F475435

General Info

Members Datasets Scaffolds Average Seq Length
690 303 1378 769

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10054109|Ga0081455_100541093
Length 870
Sequence MSRTNPSATTSHSQPSTPPIADHMRTYASVVHGRKMIPSTGQIQELKAASQRPGLAIHQITAAILGPMNPAVSARQHITRNYDNVGNDCSTGNPLLRRAEMAAKKEPKGSQDGKVAATPELVEYEPGTAFPGVIGRTFDVSTPAWPEPLRAQEEAPNVLFIVIDDTGFGHLGCYGSPISTPNIDRLAEGGLRYANMHTTALCSPTRSCILTGRNHHSNHMAGITEISTGFPGYDGYIPFENGFLSEVLRAEGYNTYAVGKWHLTPSDQLTAAGPYDRWPLGRGFDRFYGFMGGDTHPEEGYHLTEDLTDRAIAFIADAKQVAPNKPFFLYFATGAQHAPHHVPKEWADKYKGAFADGWDAYRERVFAKQKRLGLVPRSAELSRHDPDVQNWKRLSAKERKLYARMMEVFAGFLEHTDHHIGRLLDFLKEIGEFDNTLIMLISDNGASAEGGPSGSVNENKFFNFVPDSLEQNLAAIDDIGGPKYFNHYPWGWTFAGNTPFRRWKRETYRGGISDPFIVHWKKGIKAKGEVRAQFAHAIDMVPTVLEALGVEAPTSIRGVTQTPIEGVSFAHTFDDAKAPTKHVTQYFEMMGHRSIYHDGWRAVCPWPGTSFTESGRQFGTPIPAKTLTELDATGWELYHVAKDPAENDNLAEKERPRLIEMIAQWYVEAGKYNVLPVDGRGQQRFAELRPQIAVDRTRYAYYPGTQEVPQNAAPRILNRPHTVTAVVEIPKGGAEGVLVSQGGVDGGFTFFVQDGKLRYTYNYVADQRFQVVSDKDVPAGRHALSFEFTPTGKAQPLKGKGTPGSVSLFVDGKPAGEGNLAVTIPISMPVTDEYEPPFDFTGTIEKVVYDVSGERIVDHEAEIRMALARQ

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
142 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
143 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
175 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
294 2506783011 Frankia datiscae Dg1 Isolate Nodule
295 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
296 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
297 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
298 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
299 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
300 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
301 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
302 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
303 2941471342 Luteibacter sp. 621 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 1.16
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0.14
Rhizoplane 5.51
Rhizosphere 90.43
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10054109 3300005937 Bacteria 3423
2 rootH2_10025454 3300003320 Bacteria 6845
3 rootH2_10046278 3300003320 Bacteria 19869
4 Ga0058859_11775670 3300004798 Bacteria 2602
5 Ga0058863_10064911 3300004799 Bacteria 2600
6 Ga0058861_10058546 3300004800 Bacteria 2712
7 Ga0070683_100000398 3300005329 Bacteria 30072
8 Ga0070683_100003404 3300005329 Bacteria 12898
9 Ga0070683_100019126 3300005329 Bacteria 6079
10 Ga0070690_100002286 3300005330 Bacteria 10276
11 Ga0070670_100025737 3300005331 Bacteria 5063
12 Ga0068869_100021281 3300005334 Bacteria 4460
13 Ga0070682_100003587 3300005337 Bacteria 8592
14 Ga0068868_100013366 3300005338 Bacteria 6020
15 Ga0068868_100017457 3300005338 Bacteria 5348
16 Ga0070660_100029140 3300005339 Bacteria 4134
17 Ga0070689_100005448 3300005340 Bacteria 8691
18 Ga0070689_100041376 3300005340 Bacteria 3537
19 Ga0070691_10003152 3300005341 Bacteria 7383
20 Ga0070691_10007041 3300005341 Bacteria 5155
21 Ga0070668_100000255 3300005347 Bacteria 35284
22 Ga0070668_100050706 3300005347 Bacteria 3196
23 Ga0070675_100000097 3300005354 Bacteria 50764
24 Ga0070675_100000719 3300005354 Bacteria 23032
25 Ga0070671_100010861 3300005355 Bacteria 7309
26 Ga0070674_100013233 3300005356 Bacteria 5094
27 Ga0070673_100029171 3300005364 Bacteria 4112
28 Ga0070659_100082777 3300005366 Bacteria 2564
29 Ga0070709_10010770 3300005434 Bacteria 5074
30 Ga0070714_100022286 3300005435 Bacteria 5193
31 Ga0070713_100017062 3300005436 Bacteria 5478
32 Ga0070700_100033940 3300005441 Bacteria 3077
33 Ga0070694_100029291 3300005444 Bacteria 3592
34 Ga0070662_100039741 3300005457 Bacteria 3347
35 Ga0070681_10033372 3300005458 Bacteria 5168
36 Ga0070681_10036963 3300005458 Bacteria 4900
37 Ga0070706_100001143 3300005467 Bacteria 28603
38 Ga0070707_100044010 3300005468 Bacteria 4273
39 Ga0070698_100017650 3300005471 Bacteria 7518
40 Ga0070698_100050583 3300005471 Bacteria 4235
41 Ga0070699_100008113 3300005518 Bacteria 9119
42 Ga0070684_100000462 3300005535 Bacteria 27772
43 Ga0070684_100000509 3300005535 Bacteria 26687
44 Ga0070684_100004354 3300005535 Bacteria 10760
45 Ga0070697_100006229 3300005536 Bacteria 9238
46 Ga0068853_100085658 3300005539 Bacteria 2762
47 Ga0070686_100029498 3300005544 Bacteria 3338
48 Ga0070665_100000441 3300005548 Bacteria 60634
49 Ga0070704_100007965 3300005549 Bacteria 6327
50 Ga0070664_100007124 3300005564 Bacteria 9021
51 Ga0070664_100017718 3300005564 Bacteria 5851
52 Ga0070664_100033555 3300005564 Bacteria 4300
53 Ga0068857_100000264 3300005577 Bacteria 35486
54 Ga0068856_100002050 3300005614 Bacteria 20895
55 Ga0068856_100003948 3300005614 Bacteria 14850
56 Ga0070702_100009777 3300005615 Bacteria 4706
57 Ga0068852_100082309 3300005616 Bacteria 2860
58 Ga0068859_100000936 3300005617 Bacteria 29958
59 Ga0068859_100001959 3300005617 Bacteria 20995
60 Ga0068864_100009009 3300005618 Bacteria 8229
61 Ga0068861_100034146 3300005719 Bacteria 3760
62 Ga0068861_100048611 3300005719 Bacteria 3208
63 Ga0068858_100062699 3300005842 Bacteria 3438
64 Ga0068860_100004148 3300005843 Bacteria 14848
65 Ga0068862_100008662 3300005844 Bacteria 8413
66 Ga0068862_100041752 3300005844 Bacteria 3904
67 Ga0081455_10002341 3300005937 Bacteria 22617
68 Ga0081455_10004533 3300005937 Bacteria 15519
69 Ga0081455_10004821 3300005937 Bacteria 14988
70 Ga0081455_10005587 3300005937 Bacteria 13755
71 Ga0081455_10016987 3300005937 Bacteria 6995
72 Ga0081538_10002182 3300005981 Bacteria 19423
73 Ga0081538_10009182 3300005981 Bacteria 8288
74 Ga0081540_1019137 3300005983 Bacteria 4175
75 Ga0081540_1026317 3300005983 Bacteria 3323
76 Ga0081540_1029074 3300005983 Bacteria 3088
77 Ga0070717_10004543 3300006028 Bacteria 10036
78 Ga0070717_10014967 3300006028 Bacteria 5975
79 Ga0070717_10027456 3300006028 Bacteria 4549
80 Ga0097621_100006367 3300006237 Bacteria 8377
81 Ga0097621_100028661 3300006237 Bacteria 4389
82 Ga0068871_100000253 3300006358 Bacteria 37196
83 Ga0075428_100002855 3300006844 Bacteria 18850
84 Ga0075428_100009299 3300006844 Bacteria 10896
85 Ga0075428_100033212 3300006844 Bacteria 5698
86 Ga0075428_100035766 3300006844 Bacteria 5474
87 Ga0075428_100101398 3300006844 Bacteria 3138
88 Ga0075430_100015398 3300006846 Bacteria 6510
89 Ga0075430_100023004 3300006846 Bacteria 5301
90 Ga0075431_100004329 3300006847 Bacteria 13908
91 Ga0075431_100034745 3300006847 Bacteria 5193
92 Ga0075431_100039943 3300006847 Bacteria 4834
93 Ga0075431_100066089 3300006847 Bacteria 3733
94 Ga0075431_100110291 3300006847 Bacteria 2840
95 Ga0075431_100112534 3300006847 Bacteria 2809
96 Ga0075433_10000529 3300006852 Bacteria 25025
97 Ga0075429_100023778 3300006880 Bacteria 5317
98 Ga0075429_100078947 3300006880 Bacteria 2869
99 Ga0068865_100045773 3300006881 Bacteria 3000
100 Ga0075436_100000719 3300006914 Bacteria 21903
101 Ga0097620_100000936 3300006931 Bacteria 29958
102 Ga0097620_100001959 3300006931 Bacteria 20995
103 Ga0105240_10156405 3300009093 Bacteria 2710
104 Ga0111539_10006878 3300009094 Bacteria 14609
105 Ga0111539_10011499 3300009094 Bacteria 11106
106 Ga0111539_10032030 3300009094 Bacteria 6386
107 Ga0111539_10034408 3300009094 Bacteria 6143
108 Ga0111539_10065307 3300009094 Bacteria 4300
109 Ga0111539_10071355 3300009094 Bacteria 4098
110 Ga0105245_10006689 3300009098 Bacteria 10115
111 Ga0105245_10016567 3300009098 Bacteria 6431
112 Ga0114129_10013951 3300009147 Bacteria 11448
113 Ga0114129_10066600 3300009147 Bacteria 5024
114 Ga0105242_10049773 3300009176 Bacteria 3411
115 Ga0105248_10018994 3300009177 Bacteria 7600
116 Ga0105248_10107396 3300009177 Bacteria 3147
117 Ga0105248_10109179 3300009177 Bacteria 3119
118 Ga0105237_10078621 3300009545 Bacteria 3288
119 Ga0105238_10035493 3300009551 Bacteria 5069
120 Ga0105238_10100470 3300009551 Bacteria 2876
121 Ga0105249_10006028 3300009553 Bacteria 10505
122 Ga0105246_10040231 3300011119 Bacteria 3154
123 Ga0157369_10003210 3300013105 Bacteria 19502
124 Ga0157369_10005783 3300013105 Bacteria 14375
125 Ga0157369_10075723 3300013105 Bacteria 3607
126 Ga0157374_10000866 3300013296 Bacteria 26455
127 Ga0157374_10016268 3300013296 Bacteria 6536
128 Ga0157374_10083403 3300013296 Bacteria 3036
129 Ga0157374_10106643 3300013296 Bacteria 2692
130 Ga0157378_10000055 3300013297 Bacteria 97875
131 Ga0157378_10048885 3300013297 Bacteria 3762
132 Ga0163162_10019681 3300013306 Bacteria 6626
133 Ga0163162_10057398 3300013306 Bacteria 3921
134 Ga0163162_10065164 3300013306 Bacteria 3690
135 Ga0157372_10011593 3300013307 Bacteria 9381
136 Ga0157372_10033187 3300013307 Bacteria 5668
137 Ga0157372_10035179 3300013307 Bacteria 5512
138 Ga0157372_10069450 3300013307 Unclassified 3962
139 Ga0157375_10037090 3300013308 Bacteria 4668
140 Ga0163163_10046809 3300014325 Bacteria 4249
141 Ga0157380_10045455 3300014326 Bacteria 3446
142 Ga0157377_10012525 3300014745 Bacteria 4268
143 Ga0157376_10074488 3300014969 Bacteria 2894
144 Ga0182007_10001064 3300015262 Bacteria 14967
145 Ga0163161_10038535 3300017792 Bacteria 3429
146 Ga0206352_10477980 3300020078 Bacteria 2841
147 Ga0206350_11417348 3300020080 Bacteria 3175
148 Ga0213875_10000598 3300021388 Bacteria 29178
149 Ga0224712_10005520 3300022467 Bacteria 3530
150 Ga0207653_10008147 3300025885 Bacteria 3266
151 Ga0207653_10013701 3300025885 Bacteria 2540
152 Ga0207692_10012148 3300025898 Bacteria 3690
153 Ga0207688_10009600 3300025901 Bacteria 5268
154 Ga0207647_10033172 3300025904 Bacteria 3308
155 Ga0207685_10008450 3300025905 Bacteria 2933
156 Ga0207645_10049761 3300025907 Bacteria 2676
157 Ga0207643_10019878 3300025908 Bacteria 3682
158 Ga0207684_10001711 3300025910 Bacteria 23277
159 Ga0207684_10043264 3300025910 Bacteria 3818
160 Ga0207707_10031257 3300025912 Bacteria 4658
161 Ga0207693_10000838 3300025915 Bacteria 27394
162 Ga0207660_10060808 3300025917 Bacteria 2717
163 Ga0207662_10026561 3300025918 Bacteria 3339
164 Ga0207662_10041057 3300025918 Bacteria 2722
165 Ga0207657_10018627 3300025919 Bacteria 6619
166 Ga0207657_10028499 3300025919 Bacteria 5093
167 Ga0207657_10074648 3300025919 Bacteria 2862
168 Ga0207652_10012617 3300025921 Bacteria 6830
169 Ga0207681_10045549 3300025923 Bacteria 2946
170 Ga0207659_10000352 3300025926 Bacteria 27474
171 Ga0207659_10046527 3300025926 Bacteria 3064
172 Ga0207687_10012059 3300025927 Bacteria 5652
173 Ga0207687_10034630 3300025927 Bacteria 3429
174 Ga0207700_10002166 3300025928 Bacteria 11253
175 Ga0207664_10013575 3300025929 Bacteria 5853
176 Ga0207706_10010700 3300025933 Bacteria 8379
177 Ga0207706_10013201 3300025933 Bacteria 7515
178 Ga0207706_10066421 3300025933 Bacteria 3174
179 Ga0207670_10001229 3300025936 Bacteria 13534
180 Ga0207665_10014205 3300025939 Bacteria 5239
181 Ga0207665_10048416 3300025939 Bacteria 2853
182 Ga0207691_10009484 3300025940 Bacteria 9347
183 Ga0207691_10061378 3300025940 Bacteria 3415
184 Ga0207711_10010318 3300025941 Bacteria 7759
185 Ga0207689_10024087 3300025942 Bacteria 5106
186 Ga0207689_10032849 3300025942 Bacteria 4313
187 Ga0207661_10020316 3300025944 Bacteria 4962
188 Ga0207661_10022053 3300025944 Bacteria 4787
189 Ga0207661_10037297 3300025944 Bacteria 3800
190 Ga0207679_10052834 3300025945 Bacteria 2982
191 Ga0207651_10000325 3300025960 Bacteria 20441
192 Ga0207712_10020307 3300025961 Bacteria 4349
193 Ga0207668_10000001 3300025972 Bacteria 266091
194 Ga0207703_10014304 3300026035 Bacteria 6189
195 Ga0207678_10018522 3300026067 Bacteria 6115
196 Ga0207678_10023261 3300026067 Bacteria 5420
197 Ga0207678_10061836 3300026067 Bacteria 3221
198 Ga0207708_10003737 3300026075 Bacteria 11229
199 Ga0207708_10009667 3300026075 Bacteria 7153
200 Ga0207702_10003801 3300026078 Bacteria 13632
201 Ga0207648_10003424 3300026089 Bacteria 16646
202 Ga0207648_10060319 3300026089 Bacteria 3308
203 Ga0207674_10000157 3300026116 Bacteria 80435
204 Ga0207674_10016529 3300026116 Bacteria 8074
205 Ga0207674_10027413 3300026116 Bacteria 6026
206 Ga0207675_100011087 3300026118 Bacteria 8446
207 Ga0207675_100070677 3300026118 Bacteria 3263
208 Ga0207675_100079562 3300026118 Bacteria 3072
209 Ga0207683_10000753 3300026121 Bacteria 29409
210 Ga0207698_10062967 3300026142 Bacteria 2900
211 Ga0207428_10004642 3300027907 Bacteria 13014
212 Ga0207428_10009384 3300027907 Bacteria 8776
213 Ga0207428_10035774 3300027907 Bacteria 4056
214 Ga0207428_10079800 3300027907 Bacteria 2558
215 Ga0268266_10001052 3300028379 Bacteria 34573
216 Ga0268265_10010766 3300028380 Bacteria 6175
217 Ga0265338_10002317 3300028800 Bacteria 28850
218 Ga0265338_10007754 3300028800 Bacteria 13210
219 Ga0265338_10047133 3300028800 Bacteria 3940
220 Ga0307513_10046470 3300031456 Bacteria 4732
221 Ga0316579_10003226 3300031691 Bacteria 6316
222 Ga0316579_10009756 3300031691 Bacteria 4042
223 Ga0316579_10012373 3300031691 Bacteria 3650
224 Ga0316579_10022811 3300031691 Bacteria 2803
225 Ga0265314_10003612 3300031711 Bacteria 14878
226 Ga0265342_10011968 3300031712 Bacteria 5896
227 Ga0316576_10048165 3300031727 Bacteria 3090
228 Ga0316576_10055457 3300031727 Bacteria 2892
229 Ga0316576_10065030 3300031727 Bacteria 2679
230 Ga0316578_10006412 3300031728 Bacteria 5804
231 Ga0316578_10033722 3300031728 Bacteria 2935
232 Ga0316577_10001188 3300031733 Bacteria 12015
233 Ga0316577_10009085 3300031733 Bacteria 5339
234 Ga0316577_10014911 3300031733 Bacteria 4273
235 Ga0316577_10032057 3300031733 Bacteria 2935
236 Ga0307410_10009991 3300031852 Bacteria 5354
237 Ga0307409_100007136 3300031995 Bacteria 6655
238 Ga0307416_100005623 3300032002 Bacteria 7730
239 Ga0316583_10015244 3300032133 Bacteria 2766
240 Ga0316585_10010635 3300032137 Bacteria 2702
241 Ga0316586_1000091 3300033527 Bacteria 6569
242 Ga0316587_1000003 3300033529 Bacteria 13777
243 Ga0373950_0000069 3300034818 Bacteria 53065
244 Ga0373926_0001932 3300035083 Bacteria 6487
245 Ga0373934_0007050 3300035086 Bacteria 4169
246 Ga0373934_0012017 3300035086 Bacteria 3266
247 Ga0373934_0015108 3300035086 Bacteria 2926
248 Ga0373923_0001369 3300035111 Bacteria 6942
249 Ga0373923_0012973 3300035111 Bacteria 3095
250 Ga0373923_0013798 3300035111 Bacteria 3019
251 Ga0373936_0000361 3300035113 Bacteria 15445
252 Ga0373936_0000927 3300035113 Bacteria 10464
253 Ga0373936_0016176 3300035113 Bacteria 2868
254 Ga0373945_0000032 3300035116 Bacteria 28513
255 Ga0373945_0001212 3300035116 Bacteria 7851
256 Ga0373953_0001069 3300035117 Bacteria 7731
257 Ga0373954_0008457 3300035118 Bacteria 4517
258 Ga0373954_0015675 3300035118 Bacteria 3389
259 Ga0373954_0021951 3300035118 Bacteria 2893
260 Ga0373956_0002465 3300035119 Bacteria 7535
261 Ga0373956_0018837 3300035119 Bacteria 2925
262 Ga0373957_0001552 3300035120 Bacteria 6264
263 Ga0373943_0000103 3300035170 Bacteria 30919
264 Ga0373943_0002595 3300035170 Bacteria 8212
265 Ga0373946_0000917 3300035171 Bacteria 10136
266 Ga0373946_0001011 3300035171 Bacteria 9649
267 Ga0373946_0001093 3300035171 Bacteria 9369
268 Ga0373955_0005604 3300035172 Bacteria 5647
269 Ga0373955_0015207 3300035172 Bacteria 3761
270 Ga0316574_0000821 3300035398 Bacteria 13548
271 Ga0316574_0005112 3300035398 Bacteria 6972
272 Ga0373924_0004119 3300035410 Bacteria 5060
273 Ga0373924_0011638 3300035410 Bacteria 3271
274 Ga0373931_0009243 3300035691 Bacteria 4707
275 Ga0373931_0037981 3300035691 Bacteria 2517
276 Ga0373935_0000548 3300035692 Bacteria 19519
277 Ga0373935_0005770 3300035692 Bacteria 7319
278 Ga0373935_0012133 3300035692 Bacteria 5182
279 Ga0373935_0015192 3300035692 Bacteria 4650
280 Ga0373927_0003346 3300035695 Bacteria 11534
281 Ga0373927_0004738 3300035695 Bacteria 9475
282 Ga0373933_0008971 3300035724 Bacteria 5456
283 Ga0373933_0031914 3300035724 Bacteria 3059
284 Ga0373947_0000465 3300035725 Bacteria 23103
285 Ga0373947_0002843 3300035725 Bacteria 10332
286 Ga0373947_0004804 3300035725 Bacteria 7910
287 Ga0373947_0019982 3300035725 Bacteria 3866
288 Ga0373937_0007831 3300036401 Bacteria 9258
289 Ga0373937_0014750 3300036401 Bacteria 6899
290 Ga0373937_0024695 3300036401 Bacteria 5423
291 Ga0373937_0042583 3300036401 Bacteria 4143
292 Ga0373937_0057446 3300036401 Bacteria 3574
293 Ga0373937_0098505 3300036401 Bacteria 2711
294 Ga0316582_0001078 3300036647 Bacteria 11499
295 Ga0316582_0005700 3300036647 Bacteria 6451
296 Ga0316582_0005902 3300036647 Bacteria 6369
297 Ga0316582_0030618 3300036647 Bacteria 3279
298 Ga0316582_0046118 3300036647 Bacteria 2747
299 Ga0316584_0001065 3300036712 Bacteria 16018
300 Ga0316584_0008491 3300036712 Bacteria 7077
301 Ga0316584_0020532 3300036712 Bacteria 4790
302 Ga0316584_0020894 3300036712 Bacteria 4754
303 Ga0316584_0024912 3300036712 Bacteria 4384
304 Ga0316584_0032060 3300036712 Bacteria 3887
305 Ga0316584_0041604 3300036712 Bacteria 3425
306 Ga0316584_0046462 3300036712 Bacteria 3243
307 Ga0316584_0056616 3300036712 Bacteria 2935
308 Ga0316584_0067539 3300036712 Bacteria 2679
309 Ga0373925_0000627 3300037068 Bacteria 33637
310 Ga0373925_0002391 3300037068 Bacteria 15049
311 Ga0373925_0005244 3300037068 Bacteria 9683
312 Ga0373925_0005649 3300037068 Bacteria 9306
313 Ga0373925_0028331 3300037068 Bacteria 4103
314 Ga0395900_0009710 3300037418 Bacteria 9860
315 Ga0395898_0025637 3300037466 Bacteria 5939
316 Ga0395898_0074662 3300037466 Bacteria 3275
317 Ga0436364_0170857 3300037853 Bacteria 27986
318 Ga0395901_0009967 3300038443 Bacteria 9630
319 Ga0436361_0354204 3300039447 Bacteria 9258
320 Ga0436361_1141966 3300039447 Bacteria 4389
321 Ga0450903_000162 3300042138 Bacteria 14681
322 Ga0439458_0001019 3300042157 Bacteria 7143
323 Ga0451577_0009950 3300042876 Bacteria 9115
324 Ga0453684_0029356 3300044712 Bacteria 7811
325 Ga0453684_0147886 3300044712 Bacteria 2796
326 Ga0495592_0005024 3300046454 Bacteria 9726
327 Ga0495592_0026998 3300046454 Bacteria 4353
328 Ga0495592_0055989 3300046454 Bacteria 2915
329 Ga0495603_0000941 3300046455 Bacteria 16746
330 Ga0495629_0004422 3300046459 Bacteria 10527
331 Ga0495629_0024620 3300046459 Bacteria 4285
332 Ga0495641_0003706 3300046461 Bacteria 11253
333 Ga0495651_0001645 3300046462 Bacteria 17321
334 Ga0495651_0001800 3300046462 Bacteria 16525
335 Ga0495651_0017304 3300046462 Bacteria 5584
336 Ga0495651_0023982 3300046462 Bacteria 4746
337 Ga0495651_0024096 3300046462 Bacteria 4735
338 Ga0495651_0025013 3300046462 Bacteria 4645
339 Ga0495651_0026403 3300046462 Bacteria 4523
340 Ga0495651_0062474 3300046462 Bacteria 2849
341 Ga0495651_0079391 3300046462 Bacteria 2480
342 Ga0495653_0005136 3300046463 Bacteria 10626
343 Ga0495653_0010357 3300046463 Bacteria 7627
344 Ga0495653_0014179 3300046463 Bacteria 6497
345 Ga0495653_0043294 3300046463 Bacteria 3501
346 Ga0495653_0052781 3300046463 Bacteria 3114
347 Ga0495653_0056959 3300046463 Bacteria 2978
348 Ga0495653_0060768 3300046463 Bacteria 2861
349 Ga0495580_0005623 3300046472 Bacteria 10319
350 Ga0495582_0001230 3300046473 Bacteria 14429
351 Ga0495605_0024457 3300046474 Bacteria 3160
352 Ga0495639_0001312 3300046475 Bacteria 11172
353 Ga0495662_0001043 3300046476 Bacteria 13603
354 Ga0495662_0003567 3300046476 Bacteria 7859
355 Ga0495662_0006219 3300046476 Bacteria 5970
356 Ga0495664_0000761 3300046477 Bacteria 16520
357 Ga0495664_0003660 3300046477 Bacteria 8375
358 Ga0495664_0007410 3300046477 Bacteria 6092
359 Ga0495664_0016782 3300046477 Bacteria 4178
360 Ga0495584_0026193 3300046491 Bacteria 2954
361 Ga0495608_0002010 3300046511 Bacteria 14566
362 Ga0495608_0018430 3300046511 Bacteria 4815
363 Ga0495608_0047302 3300046511 Bacteria 2860
364 Ga0495608_0049092 3300046511 Bacteria 2802
365 Ga0495610_0000629 3300046512 Bacteria 34679
366 Ga0495618_0007784 3300046514 Bacteria 6483
367 Ga0495618_0016583 3300046514 Bacteria 4509
368 Ga0495618_0027014 3300046514 Bacteria 3572
369 Ga0495628_0010793 3300046516 Bacteria 7736
370 Ga0495628_0013266 3300046516 Bacteria 6930
371 Ga0495628_0016463 3300046516 Bacteria 6168
372 Ga0495628_0022603 3300046516 Bacteria 5165
373 Ga0495628_0043484 3300046516 Bacteria 3578
374 Ga0495628_0053278 3300046516 Bacteria 3193
375 Ga0495628_0070497 3300046516 Bacteria 2725
376 Ga0495628_0089710 3300046516 Bacteria 2380
377 Ga0495630_0001346 3300046517 Bacteria 16892
378 Ga0495630_0004983 3300046517 Bacteria 9341
379 Ga0495630_0028680 3300046517 Bacteria 4135
380 Ga0495631_0000128 3300046518 Bacteria 51035
381 Ga0495666_0014542 3300046526 Bacteria 3919
382 Ga0495652_0004310 3300046529 Bacteria 13634
383 Ga0495652_0007220 3300046529 Bacteria 10257
384 Ga0495652_0007693 3300046529 Bacteria 9924
385 Ga0495652_0009522 3300046529 Bacteria 8823
386 Ga0495652_0024480 3300046529 Bacteria 5343
387 Ga0495652_0043361 3300046529 Bacteria 3875
388 Ga0495652_0056255 3300046529 Bacteria 3341
389 Ga0495652_0070680 3300046529 Bacteria 2916
390 Ga0495665_0003786 3300046531 Bacteria 8187
391 Ga0495640_0007342 3300046533 Bacteria 8673
392 Ga0495640_0014231 3300046533 Bacteria 6029
393 Ga0495640_0020145 3300046533 Bacteria 4913
394 Ga0495640_0065056 3300046533 Bacteria 2464
395 Ga0495586_0001077 3300046535 Bacteria 15418
396 Ga0495587_0005544 3300046536 Bacteria 8234
397 Ga0495587_0014673 3300046536 Bacteria 4908
398 Ga0495587_0017801 3300046536 Bacteria 4407
399 Ga0495587_0021370 3300046536 Bacteria 3990
400 Ga0495645_0002041 3300046543 Bacteria 13736
401 Ga0495645_0005227 3300046543 Bacteria 8891
402 Ga0495645_0014927 3300046543 Bacteria 5519
403 Ga0495645_0039741 3300046543 Bacteria 3430
404 Ga0495645_0056507 3300046543 Bacteria 2849
405 Ga0495645_0057783 3300046543 Bacteria 2815
406 Ga0495645_0061733 3300046543 Bacteria 2715
407 Ga0495645_0091453 3300046543 Bacteria 2173
408 Ga0495667_0003307 3300046559 Bacteria 10801
409 Ga0495667_0008323 3300046559 Bacteria 7033
410 Ga0495667_0011984 3300046559 Bacteria 5873
411 Ga0495667_0013524 3300046559 Bacteria 5521
412 Ga0495667_0021185 3300046559 Bacteria 4385
413 Ga0495667_0045309 3300046559 Bacteria 2912
414 Ga0495634_0016884 3300046642 Bacteria 5214
415 Ga0495634_0025925 3300046642 Bacteria 4095
416 Ga0495634_0050850 3300046642 Bacteria 2781
417 Ga0495625_0021732 3300046660 Bacteria 4932
418 Ga0495635_0001088 3300046663 Bacteria 18033
419 Ga0495635_0004406 3300046663 Bacteria 9750
420 Ga0495635_0004997 3300046663 Bacteria 9231
421 Ga0495635_0059305 3300046663 Bacteria 2631
422 Ga0495588_0004318 3300046674 Bacteria 6273
423 Ga0495657_0007137 3300046675 Bacteria 8668
424 Ga0495657_0011422 3300046675 Bacteria 6638
425 Ga0495657_0012426 3300046675 Bacteria 6328
426 Ga0495657_0014136 3300046675 Bacteria 5866
427 Ga0495657_0024848 3300046675 Bacteria 4260
428 Ga0495657_0051695 3300046675 Bacteria 2758
429 Ga0495599_0004643 3300046678 Bacteria 8142
430 Ga0495599_0005968 3300046678 Bacteria 7326
431 Ga0495599_0010765 3300046678 Bacteria 5604
432 Ga0495599_0031390 3300046678 Bacteria 3334
433 Ga0495599_0037849 3300046678 Bacteria 3030
434 Ga0495623_0002925 3300046679 Bacteria 11235
435 Ga0495623_0010659 3300046679 Bacteria 5950
436 Ga0495623_0038340 3300046679 Bacteria 3064
437 Ga0495646_0004883 3300046680 Bacteria 8474
438 Ga0495646_0027356 3300046680 Bacteria 3578
439 Ga0495646_0030454 3300046680 Bacteria 3370
440 Ga0495646_0036671 3300046680 Bacteria 3036
441 Ga0495658_0002221 3300046683 Bacteria 9815
442 Ga0495658_0049084 3300046683 Bacteria 2383
443 Ga0495669_0001066 3300046684 Bacteria 11426
444 Ga0495613_0000186 3300046689 Bacteria 60855
445 Ga0495613_0016139 3300046689 Bacteria 5561
446 Ga0495613_0016140 3300046689 Bacteria 5561
447 Ga0495613_0020710 3300046689 Bacteria 4903
448 Ga0495613_0021842 3300046689 Bacteria 4770
449 Ga0495624_0004980 3300046690 Bacteria 9622
450 Ga0495624_0005812 3300046690 Bacteria 8833
451 Ga0495624_0009110 3300046690 Bacteria 6883
452 Ga0495600_0014104 3300046809 Bacteria 5033
453 Ga0495600_0027959 3300046809 Bacteria 3647
454 Ga0495600_0039226 3300046809 Bacteria 3084
455 Ga0495600_0040468 3300046809 Bacteria 3035
456 Ga0495581_0010322 3300047315 Bacteria 5402
457 Ga0495581_0056615 3300047315 Bacteria 2263
458 Ga0495604_0008396 3300047317 Bacteria 8165
459 Ga0495604_0018054 3300047317 Bacteria 5645
460 Ga0495604_0046444 3300047317 Bacteria 3385
461 Ga0495604_0057480 3300047317 Bacteria 2990
462 Ga0495604_0060091 3300047317 Bacteria 2911
463 Ga0495604_0060432 3300047317 Bacteria 2902
464 Ga0495636_0005100 3300047318 Bacteria 5159
465 Ga0495636_0009113 3300047318 Bacteria 3903
466 Ga0495674_0002225 3300047319 Bacteria 19082
467 Ga0495674_0018508 3300047319 Bacteria 6483
468 Ga0495674_0018687 3300047319 Bacteria 6451
469 Ga0495674_0027551 3300047319 Bacteria 5191
470 Ga0495674_0059154 3300047319 Bacteria 3348
471 Ga0495674_0074365 3300047319 Bacteria 2926
472 Ga0495672_0001313 3300047320 Bacteria 24742
473 Ga0495672_0008531 3300047320 Bacteria 7545
474 Ga0495676_0002295 3300047321 Bacteria 16971
475 Ga0495676_0006872 3300047321 Bacteria 10455
476 Ga0495680_0001811 3300047322 Bacteria 22577
477 Ga0495680_0007420 3300047322 Bacteria 10056
478 Ga0495680_0009933 3300047322 Bacteria 8523
479 Ga0495680_0018104 3300047322 Bacteria 5993
480 Ga0495680_0043579 3300047322 Bacteria 3551
481 Ga0495680_0056683 3300047322 Bacteria 3032
482 Ga0495675_0000906 3300047444 Bacteria 18066
483 Ga0495675_0008557 3300047444 Bacteria 6343
484 Ga0495675_0042438 3300047444 Bacteria 2897
485 Ga0495684_0000188 3300047471 Bacteria 47553
486 Ga0495684_0001074 3300047471 Bacteria 22115
487 Ga0495684_0004585 3300047471 Bacteria 10798
488 Ga0495684_0048159 3300047471 Bacteria 3259
489 Ga0495684_0068454 3300047471 Bacteria 2699
490 Ga0495686_0000028 3300047472 Bacteria 369493
491 Ga0495593_0005162 3300047673 Bacteria 7718
492 Ga0495593_0012898 3300047673 Bacteria 4774
493 Ga0495602_0007364 3300048088 Bacteria 11524
494 Ga0495602_0014255 3300048088 Bacteria 8076
495 Ga0495602_0034829 3300048088 Bacteria 4703
496 Ga0495602_0042848 3300048088 Bacteria 4120
497 Ga0495602_0043819 3300048088 Bacteria 4063
498 Ga0495602_0062237 3300048088 Bacteria 3238
499 Ga0495602_0073782 3300048088 Bacteria 2902
500 Ga0496101_0001239 3300048904 Bacteria 15256
501 Ga0496101_0021984 3300048904 Bacteria 4386
502 Ga0496102_0148001 3300048905 Bacteria 2205
503 Ga0496103_0014872 3300048906 Bacteria 4626
504 Ga0496104_0053464 3300048907 Bacteria 3816
505 Ga0496104_0113027 3300048907 Bacteria 2604
506 Ga0496105_0010325 3300048908 Bacteria 7341
507 Ga0496105_0023239 3300048908 Bacteria 5027
508 Ga0496106_0002244 3300048909 Bacteria 14403
509 Ga0496106_0035570 3300048909 Bacteria 3724
510 Ga0496107_0001051 3300048910 Bacteria 16518
511 Ga0496107_0043208 3300048910 Bacteria 3237
512 Ga0496107_0078279 3300048910 Bacteria 2409
513 Ga0496108_0019058 3300048911 Bacteria 5629
514 Ga0496108_0028739 3300048911 Bacteria 4600
515 Ga0496108_0069198 3300048911 Bacteria 2978
516 Ga0496108_0099549 3300048911 Bacteria 2478
517 Ga0496109_0000005 3300048912 Bacteria 358226
518 Ga0496109_0001161 3300048912 Bacteria 21914
519 Ga0496109_0009390 3300048912 Bacteria 8335
520 Ga0496109_0033920 3300048912 Bacteria 4594
521 Ga0496109_0034535 3300048912 Bacteria 4556
522 Ga0496109_0064028 3300048912 Bacteria 3364
523 Ga0496110_0006046 3300048913 Bacteria 9540
524 Ga0496110_0011606 3300048913 Bacteria 7222
525 Ga0496110_0041509 3300048913 Bacteria 4015
526 Ga0496111_0018069 3300048914 Bacteria 4878
527 Ga0496111_0027417 3300048914 Bacteria 4029
528 Ga0496111_0037576 3300048914 Bacteria 3465
529 Ga0496112_0020586 3300048915 Bacteria 6255
530 Ga0496114_0000918 3300048917 Bacteria 22085
531 Ga0496114_0001433 3300048917 Bacteria 18080
532 Ga0496114_0003147 3300048917 Bacteria 12672
533 Ga0496114_0029213 3300048917 Bacteria 4529
534 Ga0496114_0079763 3300048917 Bacteria 2764
535 Ga0496115_0002106 3300048918 Bacteria 14243
536 Ga0496115_0012185 3300048918 Bacteria 6466
537 Ga0496115_0039808 3300048918 Bacteria 3734
538 Ga0496117_0014433 3300048920 Bacteria 6806
539 Ga0496118_0000940 3300048921 Bacteria 45474
540 Ga0496118_0002837 3300048921 Bacteria 22651
541 Ga0496121_0000075 3300048924 Bacteria 240437
542 Ga0496121_0000832 3300048924 Bacteria 56038
543 Ga0496126_0037531 3300048929 Bacteria 4520
544 Ga0501031_0002727 3300049568 Bacteria 11246
545 Ga0501031_0027545 3300049568 Bacteria 3705
546 Ga0501032_0014186 3300049569 Bacteria 5645
547 Ga0501033_0000598 3300049570 Bacteria 33419
548 Ga0501033_0048010 3300049570 Bacteria 3173
549 Ga0501036_0000758 3300049572 Bacteria 23921
550 Ga0501036_0051435 3300049572 Bacteria 3488
551 Ga0501037_0006192 3300049573 Bacteria 8751
552 Ga0501037_0015050 3300049573 Bacteria 5690
553 Ga0501038_0019390 3300049574 Bacteria 6132
554 Ga0501038_0022865 3300049574 Bacteria 5596
555 Ga0501038_0051560 3300049574 Bacteria 3550
556 Ga0501039_0011531 3300049575 Bacteria 6727
557 Ga0501039_0024275 3300049575 Bacteria 4655
558 Ga0501039_0031177 3300049575 Bacteria 4110
559 Ga0501039_0037356 3300049575 Bacteria 3748
560 Ga0501039_0049886 3300049575 Bacteria 3237
561 Ga0501040_0001705 3300049576 Bacteria 14074
562 Ga0501040_0007388 3300049576 Bacteria 7114
563 Ga0501040_0014793 3300049576 Bacteria 5149
564 Ga0501041_0000634 3300049577 Bacteria 18382
565 Ga0501041_0007349 3300049577 Bacteria 6467
566 Ga0501041_0042856 3300049577 Bacteria 2751
567 Ga0501042_0000943 3300049578 Bacteria 16364
568 Ga0501042_0001500 3300049578 Bacteria 13790
569 Ga0501042_0001544 3300049578 Bacteria 13640
570 Ga0501042_0005061 3300049578 Bacteria 8459
571 Ga0501046_0000002 3300049580 Bacteria 526908
572 Ga0501046_0001656 3300049580 Bacteria 21290
573 Ga0501046_0027373 3300049580 Bacteria 4651
574 Ga0501046_0029356 3300049580 Bacteria 4470
575 Ga0501047_0004836 3300049581 Bacteria 12660
576 Ga0501047_0094361 3300049581 Bacteria 2871
577 Ga0501048_0003340 3300049582 Bacteria 12207
578 Ga0501048_0024298 3300049582 Bacteria 4424
579 Ga0501067_0000024 3300049583 Bacteria 92998
580 Ga0501067_0000851 3300049583 Bacteria 16470
581 Ga0501067_0005568 3300049583 Bacteria 6982
582 Ga0501067_0018664 3300049583 Bacteria 3839
583 Ga0501068_0001402 3300049584 Bacteria 12816
584 Ga0501068_0049291 3300049584 Bacteria 2543
585 Ga0501068_0050645 3300049584 Bacteria 2510
586 Ga0501069_0008019 3300049585 Bacteria 5548
587 Ga0501070_0000023 3300049586 Bacteria 164053
588 Ga0501070_0010567 3300049586 Bacteria 7802
589 Ga0501070_0017550 3300049586 Bacteria 6008
590 Ga0501071_0004627 3300049587 Bacteria 8733
591 Ga0501071_0005165 3300049587 Bacteria 8362
592 Ga0501071_0018933 3300049587 Bacteria 4776
593 Ga0501071_0026278 3300049587 Bacteria 4085
594 Ga0501071_0043336 3300049587 Bacteria 3226
595 Ga0501072_0000151 3300049588 Bacteria 51318
596 Ga0501072_0027592 3300049588 Bacteria 4429
597 Ga0501072_0036350 3300049588 Bacteria 3861
598 Ga0501073_0000133 3300049589 Bacteria 47997
599 Ga0501073_0006162 3300049589 Bacteria 8951
600 Ga0501073_0014038 3300049589 Bacteria 5819
601 Ga0501073_0015450 3300049589 Bacteria 5538
602 Ga0501073_0037676 3300049589 Bacteria 3432
603 Ga0501074_0012281 3300049590 Bacteria 6226
604 Ga0501075_0002274 3300049591 Bacteria 12729
605 Ga0501075_0007557 3300049591 Bacteria 7542
606 Ga0501076_0002173 3300049592 Bacteria 13461
607 Ga0501076_0005860 3300049592 Bacteria 8861
608 Ga0501076_0010254 3300049592 Bacteria 6946
609 Ga0501076_0068385 3300049592 Bacteria 2837
610 Ga0501077_0002347 3300049593 Bacteria 11406
611 Ga0501077_0005240 3300049593 Bacteria 7874
612 Ga0501077_0010438 3300049593 Bacteria 5780
613 Ga0501079_0001676 3300049741 Bacteria 15754
614 Ga0501079_0001707 3300049741 Bacteria 15660
615 Ga0501079_0003211 3300049741 Bacteria 11970
616 Ga0501080_0002849 3300049742 Bacteria 15205
617 Ga0501080_0017775 3300049742 Bacteria 6581
618 Ga0501080_0023887 3300049742 Bacteria 5666
619 Ga0501081_0003137 3300049743 Bacteria 10506
620 Ga0501081_0005227 3300049743 Bacteria 8359
621 Ga0501083_0011387 3300049744 Bacteria 6240
622 Ga0501035_0000006 3300049822 Bacteria 369040
623 Ga0501035_0000136 3300049822 Bacteria 89432
624 Ga0501035_0010681 3300049822 Bacteria 8500
625 Ga0501035_0057370 3300049822 Bacteria 3472
626 Ga0501045_0003406 3300049824 Bacteria 10884
627 Ga0501045_0042794 3300049824 Bacteria 3297
628 Ga0501045_0055429 3300049824 Bacteria 2899
629 nmdc:mga05p37_121606_c1 3300050507 Bacteria 3207
630 nmdc:mga05p37_169477_c1 3300050507 Bacteria 2664
631 nmdc:mga05p37_203931_c1 3300050507 Bacteria 2393
632 nmdc:mga05p37_210_c1 3300050507 Bacteria 58879
633 nmdc:mga05p37_28942_c1 3300050507 Bacteria 6759
634 nmdc:mga05p37_47491_c1 3300050507 Bacteria 5280
635 nmdc:mga09592_21156_c1 3300050508 Bacteria 5359
636 nmdc:mga09592_67342_c1 3300050508 Bacteria 3037
637 nmdc:mga0qj67_43541_c1 3300050509 Bacteria 3535
638 nmdc:mga06r32_108209_c1 3300050510 Bacteria 2733
639 nmdc:mga06r32_14946_c1 3300050510 Bacteria 7045
640 nmdc:mga06r32_2687_c1 3300050510 Bacteria 15914
641 nmdc:mga06r32_51744_c1 3300050510 Bacteria 3931
642 nmdc:mga08y16_11062_c1 3300050511 Bacteria 9474
643 nmdc:mga08y16_121958_c1 3300050511 Bacteria 2713
644 nmdc:mga08y16_34082_c1 3300050511 Bacteria 5348
645 nmdc:mga08y16_36998_c1 3300050511 Bacteria 5126
646 nmdc:mga08y16_3801_c1 3300050511 Bacteria 15723
647 nmdc:mga08y16_6452_c1 3300050511 Bacteria 12303
648 nmdc:mga08y16_66397_c1 3300050511 Bacteria 3765
649 nmdc:mga0rr50_38024_c1 3300050513 Bacteria 3479
650 nmdc:mga08x19_5857_c1 3300050514 Bacteria 7276
651 nmdc:mga0a205_70053_c1 3300050515 Bacteria 3386
652 Ga0495601_0005809 3300053077 Bacteria 7194
653 Ga0495601_0006218 3300053077 Bacteria 6974
654 Ga0495601_0036144 3300053077 Bacteria 3084
655 Ga0500635_0000696 3300053080 Bacteria 8511
656 Ga0495619_0009606 3300053085 Bacteria 6100
657 Ga0500643_005913 3300053087 Bacteria 5189
658 Ga0500616_0001539 3300053153 Bacteria 21684
659 Ga0501084_0000172 3300054114 Bacteria 50211
660 Ga0501084_0000885 3300054114 Bacteria 23177
661 Ga0501084_0001208 3300054114 Bacteria 20262
662 Ga0501084_0013944 3300054114 Bacteria 6652
663 Ga0501082_0002146 3300060353 Bacteria 17290
664 Ga0501082_0013628 3300060353 Bacteria 6987
665 Ga0501082_0014422 3300060353 Bacteria 6801
666 Ga0501082_0022512 3300060353 Bacteria 5427
667 Ga0501082_0111929 3300060353 Bacteria 2363
668 Ga0530510_0000312 3300061734 Bacteria 31116
669 Ga0530510_0000554 3300061734 Bacteria 24110
670 Ga0530510_0013127 3300061734 Bacteria 5827
671 Ga0530510_0019432 3300061734 Bacteria 4822
672 Ga0530510_0021465 3300061734 Bacteria 4594
673 Ga0530510_0024686 3300061734 Bacteria 4293
674 Ga0530510_0059522 3300061734 Bacteria 2763
675 Ga0530510_0062280 3300061734 Bacteria 2700
676 Ga0530510_0073023 3300061734 Bacteria 2490
677 2506867855 2506783011 Bacteria 5323186
678 2644085380 2643221614 Bacteria 4260023
679 2644085609 2643221614 Bacteria 4260023
680 2644342932 2643221661 Bacteria 4267604
681 2644343160 2643221661 Bacteria 4267604
682 2644366232 2643221666 Bacteria 4265935
683 2644366460 2643221666 Bacteria 4265935
684 2808873197 2808606365 Bacteria 4301966
685 2837270096 2837268691 Bacteria 7850704
686 2902815151 2902810491 Bacteria 6794147
687 2913915778 2913912277 Bacteria 9037797
688 2913940840 2913939268 Bacteria 8559644
689 2941474835 2941471342 Bacteria 5018624
690 Ga0081455_10054109
691 rootH2_10025454
692 rootH2_10046278
693 Ga0058859_11775670
694 Ga0058863_10064911
695 Ga0058861_10058546
696 Ga0070683_100000398
697 Ga0070683_100003404
698 Ga0070683_100019126
699 Ga0070690_100002286
700 Ga0070670_100025737
701 Ga0068869_100021281
702 Ga0070682_100003587
703 Ga0068868_100013366
704 Ga0068868_100017457
705 Ga0070660_100029140
706 Ga0070689_100005448
707 Ga0070689_100041376
708 Ga0070691_10003152
709 Ga0070691_10007041
710 Ga0070668_100000255
711 Ga0070668_100050706
712 Ga0070675_100000097
713 Ga0070675_100000719
714 Ga0070671_100010861
715 Ga0070674_100013233
716 Ga0070673_100029171
717 Ga0070659_100082777
718 Ga0070709_10010770
719 Ga0070714_100022286
720 Ga0070713_100017062
721 Ga0070700_100033940
722 Ga0070694_100029291
723 Ga0070662_100039741
724 Ga0070681_10033372
725 Ga0070681_10036963
726 Ga0070706_100001143
727 Ga0070707_100044010
728 Ga0070698_100017650
729 Ga0070698_100050583
730 Ga0070699_100008113
731 Ga0070684_100000462
732 Ga0070684_100000509
733 Ga0070684_100004354
734 Ga0070697_100006229
735 Ga0068853_100085658
736 Ga0070686_100029498
737 Ga0070665_100000441
738 Ga0070704_100007965
739 Ga0070664_100007124
740 Ga0070664_100017718
741 Ga0070664_100033555
742 Ga0068857_100000264
743 Ga0068856_100002050
744 Ga0068856_100003948
745 Ga0070702_100009777
746 Ga0068852_100082309
747 Ga0068859_100000936
748 Ga0068859_100001959
749 Ga0068864_100009009
750 Ga0068861_100034146
751 Ga0068861_100048611
752 Ga0068858_100062699
753 Ga0068860_100004148
754 Ga0068862_100008662
755 Ga0068862_100041752
756 Ga0081455_10002341
757 Ga0081455_10004533
758 Ga0081455_10004821
759 Ga0081455_10005587
760 Ga0081455_10016987
761 Ga0081538_10002182
762 Ga0081538_10009182
763 Ga0081540_1019137
764 Ga0081540_1026317
765 Ga0081540_1029074
766 Ga0070717_10004543
767 Ga0070717_10014967
768 Ga0070717_10027456
769 Ga0097621_100006367
770 Ga0097621_100028661
771 Ga0068871_100000253
772 Ga0075428_100002855
773 Ga0075428_100009299
774 Ga0075428_100033212
775 Ga0075428_100035766
776 Ga0075428_100101398
777 Ga0075430_100015398
778 Ga0075430_100023004
779 Ga0075431_100004329
780 Ga0075431_100034745
781 Ga0075431_100039943
782 Ga0075431_100066089
783 Ga0075431_100110291
784 Ga0075431_100112534
785 Ga0075433_10000529
786 Ga0075429_100023778
787 Ga0075429_100078947
788 Ga0068865_100045773
789 Ga0075436_100000719
790 Ga0097620_100000936
791 Ga0097620_100001959
792 Ga0105240_10156405
793 Ga0111539_10006878
794 Ga0111539_10011499
795 Ga0111539_10032030
796 Ga0111539_10034408
797 Ga0111539_10065307
798 Ga0111539_10071355
799 Ga0105245_10006689
800 Ga0105245_10016567
801 Ga0114129_10013951
802 Ga0114129_10066600
803 Ga0105242_10049773
804 Ga0105248_10018994
805 Ga0105248_10107396
806 Ga0105248_10109179
807 Ga0105237_10078621
808 Ga0105238_10035493
809 Ga0105238_10100470
810 Ga0105249_10006028
811 Ga0105246_10040231
812 Ga0157369_10003210
813 Ga0157369_10005783
814 Ga0157369_10075723
815 Ga0157374_10000866
816 Ga0157374_10016268
817 Ga0157374_10083403
818 Ga0157374_10106643
819 Ga0157378_10000055
820 Ga0157378_10048885
821 Ga0163162_10019681
822 Ga0163162_10057398
823 Ga0163162_10065164
824 Ga0157372_10011593
825 Ga0157372_10033187
826 Ga0157372_10035179
827 Ga0157372_10069450
828 Ga0157375_10037090
829 Ga0163163_10046809
830 Ga0157380_10045455
831 Ga0157377_10012525
832 Ga0157376_10074488
833 Ga0182007_10001064
834 Ga0163161_10038535
835 Ga0206352_10477980
836 Ga0206350_11417348
837 Ga0213875_10000598
838 Ga0224712_10005520
839 Ga0207653_10008147
840 Ga0207653_10013701
841 Ga0207692_10012148
842 Ga0207688_10009600
843 Ga0207647_10033172
844 Ga0207685_10008450
845 Ga0207645_10049761
846 Ga0207643_10019878
847 Ga0207684_10001711
848 Ga0207684_10043264
849 Ga0207707_10031257
850 Ga0207693_10000838
851 Ga0207660_10060808
852 Ga0207662_10026561
853 Ga0207662_10041057
854 Ga0207657_10018627
855 Ga0207657_10028499
856 Ga0207657_10074648
857 Ga0207652_10012617
858 Ga0207681_10045549
859 Ga0207659_10000352
860 Ga0207659_10046527
861 Ga0207687_10012059
862 Ga0207687_10034630
863 Ga0207700_10002166
864 Ga0207664_10013575
865 Ga0207706_10010700
866 Ga0207706_10013201
867 Ga0207706_10066421
868 Ga0207670_10001229
869 Ga0207665_10014205
870 Ga0207665_10048416
871 Ga0207691_10009484
872 Ga0207691_10061378
873 Ga0207711_10010318
874 Ga0207689_10024087
875 Ga0207689_10032849
876 Ga0207661_10020316
877 Ga0207661_10022053
878 Ga0207661_10037297
879 Ga0207679_10052834
880 Ga0207651_10000325
881 Ga0207712_10020307
882 Ga0207668_10000001
883 Ga0207703_10014304
884 Ga0207678_10018522
885 Ga0207678_10023261
886 Ga0207678_10061836
887 Ga0207708_10003737
888 Ga0207708_10009667
889 Ga0207702_10003801
890 Ga0207648_10003424
891 Ga0207648_10060319
892 Ga0207674_10000157
893 Ga0207674_10016529
894 Ga0207674_10027413
895 Ga0207675_100011087
896 Ga0207675_100070677
897 Ga0207675_100079562
898 Ga0207683_10000753
899 Ga0207698_10062967
900 Ga0207428_10004642
901 Ga0207428_10009384
902 Ga0207428_10035774
903 Ga0207428_10079800
904 Ga0268266_10001052
905 Ga0268265_10010766
906 Ga0265338_10002317
907 Ga0265338_10007754
908 Ga0265338_10047133
909 Ga0307513_10046470
910 Ga0316579_10003226
911 Ga0316579_10009756
912 Ga0316579_10012373
913 Ga0316579_10022811
914 Ga0265314_10003612
915 Ga0265342_10011968
916 Ga0316576_10048165
917 Ga0316576_10055457
918 Ga0316576_10065030
919 Ga0316578_10006412
920 Ga0316578_10033722
921 Ga0316577_10001188
922 Ga0316577_10009085
923 Ga0316577_10014911
924 Ga0316577_10032057
925 Ga0307410_10009991
926 Ga0307409_100007136
927 Ga0307416_100005623
928 Ga0316583_10015244
929 Ga0316585_10010635
930 Ga0316586_1000091
931 Ga0316587_1000003
932 Ga0373950_0000069
933 Ga0373926_0001932
934 Ga0373934_0007050
935 Ga0373934_0012017
936 Ga0373934_0015108
937 Ga0373923_0001369
938 Ga0373923_0012973
939 Ga0373923_0013798
940 Ga0373936_0000361
941 Ga0373936_0000927
942 Ga0373936_0016176
943 Ga0373945_0000032
944 Ga0373945_0001212
945 Ga0373953_0001069
946 Ga0373954_0008457
947 Ga0373954_0015675
948 Ga0373954_0021951
949 Ga0373956_0002465
950 Ga0373956_0018837
951 Ga0373957_0001552
952 Ga0373943_0000103
953 Ga0373943_0002595
954 Ga0373946_0000917
955 Ga0373946_0001011
956 Ga0373946_0001093
957 Ga0373955_0005604
958 Ga0373955_0015207
959 Ga0316574_0000821
960 Ga0316574_0005112
961 Ga0373924_0004119
962 Ga0373924_0011638
963 Ga0373931_0009243
964 Ga0373931_0037981
965 Ga0373935_0000548
966 Ga0373935_0005770
967 Ga0373935_0012133
968 Ga0373935_0015192
969 Ga0373927_0003346
970 Ga0373927_0004738
971 Ga0373933_0008971
972 Ga0373933_0031914
973 Ga0373947_0000465
974 Ga0373947_0002843
975 Ga0373947_0004804
976 Ga0373947_0019982
977 Ga0373937_0007831
978 Ga0373937_0014750
979 Ga0373937_0024695
980 Ga0373937_0042583
981 Ga0373937_0057446
982 Ga0373937_0098505
983 Ga0316582_0001078
984 Ga0316582_0005700
985 Ga0316582_0005902
986 Ga0316582_0030618
987 Ga0316582_0046118
988 Ga0316584_0001065
989 Ga0316584_0008491
990 Ga0316584_0020532
991 Ga0316584_0020894
992 Ga0316584_0024912
993 Ga0316584_0032060
994 Ga0316584_0041604
995 Ga0316584_0046462
996 Ga0316584_0056616
997 Ga0316584_0067539
998 Ga0373925_0000627
999 Ga0373925_0002391
1000 Ga0373925_0005244
1001 Ga0373925_0005649
1002 Ga0373925_0028331
1003 Ga0395900_0009710
1004 Ga0395898_0025637
1005 Ga0395898_0074662
1006 Ga0436364_0170857
1007 Ga0395901_0009967
1008 Ga0436361_0354204
1009 Ga0436361_1141966
1010 Ga0450903_000162
1011 Ga0439458_0001019
1012 Ga0451577_0009950
1013 Ga0453684_0029356
1014 Ga0453684_0147886
1015 Ga0495592_0005024
1016 Ga0495592_0026998
1017 Ga0495592_0055989
1018 Ga0495603_0000941
1019 Ga0495629_0004422
1020 Ga0495629_0024620
1021 Ga0495641_0003706
1022 Ga0495651_0001645
1023 Ga0495651_0001800
1024 Ga0495651_0017304
1025 Ga0495651_0023982
1026 Ga0495651_0024096
1027 Ga0495651_0025013
1028 Ga0495651_0026403
1029 Ga0495651_0062474
1030 Ga0495651_0079391
1031 Ga0495653_0005136
1032 Ga0495653_0010357
1033 Ga0495653_0014179
1034 Ga0495653_0043294
1035 Ga0495653_0052781
1036 Ga0495653_0056959
1037 Ga0495653_0060768
1038 Ga0495580_0005623
1039 Ga0495582_0001230
1040 Ga0495605_0024457
1041 Ga0495639_0001312
1042 Ga0495662_0001043
1043 Ga0495662_0003567
1044 Ga0495662_0006219
1045 Ga0495664_0000761
1046 Ga0495664_0003660
1047 Ga0495664_0007410
1048 Ga0495664_0016782
1049 Ga0495584_0026193
1050 Ga0495608_0002010
1051 Ga0495608_0018430
1052 Ga0495608_0047302
1053 Ga0495608_0049092
1054 Ga0495610_0000629
1055 Ga0495618_0007784
1056 Ga0495618_0016583
1057 Ga0495618_0027014
1058 Ga0495628_0010793
1059 Ga0495628_0013266
1060 Ga0495628_0016463
1061 Ga0495628_0022603
1062 Ga0495628_0043484
1063 Ga0495628_0053278
1064 Ga0495628_0070497
1065 Ga0495628_0089710
1066 Ga0495630_0001346
1067 Ga0495630_0004983
1068 Ga0495630_0028680
1069 Ga0495631_0000128
1070 Ga0495666_0014542
1071 Ga0495652_0004310
1072 Ga0495652_0007220
1073 Ga0495652_0007693
1074 Ga0495652_0009522
1075 Ga0495652_0024480
1076 Ga0495652_0043361
1077 Ga0495652_0056255
1078 Ga0495652_0070680
1079 Ga0495665_0003786
1080 Ga0495640_0007342
1081 Ga0495640_0014231
1082 Ga0495640_0020145
1083 Ga0495640_0065056
1084 Ga0495586_0001077
1085 Ga0495587_0005544
1086 Ga0495587_0014673
1087 Ga0495587_0017801
1088 Ga0495587_0021370
1089 Ga0495645_0002041
1090 Ga0495645_0005227
1091 Ga0495645_0014927
1092 Ga0495645_0039741
1093 Ga0495645_0056507
1094 Ga0495645_0057783
1095 Ga0495645_0061733
1096 Ga0495645_0091453
1097 Ga0495667_0003307
1098 Ga0495667_0008323
1099 Ga0495667_0011984
1100 Ga0495667_0013524
1101 Ga0495667_0021185
1102 Ga0495667_0045309
1103 Ga0495634_0016884
1104 Ga0495634_0025925
1105 Ga0495634_0050850
1106 Ga0495625_0021732
1107 Ga0495635_0001088
1108 Ga0495635_0004406
1109 Ga0495635_0004997
1110 Ga0495635_0059305
1111 Ga0495588_0004318
1112 Ga0495657_0007137
1113 Ga0495657_0011422
1114 Ga0495657_0012426
1115 Ga0495657_0014136
1116 Ga0495657_0024848
1117 Ga0495657_0051695
1118 Ga0495599_0004643
1119 Ga0495599_0005968
1120 Ga0495599_0010765
1121 Ga0495599_0031390
1122 Ga0495599_0037849
1123 Ga0495623_0002925
1124 Ga0495623_0010659
1125 Ga0495623_0038340
1126 Ga0495646_0004883
1127 Ga0495646_0027356
1128 Ga0495646_0030454
1129 Ga0495646_0036671
1130 Ga0495658_0002221
1131 Ga0495658_0049084
1132 Ga0495669_0001066
1133 Ga0495613_0000186
1134 Ga0495613_0016139
1135 Ga0495613_0016140
1136 Ga0495613_0020710
1137 Ga0495613_0021842
1138 Ga0495624_0004980
1139 Ga0495624_0005812
1140 Ga0495624_0009110
1141 Ga0495600_0014104
1142 Ga0495600_0027959
1143 Ga0495600_0039226
1144 Ga0495600_0040468
1145 Ga0495581_0010322
1146 Ga0495581_0056615
1147 Ga0495604_0008396
1148 Ga0495604_0018054
1149 Ga0495604_0046444
1150 Ga0495604_0057480
1151 Ga0495604_0060091
1152 Ga0495604_0060432
1153 Ga0495636_0005100
1154 Ga0495636_0009113
1155 Ga0495674_0002225
1156 Ga0495674_0018508
1157 Ga0495674_0018687
1158 Ga0495674_0027551
1159 Ga0495674_0059154
1160 Ga0495674_0074365
1161 Ga0495672_0001313
1162 Ga0495672_0008531
1163 Ga0495676_0002295
1164 Ga0495676_0006872
1165 Ga0495680_0001811
1166 Ga0495680_0007420
1167 Ga0495680_0009933
1168 Ga0495680_0018104
1169 Ga0495680_0043579
1170 Ga0495680_0056683
1171 Ga0495675_0000906
1172 Ga0495675_0008557
1173 Ga0495675_0042438
1174 Ga0495684_0000188
1175 Ga0495684_0001074
1176 Ga0495684_0004585
1177 Ga0495684_0048159
1178 Ga0495684_0068454
1179 Ga0495686_0000028
1180 Ga0495593_0005162
1181 Ga0495593_0012898
1182 Ga0495602_0007364
1183 Ga0495602_0014255
1184 Ga0495602_0034829
1185 Ga0495602_0042848
1186 Ga0495602_0043819
1187 Ga0495602_0062237
1188 Ga0495602_0073782
1189 Ga0496101_0001239
1190 Ga0496101_0021984
1191 Ga0496102_0148001
1192 Ga0496103_0014872
1193 Ga0496104_0053464
1194 Ga0496104_0113027
1195 Ga0496105_0010325
1196 Ga0496105_0023239
1197 Ga0496106_0002244
1198 Ga0496106_0035570
1199 Ga0496107_0001051
1200 Ga0496107_0043208
1201 Ga0496107_0078279
1202 Ga0496108_0019058
1203 Ga0496108_0028739
1204 Ga0496108_0069198
1205 Ga0496108_0099549
1206 Ga0496109_0000005
1207 Ga0496109_0001161
1208 Ga0496109_0009390
1209 Ga0496109_0033920
1210 Ga0496109_0034535
1211 Ga0496109_0064028
1212 Ga0496110_0006046
1213 Ga0496110_0011606
1214 Ga0496110_0041509
1215 Ga0496111_0018069
1216 Ga0496111_0027417
1217 Ga0496111_0037576
1218 Ga0496112_0020586
1219 Ga0496114_0000918
1220 Ga0496114_0001433
1221 Ga0496114_0003147
1222 Ga0496114_0029213
1223 Ga0496114_0079763
1224 Ga0496115_0002106
1225 Ga0496115_0012185
1226 Ga0496115_0039808
1227 Ga0496117_0014433
1228 Ga0496118_0000940
1229 Ga0496118_0002837
1230 Ga0496121_0000075
1231 Ga0496121_0000832
1232 Ga0496126_0037531
1233 Ga0501031_0002727
1234 Ga0501031_0027545
1235 Ga0501032_0014186
1236 Ga0501033_0000598
1237 Ga0501033_0048010
1238 Ga0501036_0000758
1239 Ga0501036_0051435
1240 Ga0501037_0006192
1241 Ga0501037_0015050
1242 Ga0501038_0019390
1243 Ga0501038_0022865
1244 Ga0501038_0051560
1245 Ga0501039_0011531
1246 Ga0501039_0024275
1247 Ga0501039_0031177
1248 Ga0501039_0037356
1249 Ga0501039_0049886
1250 Ga0501040_0001705
1251 Ga0501040_0007388
1252 Ga0501040_0014793
1253 Ga0501041_0000634
1254 Ga0501041_0007349
1255 Ga0501041_0042856
1256 Ga0501042_0000943
1257 Ga0501042_0001500
1258 Ga0501042_0001544
1259 Ga0501042_0005061
1260 Ga0501046_0000002
1261 Ga0501046_0001656
1262 Ga0501046_0027373
1263 Ga0501046_0029356
1264 Ga0501047_0004836
1265 Ga0501047_0094361
1266 Ga0501048_0003340
1267 Ga0501048_0024298
1268 Ga0501067_0000024
1269 Ga0501067_0000851
1270 Ga0501067_0005568
1271 Ga0501067_0018664
1272 Ga0501068_0001402
1273 Ga0501068_0049291
1274 Ga0501068_0050645
1275 Ga0501069_0008019
1276 Ga0501070_0000023
1277 Ga0501070_0010567
1278 Ga0501070_0017550
1279 Ga0501071_0004627
1280 Ga0501071_0005165
1281 Ga0501071_0018933
1282 Ga0501071_0026278
1283 Ga0501071_0043336
1284 Ga0501072_0000151
1285 Ga0501072_0027592
1286 Ga0501072_0036350
1287 Ga0501073_0000133
1288 Ga0501073_0006162
1289 Ga0501073_0014038
1290 Ga0501073_0015450
1291 Ga0501073_0037676
1292 Ga0501074_0012281
1293 Ga0501075_0002274
1294 Ga0501075_0007557
1295 Ga0501076_0002173
1296 Ga0501076_0005860
1297 Ga0501076_0010254
1298 Ga0501076_0068385
1299 Ga0501077_0002347
1300 Ga0501077_0005240
1301 Ga0501077_0010438
1302 Ga0501079_0001676
1303 Ga0501079_0001707
1304 Ga0501079_0003211
1305 Ga0501080_0002849
1306 Ga0501080_0017775
1307 Ga0501080_0023887
1308 Ga0501081_0003137
1309 Ga0501081_0005227
1310 Ga0501083_0011387
1311 Ga0501035_0000006
1312 Ga0501035_0000136
1313 Ga0501035_0010681
1314 Ga0501035_0057370
1315 Ga0501045_0003406
1316 Ga0501045_0042794
1317 Ga0501045_0055429
1318 nmdc:mga05p37_121606_c1
1319 nmdc:mga05p37_169477_c1
1320 nmdc:mga05p37_203931_c1
1321 nmdc:mga05p37_210_c1
1322 nmdc:mga05p37_28942_c1
1323 nmdc:mga05p37_47491_c1
1324 nmdc:mga09592_21156_c1
1325 nmdc:mga09592_67342_c1
1326 nmdc:mga0qj67_43541_c1
1327 nmdc:mga06r32_108209_c1
1328 nmdc:mga06r32_14946_c1
1329 nmdc:mga06r32_2687_c1
1330 nmdc:mga06r32_51744_c1
1331 nmdc:mga08y16_11062_c1
1332 nmdc:mga08y16_121958_c1
1333 nmdc:mga08y16_34082_c1
1334 nmdc:mga08y16_36998_c1
1335 nmdc:mga08y16_3801_c1
1336 nmdc:mga08y16_6452_c1
1337 nmdc:mga08y16_66397_c1
1338 nmdc:mga0rr50_38024_c1
1339 nmdc:mga08x19_5857_c1
1340 nmdc:mga0a205_70053_c1
1341 Ga0495601_0005809
1342 Ga0495601_0006218
1343 Ga0495601_0036144
1344 Ga0500635_0000696
1345 Ga0495619_0009606
1346 Ga0500643_005913
1347 Ga0500616_0001539
1348 Ga0501084_0000172
1349 Ga0501084_0000885
1350 Ga0501084_0001208
1351 Ga0501084_0013944
1352 Ga0501082_0002146
1353 Ga0501082_0013628
1354 Ga0501082_0014422
1355 Ga0501082_0022512
1356 Ga0501082_0111929
1357 Ga0530510_0000312
1358 Ga0530510_0000554
1359 Ga0530510_0013127
1360 Ga0530510_0019432
1361 Ga0530510_0021465
1362 Ga0530510_0024686
1363 Ga0530510_0059522
1364 Ga0530510_0062280
1365 Ga0530510_0073023
1366 2506867855
1367 2644085380
1368 2644085609
1369 2644342932
1370 2644343160
1371 2644366232
1372 2644366460
1373 2808873197
1374 2837270096
1375 2902815151
1376 2913915778
1377 2913940840
1378 2941474835

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00884

Sulfatase

Sulfatase

156

550

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7all-assembly1.cif.gz_AAA a single sulfatase is required for metabolism of colonic mucin o-glycans and intestinal colonization by a symbiotic human gut bacterium (bt4683-s1_4) 0.9218 31 577
4cxs-assembly1.cif.gz_A g4 mutant of pas, arylsulfatase from pseudomonas aeruginosa, in complex with phenylphosphonic acid 0.8846 31 570
7all-assembly1.cif.gz_AAA a single sulfatase is required for metabolism of colonic mucin o-glycans and intestinal colonization by a symbiotic human gut bacterium (bt4683-s1_4) 0.8844 31 577
5aj9-assembly2.cif.gz_B g7 mutant of pas, arylsulfatase from pseudomonas aeruginosa 0.8788 31 573
4cxu-assembly2.cif.gz_B g4 mutant of pas, arylsulfatase from pseudomonas aeruginosa, in complex with 3-br-phenolphenylphosphonate 0.8781 31 570
ID Description Score Start End Superfamily
af_P95059_35_492_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9835 31 486 3.40.720.10
af_P95059_35_492_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9771 31 486 3.40.720.10
af_I6XVW9_41_489_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.968 31 489 3.40.720.10
af_I6XVW9_41_489_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9616 31 489 3.40.720.10
af_O65931_209_662_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9464 30 488 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A562E120-F1-model_v4 Arylsulfatase 0.9817 32 213 GO:0016787
AF-A0A520EQ29-F1-model_v4 Arylsulfatase 0.9801 3 515 GO:0016787
AF-A0A368TKK5-F1-model_v4 Arylsulfatase (EC 3.1.6.1) 0.9783 50 201 GO:0004065
AF-A0A6I2V894-F1-model_v4 Sulfatase-like hydrolase/transferase 0.9779 1 404 GO:0016740
GO:0016787
AF-A0A535S7R9-F1-model_v4 Arylsulfatase 0.9772 1 670 GO:0016787

Map