembly1.cif.gz_AAA | crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. | 0.971 | 147 | 206 |
| 4wul-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9646 | 148 | 211 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9607 | 147 | 211 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.9581 | 147 | 212 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9578 | 147 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3p7nA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9681 | 147 | 206 | 1.10.10.10 |
| af_P52106_149_214_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9644 | 151 | 207 | 1.10.10.10 |
| 1zn2A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9499 | 151 | 207 | 1.10.10.10 |
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9486 | 151 | 207 | 1.10.10.10 |
| 4if4C02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9482 | 145 | 212 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0EEL3-F1-model_v4 | DNA-binding response regulator | 0.9846 | 4 | 140 |
GO:0000160
GO:0003677 |
| AF-A0A7Z2G7W5-F1-model_v4 | Response regulator | 0.9803 | 4 | 212 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A3D3PPS9-F1-model_v4 | DNA-binding response regulator | 0.9768 | 3 | 136 |
GO:0000160
GO:0003677 |
| AF-A0A7J6Z2T9-F1-model_v4 | deleted | 0.9732 | 4 | 212 |
|
| AF-A0A258NGY1-F1-model_v4 | DNA-binding response regulator | 0.9727 | 4 | 212 |
GO:0000160
GO:0003677 GO:0006355 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar