F475435
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 303 | 1378 | 769 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10054109|Ga0081455_100541093 |
| Length | 870 |
| Sequence | MSRTNPSATTSHSQPSTPPIADHMRTYASVVHGRKMIPSTGQIQELKAASQRPGLAIHQITAAILGPMNPAVSARQHITRNYDNVGNDCSTGNPLLRRAEMAAKKEPKGSQDGKVAATPELVEYEPGTAFPGVIGRTFDVSTPAWPEPLRAQEEAPNVLFIVIDDTGFGHLGCYGSPISTPNIDRLAEGGLRYANMHTTALCSPTRSCILTGRNHHSNHMAGITEISTGFPGYDGYIPFENGFLSEVLRAEGYNTYAVGKWHLTPSDQLTAAGPYDRWPLGRGFDRFYGFMGGDTHPEEGYHLTEDLTDRAIAFIADAKQVAPNKPFFLYFATGAQHAPHHVPKEWADKYKGAFADGWDAYRERVFAKQKRLGLVPRSAELSRHDPDVQNWKRLSAKERKLYARMMEVFAGFLEHTDHHIGRLLDFLKEIGEFDNTLIMLISDNGASAEGGPSGSVNENKFFNFVPDSLEQNLAAIDDIGGPKYFNHYPWGWTFAGNTPFRRWKRETYRGGISDPFIVHWKKGIKAKGEVRAQFAHAIDMVPTVLEALGVEAPTSIRGVTQTPIEGVSFAHTFDDAKAPTKHVTQYFEMMGHRSIYHDGWRAVCPWPGTSFTESGRQFGTPIPAKTLTELDATGWELYHVAKDPAENDNLAEKERPRLIEMIAQWYVEAGKYNVLPVDGRGQQRFAELRPQIAVDRTRYAYYPGTQEVPQNAAPRILNRPHTVTAVVEIPKGGAEGVLVSQGGVDGGFTFFVQDGKLRYTYNYVADQRFQVVSDKDVPAGRHALSFEFTPTGKAQPLKGKGTPGSVSLFVDGKPAGEGNLAVTIPISMPVTDEYEPPFDFTGTIEKVVYDVSGERIVDHEAEIRMALARQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 87 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 136 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 137 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 142 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 143 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 146 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 147 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 159 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 167 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 174 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 175 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 176 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 177 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 178 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 245 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 294 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 295 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 296 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 297 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 298 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 299 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 300 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 301 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 302 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 303 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.96 |
| Metatranscriptomes | 1.16 |
| Isolates | 1.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0.14 |
| Rhizoplane | 5.51 |
| Rhizosphere | 90.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10054109 | 3300005937 | Bacteria | 3423 |
| 2 | rootH2_10025454 | 3300003320 | Bacteria | 6845 |
| 3 | rootH2_10046278 | 3300003320 | Bacteria | 19869 |
| 4 | Ga0058859_11775670 | 3300004798 | Bacteria | 2602 |
| 5 | Ga0058863_10064911 | 3300004799 | Bacteria | 2600 |
| 6 | Ga0058861_10058546 | 3300004800 | Bacteria | 2712 |
| 7 | Ga0070683_100000398 | 3300005329 | Bacteria | 30072 |
| 8 | Ga0070683_100003404 | 3300005329 | Bacteria | 12898 |
| 9 | Ga0070683_100019126 | 3300005329 | Bacteria | 6079 |
| 10 | Ga0070690_100002286 | 3300005330 | Bacteria | 10276 |
| 11 | Ga0070670_100025737 | 3300005331 | Bacteria | 5063 |
| 12 | Ga0068869_100021281 | 3300005334 | Bacteria | 4460 |
| 13 | Ga0070682_100003587 | 3300005337 | Bacteria | 8592 |
| 14 | Ga0068868_100013366 | 3300005338 | Bacteria | 6020 |
| 15 | Ga0068868_100017457 | 3300005338 | Bacteria | 5348 |
| 16 | Ga0070660_100029140 | 3300005339 | Bacteria | 4134 |
| 17 | Ga0070689_100005448 | 3300005340 | Bacteria | 8691 |
| 18 | Ga0070689_100041376 | 3300005340 | Bacteria | 3537 |
| 19 | Ga0070691_10003152 | 3300005341 | Bacteria | 7383 |
| 20 | Ga0070691_10007041 | 3300005341 | Bacteria | 5155 |
| 21 | Ga0070668_100000255 | 3300005347 | Bacteria | 35284 |
| 22 | Ga0070668_100050706 | 3300005347 | Bacteria | 3196 |
| 23 | Ga0070675_100000097 | 3300005354 | Bacteria | 50764 |
| 24 | Ga0070675_100000719 | 3300005354 | Bacteria | 23032 |
| 25 | Ga0070671_100010861 | 3300005355 | Bacteria | 7309 |
| 26 | Ga0070674_100013233 | 3300005356 | Bacteria | 5094 |
| 27 | Ga0070673_100029171 | 3300005364 | Bacteria | 4112 |
| 28 | Ga0070659_100082777 | 3300005366 | Bacteria | 2564 |
| 29 | Ga0070709_10010770 | 3300005434 | Bacteria | 5074 |
| 30 | Ga0070714_100022286 | 3300005435 | Bacteria | 5193 |
| 31 | Ga0070713_100017062 | 3300005436 | Bacteria | 5478 |
| 32 | Ga0070700_100033940 | 3300005441 | Bacteria | 3077 |
| 33 | Ga0070694_100029291 | 3300005444 | Bacteria | 3592 |
| 34 | Ga0070662_100039741 | 3300005457 | Bacteria | 3347 |
| 35 | Ga0070681_10033372 | 3300005458 | Bacteria | 5168 |
| 36 | Ga0070681_10036963 | 3300005458 | Bacteria | 4900 |
| 37 | Ga0070706_100001143 | 3300005467 | Bacteria | 28603 |
| 38 | Ga0070707_100044010 | 3300005468 | Bacteria | 4273 |
| 39 | Ga0070698_100017650 | 3300005471 | Bacteria | 7518 |
| 40 | Ga0070698_100050583 | 3300005471 | Bacteria | 4235 |
| 41 | Ga0070699_100008113 | 3300005518 | Bacteria | 9119 |
| 42 | Ga0070684_100000462 | 3300005535 | Bacteria | 27772 |
| 43 | Ga0070684_100000509 | 3300005535 | Bacteria | 26687 |
| 44 | Ga0070684_100004354 | 3300005535 | Bacteria | 10760 |
| 45 | Ga0070697_100006229 | 3300005536 | Bacteria | 9238 |
| 46 | Ga0068853_100085658 | 3300005539 | Bacteria | 2762 |
| 47 | Ga0070686_100029498 | 3300005544 | Bacteria | 3338 |
| 48 | Ga0070665_100000441 | 3300005548 | Bacteria | 60634 |
| 49 | Ga0070704_100007965 | 3300005549 | Bacteria | 6327 |
| 50 | Ga0070664_100007124 | 3300005564 | Bacteria | 9021 |
| 51 | Ga0070664_100017718 | 3300005564 | Bacteria | 5851 |
| 52 | Ga0070664_100033555 | 3300005564 | Bacteria | 4300 |
| 53 | Ga0068857_100000264 | 3300005577 | Bacteria | 35486 |
| 54 | Ga0068856_100002050 | 3300005614 | Bacteria | 20895 |
| 55 | Ga0068856_100003948 | 3300005614 | Bacteria | 14850 |
| 56 | Ga0070702_100009777 | 3300005615 | Bacteria | 4706 |
| 57 | Ga0068852_100082309 | 3300005616 | Bacteria | 2860 |
| 58 | Ga0068859_100000936 | 3300005617 | Bacteria | 29958 |
| 59 | Ga0068859_100001959 | 3300005617 | Bacteria | 20995 |
| 60 | Ga0068864_100009009 | 3300005618 | Bacteria | 8229 |
| 61 | Ga0068861_100034146 | 3300005719 | Bacteria | 3760 |
| 62 | Ga0068861_100048611 | 3300005719 | Bacteria | 3208 |
| 63 | Ga0068858_100062699 | 3300005842 | Bacteria | 3438 |
| 64 | Ga0068860_100004148 | 3300005843 | Bacteria | 14848 |
| 65 | Ga0068862_100008662 | 3300005844 | Bacteria | 8413 |
| 66 | Ga0068862_100041752 | 3300005844 | Bacteria | 3904 |
| 67 | Ga0081455_10002341 | 3300005937 | Bacteria | 22617 |
| 68 | Ga0081455_10004533 | 3300005937 | Bacteria | 15519 |
| 69 | Ga0081455_10004821 | 3300005937 | Bacteria | 14988 |
| 70 | Ga0081455_10005587 | 3300005937 | Bacteria | 13755 |
| 71 | Ga0081455_10016987 | 3300005937 | Bacteria | 6995 |
| 72 | Ga0081538_10002182 | 3300005981 | Bacteria | 19423 |
| 73 | Ga0081538_10009182 | 3300005981 | Bacteria | 8288 |
| 74 | Ga0081540_1019137 | 3300005983 | Bacteria | 4175 |
| 75 | Ga0081540_1026317 | 3300005983 | Bacteria | 3323 |
| 76 | Ga0081540_1029074 | 3300005983 | Bacteria | 3088 |
| 77 | Ga0070717_10004543 | 3300006028 | Bacteria | 10036 |
| 78 | Ga0070717_10014967 | 3300006028 | Bacteria | 5975 |
| 79 | Ga0070717_10027456 | 3300006028 | Bacteria | 4549 |
| 80 | Ga0097621_100006367 | 3300006237 | Bacteria | 8377 |
| 81 | Ga0097621_100028661 | 3300006237 | Bacteria | 4389 |
| 82 | Ga0068871_100000253 | 3300006358 | Bacteria | 37196 |
| 83 | Ga0075428_100002855 | 3300006844 | Bacteria | 18850 |
| 84 | Ga0075428_100009299 | 3300006844 | Bacteria | 10896 |
| 85 | Ga0075428_100033212 | 3300006844 | Bacteria | 5698 |
| 86 | Ga0075428_100035766 | 3300006844 | Bacteria | 5474 |
| 87 | Ga0075428_100101398 | 3300006844 | Bacteria | 3138 |
| 88 | Ga0075430_100015398 | 3300006846 | Bacteria | 6510 |
| 89 | Ga0075430_100023004 | 3300006846 | Bacteria | 5301 |
| 90 | Ga0075431_100004329 | 3300006847 | Bacteria | 13908 |
| 91 | Ga0075431_100034745 | 3300006847 | Bacteria | 5193 |
| 92 | Ga0075431_100039943 | 3300006847 | Bacteria | 4834 |
| 93 | Ga0075431_100066089 | 3300006847 | Bacteria | 3733 |
| 94 | Ga0075431_100110291 | 3300006847 | Bacteria | 2840 |
| 95 | Ga0075431_100112534 | 3300006847 | Bacteria | 2809 |
| 96 | Ga0075433_10000529 | 3300006852 | Bacteria | 25025 |
| 97 | Ga0075429_100023778 | 3300006880 | Bacteria | 5317 |
| 98 | Ga0075429_100078947 | 3300006880 | Bacteria | 2869 |
| 99 | Ga0068865_100045773 | 3300006881 | Bacteria | 3000 |
| 100 | Ga0075436_100000719 | 3300006914 | Bacteria | 21903 |
| 101 | Ga0097620_100000936 | 3300006931 | Bacteria | 29958 |
| 102 | Ga0097620_100001959 | 3300006931 | Bacteria | 20995 |
| 103 | Ga0105240_10156405 | 3300009093 | Bacteria | 2710 |
| 104 | Ga0111539_10006878 | 3300009094 | Bacteria | 14609 |
| 105 | Ga0111539_10011499 | 3300009094 | Bacteria | 11106 |
| 106 | Ga0111539_10032030 | 3300009094 | Bacteria | 6386 |
| 107 | Ga0111539_10034408 | 3300009094 | Bacteria | 6143 |
| 108 | Ga0111539_10065307 | 3300009094 | Bacteria | 4300 |
| 109 | Ga0111539_10071355 | 3300009094 | Bacteria | 4098 |
| 110 | Ga0105245_10006689 | 3300009098 | Bacteria | 10115 |
| 111 | Ga0105245_10016567 | 3300009098 | Bacteria | 6431 |
| 112 | Ga0114129_10013951 | 3300009147 | Bacteria | 11448 |
| 113 | Ga0114129_10066600 | 3300009147 | Bacteria | 5024 |
| 114 | Ga0105242_10049773 | 3300009176 | Bacteria | 3411 |
| 115 | Ga0105248_10018994 | 3300009177 | Bacteria | 7600 |
| 116 | Ga0105248_10107396 | 3300009177 | Bacteria | 3147 |
| 117 | Ga0105248_10109179 | 3300009177 | Bacteria | 3119 |
| 118 | Ga0105237_10078621 | 3300009545 | Bacteria | 3288 |
| 119 | Ga0105238_10035493 | 3300009551 | Bacteria | 5069 |
| 120 | Ga0105238_10100470 | 3300009551 | Bacteria | 2876 |
| 121 | Ga0105249_10006028 | 3300009553 | Bacteria | 10505 |
| 122 | Ga0105246_10040231 | 3300011119 | Bacteria | 3154 |
| 123 | Ga0157369_10003210 | 3300013105 | Bacteria | 19502 |
| 124 | Ga0157369_10005783 | 3300013105 | Bacteria | 14375 |
| 125 | Ga0157369_10075723 | 3300013105 | Bacteria | 3607 |
| 126 | Ga0157374_10000866 | 3300013296 | Bacteria | 26455 |
| 127 | Ga0157374_10016268 | 3300013296 | Bacteria | 6536 |
| 128 | Ga0157374_10083403 | 3300013296 | Bacteria | 3036 |
| 129 | Ga0157374_10106643 | 3300013296 | Bacteria | 2692 |
| 130 | Ga0157378_10000055 | 3300013297 | Bacteria | 97875 |
| 131 | Ga0157378_10048885 | 3300013297 | Bacteria | 3762 |
| 132 | Ga0163162_10019681 | 3300013306 | Bacteria | 6626 |
| 133 | Ga0163162_10057398 | 3300013306 | Bacteria | 3921 |
| 134 | Ga0163162_10065164 | 3300013306 | Bacteria | 3690 |
| 135 | Ga0157372_10011593 | 3300013307 | Bacteria | 9381 |
| 136 | Ga0157372_10033187 | 3300013307 | Bacteria | 5668 |
| 137 | Ga0157372_10035179 | 3300013307 | Bacteria | 5512 |
| 138 | Ga0157372_10069450 | 3300013307 | Unclassified | 3962 |
| 139 | Ga0157375_10037090 | 3300013308 | Bacteria | 4668 |
| 140 | Ga0163163_10046809 | 3300014325 | Bacteria | 4249 |
| 141 | Ga0157380_10045455 | 3300014326 | Bacteria | 3446 |
| 142 | Ga0157377_10012525 | 3300014745 | Bacteria | 4268 |
| 143 | Ga0157376_10074488 | 3300014969 | Bacteria | 2894 |
| 144 | Ga0182007_10001064 | 3300015262 | Bacteria | 14967 |
| 145 | Ga0163161_10038535 | 3300017792 | Bacteria | 3429 |
| 146 | Ga0206352_10477980 | 3300020078 | Bacteria | 2841 |
| 147 | Ga0206350_11417348 | 3300020080 | Bacteria | 3175 |
| 148 | Ga0213875_10000598 | 3300021388 | Bacteria | 29178 |
| 149 | Ga0224712_10005520 | 3300022467 | Bacteria | 3530 |
| 150 | Ga0207653_10008147 | 3300025885 | Bacteria | 3266 |
| 151 | Ga0207653_10013701 | 3300025885 | Bacteria | 2540 |
| 152 | Ga0207692_10012148 | 3300025898 | Bacteria | 3690 |
| 153 | Ga0207688_10009600 | 3300025901 | Bacteria | 5268 |
| 154 | Ga0207647_10033172 | 3300025904 | Bacteria | 3308 |
| 155 | Ga0207685_10008450 | 3300025905 | Bacteria | 2933 |
| 156 | Ga0207645_10049761 | 3300025907 | Bacteria | 2676 |
| 157 | Ga0207643_10019878 | 3300025908 | Bacteria | 3682 |
| 158 | Ga0207684_10001711 | 3300025910 | Bacteria | 23277 |
| 159 | Ga0207684_10043264 | 3300025910 | Bacteria | 3818 |
| 160 | Ga0207707_10031257 | 3300025912 | Bacteria | 4658 |
| 161 | Ga0207693_10000838 | 3300025915 | Bacteria | 27394 |
| 162 | Ga0207660_10060808 | 3300025917 | Bacteria | 2717 |
| 163 | Ga0207662_10026561 | 3300025918 | Bacteria | 3339 |
| 164 | Ga0207662_10041057 | 3300025918 | Bacteria | 2722 |
| 165 | Ga0207657_10018627 | 3300025919 | Bacteria | 6619 |
| 166 | Ga0207657_10028499 | 3300025919 | Bacteria | 5093 |
| 167 | Ga0207657_10074648 | 3300025919 | Bacteria | 2862 |
| 168 | Ga0207652_10012617 | 3300025921 | Bacteria | 6830 |
| 169 | Ga0207681_10045549 | 3300025923 | Bacteria | 2946 |
| 170 | Ga0207659_10000352 | 3300025926 | Bacteria | 27474 |
| 171 | Ga0207659_10046527 | 3300025926 | Bacteria | 3064 |
| 172 | Ga0207687_10012059 | 3300025927 | Bacteria | 5652 |
| 173 | Ga0207687_10034630 | 3300025927 | Bacteria | 3429 |
| 174 | Ga0207700_10002166 | 3300025928 | Bacteria | 11253 |
| 175 | Ga0207664_10013575 | 3300025929 | Bacteria | 5853 |
| 176 | Ga0207706_10010700 | 3300025933 | Bacteria | 8379 |
| 177 | Ga0207706_10013201 | 3300025933 | Bacteria | 7515 |
| 178 | Ga0207706_10066421 | 3300025933 | Bacteria | 3174 |
| 179 | Ga0207670_10001229 | 3300025936 | Bacteria | 13534 |
| 180 | Ga0207665_10014205 | 3300025939 | Bacteria | 5239 |
| 181 | Ga0207665_10048416 | 3300025939 | Bacteria | 2853 |
| 182 | Ga0207691_10009484 | 3300025940 | Bacteria | 9347 |
| 183 | Ga0207691_10061378 | 3300025940 | Bacteria | 3415 |
| 184 | Ga0207711_10010318 | 3300025941 | Bacteria | 7759 |
| 185 | Ga0207689_10024087 | 3300025942 | Bacteria | 5106 |
| 186 | Ga0207689_10032849 | 3300025942 | Bacteria | 4313 |
| 187 | Ga0207661_10020316 | 3300025944 | Bacteria | 4962 |
| 188 | Ga0207661_10022053 | 3300025944 | Bacteria | 4787 |
| 189 | Ga0207661_10037297 | 3300025944 | Bacteria | 3800 |
| 190 | Ga0207679_10052834 | 3300025945 | Bacteria | 2982 |
| 191 | Ga0207651_10000325 | 3300025960 | Bacteria | 20441 |
| 192 | Ga0207712_10020307 | 3300025961 | Bacteria | 4349 |
| 193 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 194 | Ga0207703_10014304 | 3300026035 | Bacteria | 6189 |
| 195 | Ga0207678_10018522 | 3300026067 | Bacteria | 6115 |
| 196 | Ga0207678_10023261 | 3300026067 | Bacteria | 5420 |
| 197 | Ga0207678_10061836 | 3300026067 | Bacteria | 3221 |
| 198 | Ga0207708_10003737 | 3300026075 | Bacteria | 11229 |
| 199 | Ga0207708_10009667 | 3300026075 | Bacteria | 7153 |
| 200 | Ga0207702_10003801 | 3300026078 | Bacteria | 13632 |
| 201 | Ga0207648_10003424 | 3300026089 | Bacteria | 16646 |
| 202 | Ga0207648_10060319 | 3300026089 | Bacteria | 3308 |
| 203 | Ga0207674_10000157 | 3300026116 | Bacteria | 80435 |
| 204 | Ga0207674_10016529 | 3300026116 | Bacteria | 8074 |
| 205 | Ga0207674_10027413 | 3300026116 | Bacteria | 6026 |
| 206 | Ga0207675_100011087 | 3300026118 | Bacteria | 8446 |
| 207 | Ga0207675_100070677 | 3300026118 | Bacteria | 3263 |
| 208 | Ga0207675_100079562 | 3300026118 | Bacteria | 3072 |
| 209 | Ga0207683_10000753 | 3300026121 | Bacteria | 29409 |
| 210 | Ga0207698_10062967 | 3300026142 | Bacteria | 2900 |
| 211 | Ga0207428_10004642 | 3300027907 | Bacteria | 13014 |
| 212 | Ga0207428_10009384 | 3300027907 | Bacteria | 8776 |
| 213 | Ga0207428_10035774 | 3300027907 | Bacteria | 4056 |
| 214 | Ga0207428_10079800 | 3300027907 | Bacteria | 2558 |
| 215 | Ga0268266_10001052 | 3300028379 | Bacteria | 34573 |
| 216 | Ga0268265_10010766 | 3300028380 | Bacteria | 6175 |
| 217 | Ga0265338_10002317 | 3300028800 | Bacteria | 28850 |
| 218 | Ga0265338_10007754 | 3300028800 | Bacteria | 13210 |
| 219 | Ga0265338_10047133 | 3300028800 | Bacteria | 3940 |
| 220 | Ga0307513_10046470 | 3300031456 | Bacteria | 4732 |
| 221 | Ga0316579_10003226 | 3300031691 | Bacteria | 6316 |
| 222 | Ga0316579_10009756 | 3300031691 | Bacteria | 4042 |
| 223 | Ga0316579_10012373 | 3300031691 | Bacteria | 3650 |
| 224 | Ga0316579_10022811 | 3300031691 | Bacteria | 2803 |
| 225 | Ga0265314_10003612 | 3300031711 | Bacteria | 14878 |
| 226 | Ga0265342_10011968 | 3300031712 | Bacteria | 5896 |
| 227 | Ga0316576_10048165 | 3300031727 | Bacteria | 3090 |
| 228 | Ga0316576_10055457 | 3300031727 | Bacteria | 2892 |
| 229 | Ga0316576_10065030 | 3300031727 | Bacteria | 2679 |
| 230 | Ga0316578_10006412 | 3300031728 | Bacteria | 5804 |
| 231 | Ga0316578_10033722 | 3300031728 | Bacteria | 2935 |
| 232 | Ga0316577_10001188 | 3300031733 | Bacteria | 12015 |
| 233 | Ga0316577_10009085 | 3300031733 | Bacteria | 5339 |
| 234 | Ga0316577_10014911 | 3300031733 | Bacteria | 4273 |
| 235 | Ga0316577_10032057 | 3300031733 | Bacteria | 2935 |
| 236 | Ga0307410_10009991 | 3300031852 | Bacteria | 5354 |
| 237 | Ga0307409_100007136 | 3300031995 | Bacteria | 6655 |
| 238 | Ga0307416_100005623 | 3300032002 | Bacteria | 7730 |
| 239 | Ga0316583_10015244 | 3300032133 | Bacteria | 2766 |
| 240 | Ga0316585_10010635 | 3300032137 | Bacteria | 2702 |
| 241 | Ga0316586_1000091 | 3300033527 | Bacteria | 6569 |
| 242 | Ga0316587_1000003 | 3300033529 | Bacteria | 13777 |
| 243 | Ga0373950_0000069 | 3300034818 | Bacteria | 53065 |
| 244 | Ga0373926_0001932 | 3300035083 | Bacteria | 6487 |
| 245 | Ga0373934_0007050 | 3300035086 | Bacteria | 4169 |
| 246 | Ga0373934_0012017 | 3300035086 | Bacteria | 3266 |
| 247 | Ga0373934_0015108 | 3300035086 | Bacteria | 2926 |
| 248 | Ga0373923_0001369 | 3300035111 | Bacteria | 6942 |
| 249 | Ga0373923_0012973 | 3300035111 | Bacteria | 3095 |
| 250 | Ga0373923_0013798 | 3300035111 | Bacteria | 3019 |
| 251 | Ga0373936_0000361 | 3300035113 | Bacteria | 15445 |
| 252 | Ga0373936_0000927 | 3300035113 | Bacteria | 10464 |
| 253 | Ga0373936_0016176 | 3300035113 | Bacteria | 2868 |
| 254 | Ga0373945_0000032 | 3300035116 | Bacteria | 28513 |
| 255 | Ga0373945_0001212 | 3300035116 | Bacteria | 7851 |
| 256 | Ga0373953_0001069 | 3300035117 | Bacteria | 7731 |
| 257 | Ga0373954_0008457 | 3300035118 | Bacteria | 4517 |
| 258 | Ga0373954_0015675 | 3300035118 | Bacteria | 3389 |
| 259 | Ga0373954_0021951 | 3300035118 | Bacteria | 2893 |
| 260 | Ga0373956_0002465 | 3300035119 | Bacteria | 7535 |
| 261 | Ga0373956_0018837 | 3300035119 | Bacteria | 2925 |
| 262 | Ga0373957_0001552 | 3300035120 | Bacteria | 6264 |
| 263 | Ga0373943_0000103 | 3300035170 | Bacteria | 30919 |
| 264 | Ga0373943_0002595 | 3300035170 | Bacteria | 8212 |
| 265 | Ga0373946_0000917 | 3300035171 | Bacteria | 10136 |
| 266 | Ga0373946_0001011 | 3300035171 | Bacteria | 9649 |
| 267 | Ga0373946_0001093 | 3300035171 | Bacteria | 9369 |
| 268 | Ga0373955_0005604 | 3300035172 | Bacteria | 5647 |
| 269 | Ga0373955_0015207 | 3300035172 | Bacteria | 3761 |
| 270 | Ga0316574_0000821 | 3300035398 | Bacteria | 13548 |
| 271 | Ga0316574_0005112 | 3300035398 | Bacteria | 6972 |
| 272 | Ga0373924_0004119 | 3300035410 | Bacteria | 5060 |
| 273 | Ga0373924_0011638 | 3300035410 | Bacteria | 3271 |
| 274 | Ga0373931_0009243 | 3300035691 | Bacteria | 4707 |
| 275 | Ga0373931_0037981 | 3300035691 | Bacteria | 2517 |
| 276 | Ga0373935_0000548 | 3300035692 | Bacteria | 19519 |
| 277 | Ga0373935_0005770 | 3300035692 | Bacteria | 7319 |
| 278 | Ga0373935_0012133 | 3300035692 | Bacteria | 5182 |
| 279 | Ga0373935_0015192 | 3300035692 | Bacteria | 4650 |
| 280 | Ga0373927_0003346 | 3300035695 | Bacteria | 11534 |
| 281 | Ga0373927_0004738 | 3300035695 | Bacteria | 9475 |
| 282 | Ga0373933_0008971 | 3300035724 | Bacteria | 5456 |
| 283 | Ga0373933_0031914 | 3300035724 | Bacteria | 3059 |
| 284 | Ga0373947_0000465 | 3300035725 | Bacteria | 23103 |
| 285 | Ga0373947_0002843 | 3300035725 | Bacteria | 10332 |
| 286 | Ga0373947_0004804 | 3300035725 | Bacteria | 7910 |
| 287 | Ga0373947_0019982 | 3300035725 | Bacteria | 3866 |
| 288 | Ga0373937_0007831 | 3300036401 | Bacteria | 9258 |
| 289 | Ga0373937_0014750 | 3300036401 | Bacteria | 6899 |
| 290 | Ga0373937_0024695 | 3300036401 | Bacteria | 5423 |
| 291 | Ga0373937_0042583 | 3300036401 | Bacteria | 4143 |
| 292 | Ga0373937_0057446 | 3300036401 | Bacteria | 3574 |
| 293 | Ga0373937_0098505 | 3300036401 | Bacteria | 2711 |
| 294 | Ga0316582_0001078 | 3300036647 | Bacteria | 11499 |
| 295 | Ga0316582_0005700 | 3300036647 | Bacteria | 6451 |
| 296 | Ga0316582_0005902 | 3300036647 | Bacteria | 6369 |
| 297 | Ga0316582_0030618 | 3300036647 | Bacteria | 3279 |
| 298 | Ga0316582_0046118 | 3300036647 | Bacteria | 2747 |
| 299 | Ga0316584_0001065 | 3300036712 | Bacteria | 16018 |
| 300 | Ga0316584_0008491 | 3300036712 | Bacteria | 7077 |
| 301 | Ga0316584_0020532 | 3300036712 | Bacteria | 4790 |
| 302 | Ga0316584_0020894 | 3300036712 | Bacteria | 4754 |
| 303 | Ga0316584_0024912 | 3300036712 | Bacteria | 4384 |
| 304 | Ga0316584_0032060 | 3300036712 | Bacteria | 3887 |
| 305 | Ga0316584_0041604 | 3300036712 | Bacteria | 3425 |
| 306 | Ga0316584_0046462 | 3300036712 | Bacteria | 3243 |
| 307 | Ga0316584_0056616 | 3300036712 | Bacteria | 2935 |
| 308 | Ga0316584_0067539 | 3300036712 | Bacteria | 2679 |
| 309 | Ga0373925_0000627 | 3300037068 | Bacteria | 33637 |
| 310 | Ga0373925_0002391 | 3300037068 | Bacteria | 15049 |
| 311 | Ga0373925_0005244 | 3300037068 | Bacteria | 9683 |
| 312 | Ga0373925_0005649 | 3300037068 | Bacteria | 9306 |
| 313 | Ga0373925_0028331 | 3300037068 | Bacteria | 4103 |
| 314 | Ga0395900_0009710 | 3300037418 | Bacteria | 9860 |
| 315 | Ga0395898_0025637 | 3300037466 | Bacteria | 5939 |
| 316 | Ga0395898_0074662 | 3300037466 | Bacteria | 3275 |
| 317 | Ga0436364_0170857 | 3300037853 | Bacteria | 27986 |
| 318 | Ga0395901_0009967 | 3300038443 | Bacteria | 9630 |
| 319 | Ga0436361_0354204 | 3300039447 | Bacteria | 9258 |
| 320 | Ga0436361_1141966 | 3300039447 | Bacteria | 4389 |
| 321 | Ga0450903_000162 | 3300042138 | Bacteria | 14681 |
| 322 | Ga0439458_0001019 | 3300042157 | Bacteria | 7143 |
| 323 | Ga0451577_0009950 | 3300042876 | Bacteria | 9115 |
| 324 | Ga0453684_0029356 | 3300044712 | Bacteria | 7811 |
| 325 | Ga0453684_0147886 | 3300044712 | Bacteria | 2796 |
| 326 | Ga0495592_0005024 | 3300046454 | Bacteria | 9726 |
| 327 | Ga0495592_0026998 | 3300046454 | Bacteria | 4353 |
| 328 | Ga0495592_0055989 | 3300046454 | Bacteria | 2915 |
| 329 | Ga0495603_0000941 | 3300046455 | Bacteria | 16746 |
| 330 | Ga0495629_0004422 | 3300046459 | Bacteria | 10527 |
| 331 | Ga0495629_0024620 | 3300046459 | Bacteria | 4285 |
| 332 | Ga0495641_0003706 | 3300046461 | Bacteria | 11253 |
| 333 | Ga0495651_0001645 | 3300046462 | Bacteria | 17321 |
| 334 | Ga0495651_0001800 | 3300046462 | Bacteria | 16525 |
| 335 | Ga0495651_0017304 | 3300046462 | Bacteria | 5584 |
| 336 | Ga0495651_0023982 | 3300046462 | Bacteria | 4746 |
| 337 | Ga0495651_0024096 | 3300046462 | Bacteria | 4735 |
| 338 | Ga0495651_0025013 | 3300046462 | Bacteria | 4645 |
| 339 | Ga0495651_0026403 | 3300046462 | Bacteria | 4523 |
| 340 | Ga0495651_0062474 | 3300046462 | Bacteria | 2849 |
| 341 | Ga0495651_0079391 | 3300046462 | Bacteria | 2480 |
| 342 | Ga0495653_0005136 | 3300046463 | Bacteria | 10626 |
| 343 | Ga0495653_0010357 | 3300046463 | Bacteria | 7627 |
| 344 | Ga0495653_0014179 | 3300046463 | Bacteria | 6497 |
| 345 | Ga0495653_0043294 | 3300046463 | Bacteria | 3501 |
| 346 | Ga0495653_0052781 | 3300046463 | Bacteria | 3114 |
| 347 | Ga0495653_0056959 | 3300046463 | Bacteria | 2978 |
| 348 | Ga0495653_0060768 | 3300046463 | Bacteria | 2861 |
| 349 | Ga0495580_0005623 | 3300046472 | Bacteria | 10319 |
| 350 | Ga0495582_0001230 | 3300046473 | Bacteria | 14429 |
| 351 | Ga0495605_0024457 | 3300046474 | Bacteria | 3160 |
| 352 | Ga0495639_0001312 | 3300046475 | Bacteria | 11172 |
| 353 | Ga0495662_0001043 | 3300046476 | Bacteria | 13603 |
| 354 | Ga0495662_0003567 | 3300046476 | Bacteria | 7859 |
| 355 | Ga0495662_0006219 | 3300046476 | Bacteria | 5970 |
| 356 | Ga0495664_0000761 | 3300046477 | Bacteria | 16520 |
| 357 | Ga0495664_0003660 | 3300046477 | Bacteria | 8375 |
| 358 | Ga0495664_0007410 | 3300046477 | Bacteria | 6092 |
| 359 | Ga0495664_0016782 | 3300046477 | Bacteria | 4178 |
| 360 | Ga0495584_0026193 | 3300046491 | Bacteria | 2954 |
| 361 | Ga0495608_0002010 | 3300046511 | Bacteria | 14566 |
| 362 | Ga0495608_0018430 | 3300046511 | Bacteria | 4815 |
| 363 | Ga0495608_0047302 | 3300046511 | Bacteria | 2860 |
| 364 | Ga0495608_0049092 | 3300046511 | Bacteria | 2802 |
| 365 | Ga0495610_0000629 | 3300046512 | Bacteria | 34679 |
| 366 | Ga0495618_0007784 | 3300046514 | Bacteria | 6483 |
| 367 | Ga0495618_0016583 | 3300046514 | Bacteria | 4509 |
| 368 | Ga0495618_0027014 | 3300046514 | Bacteria | 3572 |
| 369 | Ga0495628_0010793 | 3300046516 | Bacteria | 7736 |
| 370 | Ga0495628_0013266 | 3300046516 | Bacteria | 6930 |
| 371 | Ga0495628_0016463 | 3300046516 | Bacteria | 6168 |
| 372 | Ga0495628_0022603 | 3300046516 | Bacteria | 5165 |
| 373 | Ga0495628_0043484 | 3300046516 | Bacteria | 3578 |
| 374 | Ga0495628_0053278 | 3300046516 | Bacteria | 3193 |
| 375 | Ga0495628_0070497 | 3300046516 | Bacteria | 2725 |
| 376 | Ga0495628_0089710 | 3300046516 | Bacteria | 2380 |
| 377 | Ga0495630_0001346 | 3300046517 | Bacteria | 16892 |
| 378 | Ga0495630_0004983 | 3300046517 | Bacteria | 9341 |
| 379 | Ga0495630_0028680 | 3300046517 | Bacteria | 4135 |
| 380 | Ga0495631_0000128 | 3300046518 | Bacteria | 51035 |
| 381 | Ga0495666_0014542 | 3300046526 | Bacteria | 3919 |
| 382 | Ga0495652_0004310 | 3300046529 | Bacteria | 13634 |
| 383 | Ga0495652_0007220 | 3300046529 | Bacteria | 10257 |
| 384 | Ga0495652_0007693 | 3300046529 | Bacteria | 9924 |
| 385 | Ga0495652_0009522 | 3300046529 | Bacteria | 8823 |
| 386 | Ga0495652_0024480 | 3300046529 | Bacteria | 5343 |
| 387 | Ga0495652_0043361 | 3300046529 | Bacteria | 3875 |
| 388 | Ga0495652_0056255 | 3300046529 | Bacteria | 3341 |
| 389 | Ga0495652_0070680 | 3300046529 | Bacteria | 2916 |
| 390 | Ga0495665_0003786 | 3300046531 | Bacteria | 8187 |
| 391 | Ga0495640_0007342 | 3300046533 | Bacteria | 8673 |
| 392 | Ga0495640_0014231 | 3300046533 | Bacteria | 6029 |
| 393 | Ga0495640_0020145 | 3300046533 | Bacteria | 4913 |
| 394 | Ga0495640_0065056 | 3300046533 | Bacteria | 2464 |
| 395 | Ga0495586_0001077 | 3300046535 | Bacteria | 15418 |
| 396 | Ga0495587_0005544 | 3300046536 | Bacteria | 8234 |
| 397 | Ga0495587_0014673 | 3300046536 | Bacteria | 4908 |
| 398 | Ga0495587_0017801 | 3300046536 | Bacteria | 4407 |
| 399 | Ga0495587_0021370 | 3300046536 | Bacteria | 3990 |
| 400 | Ga0495645_0002041 | 3300046543 | Bacteria | 13736 |
| 401 | Ga0495645_0005227 | 3300046543 | Bacteria | 8891 |
| 402 | Ga0495645_0014927 | 3300046543 | Bacteria | 5519 |
| 403 | Ga0495645_0039741 | 3300046543 | Bacteria | 3430 |
| 404 | Ga0495645_0056507 | 3300046543 | Bacteria | 2849 |
| 405 | Ga0495645_0057783 | 3300046543 | Bacteria | 2815 |
| 406 | Ga0495645_0061733 | 3300046543 | Bacteria | 2715 |
| 407 | Ga0495645_0091453 | 3300046543 | Bacteria | 2173 |
| 408 | Ga0495667_0003307 | 3300046559 | Bacteria | 10801 |
| 409 | Ga0495667_0008323 | 3300046559 | Bacteria | 7033 |
| 410 | Ga0495667_0011984 | 3300046559 | Bacteria | 5873 |
| 411 | Ga0495667_0013524 | 3300046559 | Bacteria | 5521 |
| 412 | Ga0495667_0021185 | 3300046559 | Bacteria | 4385 |
| 413 | Ga0495667_0045309 | 3300046559 | Bacteria | 2912 |
| 414 | Ga0495634_0016884 | 3300046642 | Bacteria | 5214 |
| 415 | Ga0495634_0025925 | 3300046642 | Bacteria | 4095 |
| 416 | Ga0495634_0050850 | 3300046642 | Bacteria | 2781 |
| 417 | Ga0495625_0021732 | 3300046660 | Bacteria | 4932 |
| 418 | Ga0495635_0001088 | 3300046663 | Bacteria | 18033 |
| 419 | Ga0495635_0004406 | 3300046663 | Bacteria | 9750 |
| 420 | Ga0495635_0004997 | 3300046663 | Bacteria | 9231 |
| 421 | Ga0495635_0059305 | 3300046663 | Bacteria | 2631 |
| 422 | Ga0495588_0004318 | 3300046674 | Bacteria | 6273 |
| 423 | Ga0495657_0007137 | 3300046675 | Bacteria | 8668 |
| 424 | Ga0495657_0011422 | 3300046675 | Bacteria | 6638 |
| 425 | Ga0495657_0012426 | 3300046675 | Bacteria | 6328 |
| 426 | Ga0495657_0014136 | 3300046675 | Bacteria | 5866 |
| 427 | Ga0495657_0024848 | 3300046675 | Bacteria | 4260 |
| 428 | Ga0495657_0051695 | 3300046675 | Bacteria | 2758 |
| 429 | Ga0495599_0004643 | 3300046678 | Bacteria | 8142 |
| 430 | Ga0495599_0005968 | 3300046678 | Bacteria | 7326 |
| 431 | Ga0495599_0010765 | 3300046678 | Bacteria | 5604 |
| 432 | Ga0495599_0031390 | 3300046678 | Bacteria | 3334 |
| 433 | Ga0495599_0037849 | 3300046678 | Bacteria | 3030 |
| 434 | Ga0495623_0002925 | 3300046679 | Bacteria | 11235 |
| 435 | Ga0495623_0010659 | 3300046679 | Bacteria | 5950 |
| 436 | Ga0495623_0038340 | 3300046679 | Bacteria | 3064 |
| 437 | Ga0495646_0004883 | 3300046680 | Bacteria | 8474 |
| 438 | Ga0495646_0027356 | 3300046680 | Bacteria | 3578 |
| 439 | Ga0495646_0030454 | 3300046680 | Bacteria | 3370 |
| 440 | Ga0495646_0036671 | 3300046680 | Bacteria | 3036 |
| 441 | Ga0495658_0002221 | 3300046683 | Bacteria | 9815 |
| 442 | Ga0495658_0049084 | 3300046683 | Bacteria | 2383 |
| 443 | Ga0495669_0001066 | 3300046684 | Bacteria | 11426 |
| 444 | Ga0495613_0000186 | 3300046689 | Bacteria | 60855 |
| 445 | Ga0495613_0016139 | 3300046689 | Bacteria | 5561 |
| 446 | Ga0495613_0016140 | 3300046689 | Bacteria | 5561 |
| 447 | Ga0495613_0020710 | 3300046689 | Bacteria | 4903 |
| 448 | Ga0495613_0021842 | 3300046689 | Bacteria | 4770 |
| 449 | Ga0495624_0004980 | 3300046690 | Bacteria | 9622 |
| 450 | Ga0495624_0005812 | 3300046690 | Bacteria | 8833 |
| 451 | Ga0495624_0009110 | 3300046690 | Bacteria | 6883 |
| 452 | Ga0495600_0014104 | 3300046809 | Bacteria | 5033 |
| 453 | Ga0495600_0027959 | 3300046809 | Bacteria | 3647 |
| 454 | Ga0495600_0039226 | 3300046809 | Bacteria | 3084 |
| 455 | Ga0495600_0040468 | 3300046809 | Bacteria | 3035 |
| 456 | Ga0495581_0010322 | 3300047315 | Bacteria | 5402 |
| 457 | Ga0495581_0056615 | 3300047315 | Bacteria | 2263 |
| 458 | Ga0495604_0008396 | 3300047317 | Bacteria | 8165 |
| 459 | Ga0495604_0018054 | 3300047317 | Bacteria | 5645 |
| 460 | Ga0495604_0046444 | 3300047317 | Bacteria | 3385 |
| 461 | Ga0495604_0057480 | 3300047317 | Bacteria | 2990 |
| 462 | Ga0495604_0060091 | 3300047317 | Bacteria | 2911 |
| 463 | Ga0495604_0060432 | 3300047317 | Bacteria | 2902 |
| 464 | Ga0495636_0005100 | 3300047318 | Bacteria | 5159 |
| 465 | Ga0495636_0009113 | 3300047318 | Bacteria | 3903 |
| 466 | Ga0495674_0002225 | 3300047319 | Bacteria | 19082 |
| 467 | Ga0495674_0018508 | 3300047319 | Bacteria | 6483 |
| 468 | Ga0495674_0018687 | 3300047319 | Bacteria | 6451 |
| 469 | Ga0495674_0027551 | 3300047319 | Bacteria | 5191 |
| 470 | Ga0495674_0059154 | 3300047319 | Bacteria | 3348 |
| 471 | Ga0495674_0074365 | 3300047319 | Bacteria | 2926 |
| 472 | Ga0495672_0001313 | 3300047320 | Bacteria | 24742 |
| 473 | Ga0495672_0008531 | 3300047320 | Bacteria | 7545 |
| 474 | Ga0495676_0002295 | 3300047321 | Bacteria | 16971 |
| 475 | Ga0495676_0006872 | 3300047321 | Bacteria | 10455 |
| 476 | Ga0495680_0001811 | 3300047322 | Bacteria | 22577 |
| 477 | Ga0495680_0007420 | 3300047322 | Bacteria | 10056 |
| 478 | Ga0495680_0009933 | 3300047322 | Bacteria | 8523 |
| 479 | Ga0495680_0018104 | 3300047322 | Bacteria | 5993 |
| 480 | Ga0495680_0043579 | 3300047322 | Bacteria | 3551 |
| 481 | Ga0495680_0056683 | 3300047322 | Bacteria | 3032 |
| 482 | Ga0495675_0000906 | 3300047444 | Bacteria | 18066 |
| 483 | Ga0495675_0008557 | 3300047444 | Bacteria | 6343 |
| 484 | Ga0495675_0042438 | 3300047444 | Bacteria | 2897 |
| 485 | Ga0495684_0000188 | 3300047471 | Bacteria | 47553 |
| 486 | Ga0495684_0001074 | 3300047471 | Bacteria | 22115 |
| 487 | Ga0495684_0004585 | 3300047471 | Bacteria | 10798 |
| 488 | Ga0495684_0048159 | 3300047471 | Bacteria | 3259 |
| 489 | Ga0495684_0068454 | 3300047471 | Bacteria | 2699 |
| 490 | Ga0495686_0000028 | 3300047472 | Bacteria | 369493 |
| 491 | Ga0495593_0005162 | 3300047673 | Bacteria | 7718 |
| 492 | Ga0495593_0012898 | 3300047673 | Bacteria | 4774 |
| 493 | Ga0495602_0007364 | 3300048088 | Bacteria | 11524 |
| 494 | Ga0495602_0014255 | 3300048088 | Bacteria | 8076 |
| 495 | Ga0495602_0034829 | 3300048088 | Bacteria | 4703 |
| 496 | Ga0495602_0042848 | 3300048088 | Bacteria | 4120 |
| 497 | Ga0495602_0043819 | 3300048088 | Bacteria | 4063 |
| 498 | Ga0495602_0062237 | 3300048088 | Bacteria | 3238 |
| 499 | Ga0495602_0073782 | 3300048088 | Bacteria | 2902 |
| 500 | Ga0496101_0001239 | 3300048904 | Bacteria | 15256 |
| 501 | Ga0496101_0021984 | 3300048904 | Bacteria | 4386 |
| 502 | Ga0496102_0148001 | 3300048905 | Bacteria | 2205 |
| 503 | Ga0496103_0014872 | 3300048906 | Bacteria | 4626 |
| 504 | Ga0496104_0053464 | 3300048907 | Bacteria | 3816 |
| 505 | Ga0496104_0113027 | 3300048907 | Bacteria | 2604 |
| 506 | Ga0496105_0010325 | 3300048908 | Bacteria | 7341 |
| 507 | Ga0496105_0023239 | 3300048908 | Bacteria | 5027 |
| 508 | Ga0496106_0002244 | 3300048909 | Bacteria | 14403 |
| 509 | Ga0496106_0035570 | 3300048909 | Bacteria | 3724 |
| 510 | Ga0496107_0001051 | 3300048910 | Bacteria | 16518 |
| 511 | Ga0496107_0043208 | 3300048910 | Bacteria | 3237 |
| 512 | Ga0496107_0078279 | 3300048910 | Bacteria | 2409 |
| 513 | Ga0496108_0019058 | 3300048911 | Bacteria | 5629 |
| 514 | Ga0496108_0028739 | 3300048911 | Bacteria | 4600 |
| 515 | Ga0496108_0069198 | 3300048911 | Bacteria | 2978 |
| 516 | Ga0496108_0099549 | 3300048911 | Bacteria | 2478 |
| 517 | Ga0496109_0000005 | 3300048912 | Bacteria | 358226 |
| 518 | Ga0496109_0001161 | 3300048912 | Bacteria | 21914 |
| 519 | Ga0496109_0009390 | 3300048912 | Bacteria | 8335 |
| 520 | Ga0496109_0033920 | 3300048912 | Bacteria | 4594 |
| 521 | Ga0496109_0034535 | 3300048912 | Bacteria | 4556 |
| 522 | Ga0496109_0064028 | 3300048912 | Bacteria | 3364 |
| 523 | Ga0496110_0006046 | 3300048913 | Bacteria | 9540 |
| 524 | Ga0496110_0011606 | 3300048913 | Bacteria | 7222 |
| 525 | Ga0496110_0041509 | 3300048913 | Bacteria | 4015 |
| 526 | Ga0496111_0018069 | 3300048914 | Bacteria | 4878 |
| 527 | Ga0496111_0027417 | 3300048914 | Bacteria | 4029 |
| 528 | Ga0496111_0037576 | 3300048914 | Bacteria | 3465 |
| 529 | Ga0496112_0020586 | 3300048915 | Bacteria | 6255 |
| 530 | Ga0496114_0000918 | 3300048917 | Bacteria | 22085 |
| 531 | Ga0496114_0001433 | 3300048917 | Bacteria | 18080 |
| 532 | Ga0496114_0003147 | 3300048917 | Bacteria | 12672 |
| 533 | Ga0496114_0029213 | 3300048917 | Bacteria | 4529 |
| 534 | Ga0496114_0079763 | 3300048917 | Bacteria | 2764 |
| 535 | Ga0496115_0002106 | 3300048918 | Bacteria | 14243 |
| 536 | Ga0496115_0012185 | 3300048918 | Bacteria | 6466 |
| 537 | Ga0496115_0039808 | 3300048918 | Bacteria | 3734 |
| 538 | Ga0496117_0014433 | 3300048920 | Bacteria | 6806 |
| 539 | Ga0496118_0000940 | 3300048921 | Bacteria | 45474 |
| 540 | Ga0496118_0002837 | 3300048921 | Bacteria | 22651 |
| 541 | Ga0496121_0000075 | 3300048924 | Bacteria | 240437 |
| 542 | Ga0496121_0000832 | 3300048924 | Bacteria | 56038 |
| 543 | Ga0496126_0037531 | 3300048929 | Bacteria | 4520 |
| 544 | Ga0501031_0002727 | 3300049568 | Bacteria | 11246 |
| 545 | Ga0501031_0027545 | 3300049568 | Bacteria | 3705 |
| 546 | Ga0501032_0014186 | 3300049569 | Bacteria | 5645 |
| 547 | Ga0501033_0000598 | 3300049570 | Bacteria | 33419 |
| 548 | Ga0501033_0048010 | 3300049570 | Bacteria | 3173 |
| 549 | Ga0501036_0000758 | 3300049572 | Bacteria | 23921 |
| 550 | Ga0501036_0051435 | 3300049572 | Bacteria | 3488 |
| 551 | Ga0501037_0006192 | 3300049573 | Bacteria | 8751 |
| 552 | Ga0501037_0015050 | 3300049573 | Bacteria | 5690 |
| 553 | Ga0501038_0019390 | 3300049574 | Bacteria | 6132 |
| 554 | Ga0501038_0022865 | 3300049574 | Bacteria | 5596 |
| 555 | Ga0501038_0051560 | 3300049574 | Bacteria | 3550 |
| 556 | Ga0501039_0011531 | 3300049575 | Bacteria | 6727 |
| 557 | Ga0501039_0024275 | 3300049575 | Bacteria | 4655 |
| 558 | Ga0501039_0031177 | 3300049575 | Bacteria | 4110 |
| 559 | Ga0501039_0037356 | 3300049575 | Bacteria | 3748 |
| 560 | Ga0501039_0049886 | 3300049575 | Bacteria | 3237 |
| 561 | Ga0501040_0001705 | 3300049576 | Bacteria | 14074 |
| 562 | Ga0501040_0007388 | 3300049576 | Bacteria | 7114 |
| 563 | Ga0501040_0014793 | 3300049576 | Bacteria | 5149 |
| 564 | Ga0501041_0000634 | 3300049577 | Bacteria | 18382 |
| 565 | Ga0501041_0007349 | 3300049577 | Bacteria | 6467 |
| 566 | Ga0501041_0042856 | 3300049577 | Bacteria | 2751 |
| 567 | Ga0501042_0000943 | 3300049578 | Bacteria | 16364 |
| 568 | Ga0501042_0001500 | 3300049578 | Bacteria | 13790 |
| 569 | Ga0501042_0001544 | 3300049578 | Bacteria | 13640 |
| 570 | Ga0501042_0005061 | 3300049578 | Bacteria | 8459 |
| 571 | Ga0501046_0000002 | 3300049580 | Bacteria | 526908 |
| 572 | Ga0501046_0001656 | 3300049580 | Bacteria | 21290 |
| 573 | Ga0501046_0027373 | 3300049580 | Bacteria | 4651 |
| 574 | Ga0501046_0029356 | 3300049580 | Bacteria | 4470 |
| 575 | Ga0501047_0004836 | 3300049581 | Bacteria | 12660 |
| 576 | Ga0501047_0094361 | 3300049581 | Bacteria | 2871 |
| 577 | Ga0501048_0003340 | 3300049582 | Bacteria | 12207 |
| 578 | Ga0501048_0024298 | 3300049582 | Bacteria | 4424 |
| 579 | Ga0501067_0000024 | 3300049583 | Bacteria | 92998 |
| 580 | Ga0501067_0000851 | 3300049583 | Bacteria | 16470 |
| 581 | Ga0501067_0005568 | 3300049583 | Bacteria | 6982 |
| 582 | Ga0501067_0018664 | 3300049583 | Bacteria | 3839 |
| 583 | Ga0501068_0001402 | 3300049584 | Bacteria | 12816 |
| 584 | Ga0501068_0049291 | 3300049584 | Bacteria | 2543 |
| 585 | Ga0501068_0050645 | 3300049584 | Bacteria | 2510 |
| 586 | Ga0501069_0008019 | 3300049585 | Bacteria | 5548 |
| 587 | Ga0501070_0000023 | 3300049586 | Bacteria | 164053 |
| 588 | Ga0501070_0010567 | 3300049586 | Bacteria | 7802 |
| 589 | Ga0501070_0017550 | 3300049586 | Bacteria | 6008 |
| 590 | Ga0501071_0004627 | 3300049587 | Bacteria | 8733 |
| 591 | Ga0501071_0005165 | 3300049587 | Bacteria | 8362 |
| 592 | Ga0501071_0018933 | 3300049587 | Bacteria | 4776 |
| 593 | Ga0501071_0026278 | 3300049587 | Bacteria | 4085 |
| 594 | Ga0501071_0043336 | 3300049587 | Bacteria | 3226 |
| 595 | Ga0501072_0000151 | 3300049588 | Bacteria | 51318 |
| 596 | Ga0501072_0027592 | 3300049588 | Bacteria | 4429 |
| 597 | Ga0501072_0036350 | 3300049588 | Bacteria | 3861 |
| 598 | Ga0501073_0000133 | 3300049589 | Bacteria | 47997 |
| 599 | Ga0501073_0006162 | 3300049589 | Bacteria | 8951 |
| 600 | Ga0501073_0014038 | 3300049589 | Bacteria | 5819 |
| 601 | Ga0501073_0015450 | 3300049589 | Bacteria | 5538 |
| 602 | Ga0501073_0037676 | 3300049589 | Bacteria | 3432 |
| 603 | Ga0501074_0012281 | 3300049590 | Bacteria | 6226 |
| 604 | Ga0501075_0002274 | 3300049591 | Bacteria | 12729 |
| 605 | Ga0501075_0007557 | 3300049591 | Bacteria | 7542 |
| 606 | Ga0501076_0002173 | 3300049592 | Bacteria | 13461 |
| 607 | Ga0501076_0005860 | 3300049592 | Bacteria | 8861 |
| 608 | Ga0501076_0010254 | 3300049592 | Bacteria | 6946 |
| 609 | Ga0501076_0068385 | 3300049592 | Bacteria | 2837 |
| 610 | Ga0501077_0002347 | 3300049593 | Bacteria | 11406 |
| 611 | Ga0501077_0005240 | 3300049593 | Bacteria | 7874 |
| 612 | Ga0501077_0010438 | 3300049593 | Bacteria | 5780 |
| 613 | Ga0501079_0001676 | 3300049741 | Bacteria | 15754 |
| 614 | Ga0501079_0001707 | 3300049741 | Bacteria | 15660 |
| 615 | Ga0501079_0003211 | 3300049741 | Bacteria | 11970 |
| 616 | Ga0501080_0002849 | 3300049742 | Bacteria | 15205 |
| 617 | Ga0501080_0017775 | 3300049742 | Bacteria | 6581 |
| 618 | Ga0501080_0023887 | 3300049742 | Bacteria | 5666 |
| 619 | Ga0501081_0003137 | 3300049743 | Bacteria | 10506 |
| 620 | Ga0501081_0005227 | 3300049743 | Bacteria | 8359 |
| 621 | Ga0501083_0011387 | 3300049744 | Bacteria | 6240 |
| 622 | Ga0501035_0000006 | 3300049822 | Bacteria | 369040 |
| 623 | Ga0501035_0000136 | 3300049822 | Bacteria | 89432 |
| 624 | Ga0501035_0010681 | 3300049822 | Bacteria | 8500 |
| 625 | Ga0501035_0057370 | 3300049822 | Bacteria | 3472 |
| 626 | Ga0501045_0003406 | 3300049824 | Bacteria | 10884 |
| 627 | Ga0501045_0042794 | 3300049824 | Bacteria | 3297 |
| 628 | Ga0501045_0055429 | 3300049824 | Bacteria | 2899 |
| 629 | nmdc:mga05p37_121606_c1 | 3300050507 | Bacteria | 3207 |
| 630 | nmdc:mga05p37_169477_c1 | 3300050507 | Bacteria | 2664 |
| 631 | nmdc:mga05p37_203931_c1 | 3300050507 | Bacteria | 2393 |
| 632 | nmdc:mga05p37_210_c1 | 3300050507 | Bacteria | 58879 |
| 633 | nmdc:mga05p37_28942_c1 | 3300050507 | Bacteria | 6759 |
| 634 | nmdc:mga05p37_47491_c1 | 3300050507 | Bacteria | 5280 |
| 635 | nmdc:mga09592_21156_c1 | 3300050508 | Bacteria | 5359 |
| 636 | nmdc:mga09592_67342_c1 | 3300050508 | Bacteria | 3037 |
| 637 | nmdc:mga0qj67_43541_c1 | 3300050509 | Bacteria | 3535 |
| 638 | nmdc:mga06r32_108209_c1 | 3300050510 | Bacteria | 2733 |
| 639 | nmdc:mga06r32_14946_c1 | 3300050510 | Bacteria | 7045 |
| 640 | nmdc:mga06r32_2687_c1 | 3300050510 | Bacteria | 15914 |
| 641 | nmdc:mga06r32_51744_c1 | 3300050510 | Bacteria | 3931 |
| 642 | nmdc:mga08y16_11062_c1 | 3300050511 | Bacteria | 9474 |
| 643 | nmdc:mga08y16_121958_c1 | 3300050511 | Bacteria | 2713 |
| 644 | nmdc:mga08y16_34082_c1 | 3300050511 | Bacteria | 5348 |
| 645 | nmdc:mga08y16_36998_c1 | 3300050511 | Bacteria | 5126 |
| 646 | nmdc:mga08y16_3801_c1 | 3300050511 | Bacteria | 15723 |
| 647 | nmdc:mga08y16_6452_c1 | 3300050511 | Bacteria | 12303 |
| 648 | nmdc:mga08y16_66397_c1 | 3300050511 | Bacteria | 3765 |
| 649 | nmdc:mga0rr50_38024_c1 | 3300050513 | Bacteria | 3479 |
| 650 | nmdc:mga08x19_5857_c1 | 3300050514 | Bacteria | 7276 |
| 651 | nmdc:mga0a205_70053_c1 | 3300050515 | Bacteria | 3386 |
| 652 | Ga0495601_0005809 | 3300053077 | Bacteria | 7194 |
| 653 | Ga0495601_0006218 | 3300053077 | Bacteria | 6974 |
| 654 | Ga0495601_0036144 | 3300053077 | Bacteria | 3084 |
| 655 | Ga0500635_0000696 | 3300053080 | Bacteria | 8511 |
| 656 | Ga0495619_0009606 | 3300053085 | Bacteria | 6100 |
| 657 | Ga0500643_005913 | 3300053087 | Bacteria | 5189 |
| 658 | Ga0500616_0001539 | 3300053153 | Bacteria | 21684 |
| 659 | Ga0501084_0000172 | 3300054114 | Bacteria | 50211 |
| 660 | Ga0501084_0000885 | 3300054114 | Bacteria | 23177 |
| 661 | Ga0501084_0001208 | 3300054114 | Bacteria | 20262 |
| 662 | Ga0501084_0013944 | 3300054114 | Bacteria | 6652 |
| 663 | Ga0501082_0002146 | 3300060353 | Bacteria | 17290 |
| 664 | Ga0501082_0013628 | 3300060353 | Bacteria | 6987 |
| 665 | Ga0501082_0014422 | 3300060353 | Bacteria | 6801 |
| 666 | Ga0501082_0022512 | 3300060353 | Bacteria | 5427 |
| 667 | Ga0501082_0111929 | 3300060353 | Bacteria | 2363 |
| 668 | Ga0530510_0000312 | 3300061734 | Bacteria | 31116 |
| 669 | Ga0530510_0000554 | 3300061734 | Bacteria | 24110 |
| 670 | Ga0530510_0013127 | 3300061734 | Bacteria | 5827 |
| 671 | Ga0530510_0019432 | 3300061734 | Bacteria | 4822 |
| 672 | Ga0530510_0021465 | 3300061734 | Bacteria | 4594 |
| 673 | Ga0530510_0024686 | 3300061734 | Bacteria | 4293 |
| 674 | Ga0530510_0059522 | 3300061734 | Bacteria | 2763 |
| 675 | Ga0530510_0062280 | 3300061734 | Bacteria | 2700 |
| 676 | Ga0530510_0073023 | 3300061734 | Bacteria | 2490 |
| 677 | 2506867855 | 2506783011 | Bacteria | 5323186 |
| 678 | 2644085380 | 2643221614 | Bacteria | 4260023 |
| 679 | 2644085609 | 2643221614 | Bacteria | 4260023 |
| 680 | 2644342932 | 2643221661 | Bacteria | 4267604 |
| 681 | 2644343160 | 2643221661 | Bacteria | 4267604 |
| 682 | 2644366232 | 2643221666 | Bacteria | 4265935 |
| 683 | 2644366460 | 2643221666 | Bacteria | 4265935 |
| 684 | 2808873197 | 2808606365 | Bacteria | 4301966 |
| 685 | 2837270096 | 2837268691 | Bacteria | 7850704 |
| 686 | 2902815151 | 2902810491 | Bacteria | 6794147 |
| 687 | 2913915778 | 2913912277 | Bacteria | 9037797 |
| 688 | 2913940840 | 2913939268 | Bacteria | 8559644 |
| 689 | 2941474835 | 2941471342 | Bacteria | 5018624 |
| 690 | Ga0081455_10054109 | |||
| 691 | rootH2_10025454 | |||
| 692 | rootH2_10046278 | |||
| 693 | Ga0058859_11775670 | |||
| 694 | Ga0058863_10064911 | |||
| 695 | Ga0058861_10058546 | |||
| 696 | Ga0070683_100000398 | |||
| 697 | Ga0070683_100003404 | |||
| 698 | Ga0070683_100019126 | |||
| 699 | Ga0070690_100002286 | |||
| 700 | Ga0070670_100025737 | |||
| 701 | Ga0068869_100021281 | |||
| 702 | Ga0070682_100003587 | |||
| 703 | Ga0068868_100013366 | |||
| 704 | Ga0068868_100017457 | |||
| 705 | Ga0070660_100029140 | |||
| 706 | Ga0070689_100005448 | |||
| 707 | Ga0070689_100041376 | |||
| 708 | Ga0070691_10003152 | |||
| 709 | Ga0070691_10007041 | |||
| 710 | Ga0070668_100000255 | |||
| 711 | Ga0070668_100050706 | |||
| 712 | Ga0070675_100000097 | |||
| 713 | Ga0070675_100000719 | |||
| 714 | Ga0070671_100010861 | |||
| 715 | Ga0070674_100013233 | |||
| 716 | Ga0070673_100029171 | |||
| 717 | Ga0070659_100082777 | |||
| 718 | Ga0070709_10010770 | |||
| 719 | Ga0070714_100022286 | |||
| 720 | Ga0070713_100017062 | |||
| 721 | Ga0070700_100033940 | |||
| 722 | Ga0070694_100029291 | |||
| 723 | Ga0070662_100039741 | |||
| 724 | Ga0070681_10033372 | |||
| 725 | Ga0070681_10036963 | |||
| 726 | Ga0070706_100001143 | |||
| 727 | Ga0070707_100044010 | |||
| 728 | Ga0070698_100017650 | |||
| 729 | Ga0070698_100050583 | |||
| 730 | Ga0070699_100008113 | |||
| 731 | Ga0070684_100000462 | |||
| 732 | Ga0070684_100000509 | |||
| 733 | Ga0070684_100004354 | |||
| 734 | Ga0070697_100006229 | |||
| 735 | Ga0068853_100085658 | |||
| 736 | Ga0070686_100029498 | |||
| 737 | Ga0070665_100000441 | |||
| 738 | Ga0070704_100007965 | |||
| 739 | Ga0070664_100007124 | |||
| 740 | Ga0070664_100017718 | |||
| 741 | Ga0070664_100033555 | |||
| 742 | Ga0068857_100000264 | |||
| 743 | Ga0068856_100002050 | |||
| 744 | Ga0068856_100003948 | |||
| 745 | Ga0070702_100009777 | |||
| 746 | Ga0068852_100082309 | |||
| 747 | Ga0068859_100000936 | |||
| 748 | Ga0068859_100001959 | |||
| 749 | Ga0068864_100009009 | |||
| 750 | Ga0068861_100034146 | |||
| 751 | Ga0068861_100048611 | |||
| 752 | Ga0068858_100062699 | |||
| 753 | Ga0068860_100004148 | |||
| 754 | Ga0068862_100008662 | |||
| 755 | Ga0068862_100041752 | |||
| 756 | Ga0081455_10002341 | |||
| 757 | Ga0081455_10004533 | |||
| 758 | Ga0081455_10004821 | |||
| 759 | Ga0081455_10005587 | |||
| 760 | Ga0081455_10016987 | |||
| 761 | Ga0081538_10002182 | |||
| 762 | Ga0081538_10009182 | |||
| 763 | Ga0081540_1019137 | |||
| 764 | Ga0081540_1026317 | |||
| 765 | Ga0081540_1029074 | |||
| 766 | Ga0070717_10004543 | |||
| 767 | Ga0070717_10014967 | |||
| 768 | Ga0070717_10027456 | |||
| 769 | Ga0097621_100006367 | |||
| 770 | Ga0097621_100028661 | |||
| 771 | Ga0068871_100000253 | |||
| 772 | Ga0075428_100002855 | |||
| 773 | Ga0075428_100009299 | |||
| 774 | Ga0075428_100033212 | |||
| 775 | Ga0075428_100035766 | |||
| 776 | Ga0075428_100101398 | |||
| 777 | Ga0075430_100015398 | |||
| 778 | Ga0075430_100023004 | |||
| 779 | Ga0075431_100004329 | |||
| 780 | Ga0075431_100034745 | |||
| 781 | Ga0075431_100039943 | |||
| 782 | Ga0075431_100066089 | |||
| 783 | Ga0075431_100110291 | |||
| 784 | Ga0075431_100112534 | |||
| 785 | Ga0075433_10000529 | |||
| 786 | Ga0075429_100023778 | |||
| 787 | Ga0075429_100078947 | |||
| 788 | Ga0068865_100045773 | |||
| 789 | Ga0075436_100000719 | |||
| 790 | Ga0097620_100000936 | |||
| 791 | Ga0097620_100001959 | |||
| 792 | Ga0105240_10156405 | |||
| 793 | Ga0111539_10006878 | |||
| 794 | Ga0111539_10011499 | |||
| 795 | Ga0111539_10032030 | |||
| 796 | Ga0111539_10034408 | |||
| 797 | Ga0111539_10065307 | |||
| 798 | Ga0111539_10071355 | |||
| 799 | Ga0105245_10006689 | |||
| 800 | Ga0105245_10016567 | |||
| 801 | Ga0114129_10013951 | |||
| 802 | Ga0114129_10066600 | |||
| 803 | Ga0105242_10049773 | |||
| 804 | Ga0105248_10018994 | |||
| 805 | Ga0105248_10107396 | |||
| 806 | Ga0105248_10109179 | |||
| 807 | Ga0105237_10078621 | |||
| 808 | Ga0105238_10035493 | |||
| 809 | Ga0105238_10100470 | |||
| 810 | Ga0105249_10006028 | |||
| 811 | Ga0105246_10040231 | |||
| 812 | Ga0157369_10003210 | |||
| 813 | Ga0157369_10005783 | |||
| 814 | Ga0157369_10075723 | |||
| 815 | Ga0157374_10000866 | |||
| 816 | Ga0157374_10016268 | |||
| 817 | Ga0157374_10083403 | |||
| 818 | Ga0157374_10106643 | |||
| 819 | Ga0157378_10000055 | |||
| 820 | Ga0157378_10048885 | |||
| 821 | Ga0163162_10019681 | |||
| 822 | Ga0163162_10057398 | |||
| 823 | Ga0163162_10065164 | |||
| 824 | Ga0157372_10011593 | |||
| 825 | Ga0157372_10033187 | |||
| 826 | Ga0157372_10035179 | |||
| 827 | Ga0157372_10069450 | |||
| 828 | Ga0157375_10037090 | |||
| 829 | Ga0163163_10046809 | |||
| 830 | Ga0157380_10045455 | |||
| 831 | Ga0157377_10012525 | |||
| 832 | Ga0157376_10074488 | |||
| 833 | Ga0182007_10001064 | |||
| 834 | Ga0163161_10038535 | |||
| 835 | Ga0206352_10477980 | |||
| 836 | Ga0206350_11417348 | |||
| 837 | Ga0213875_10000598 | |||
| 838 | Ga0224712_10005520 | |||
| 839 | Ga0207653_10008147 | |||
| 840 | Ga0207653_10013701 | |||
| 841 | Ga0207692_10012148 | |||
| 842 | Ga0207688_10009600 | |||
| 843 | Ga0207647_10033172 | |||
| 844 | Ga0207685_10008450 | |||
| 845 | Ga0207645_10049761 | |||
| 846 | Ga0207643_10019878 | |||
| 847 | Ga0207684_10001711 | |||
| 848 | Ga0207684_10043264 | |||
| 849 | Ga0207707_10031257 | |||
| 850 | Ga0207693_10000838 | |||
| 851 | Ga0207660_10060808 | |||
| 852 | Ga0207662_10026561 | |||
| 853 | Ga0207662_10041057 | |||
| 854 | Ga0207657_10018627 | |||
| 855 | Ga0207657_10028499 | |||
| 856 | Ga0207657_10074648 | |||
| 857 | Ga0207652_10012617 | |||
| 858 | Ga0207681_10045549 | |||
| 859 | Ga0207659_10000352 | |||
| 860 | Ga0207659_10046527 | |||
| 861 | Ga0207687_10012059 | |||
| 862 | Ga0207687_10034630 | |||
| 863 | Ga0207700_10002166 | |||
| 864 | Ga0207664_10013575 | |||
| 865 | Ga0207706_10010700 | |||
| 866 | Ga0207706_10013201 | |||
| 867 | Ga0207706_10066421 | |||
| 868 | Ga0207670_10001229 | |||
| 869 | Ga0207665_10014205 | |||
| 870 | Ga0207665_10048416 | |||
| 871 | Ga0207691_10009484 | |||
| 872 | Ga0207691_10061378 | |||
| 873 | Ga0207711_10010318 | |||
| 874 | Ga0207689_10024087 | |||
| 875 | Ga0207689_10032849 | |||
| 876 | Ga0207661_10020316 | |||
| 877 | Ga0207661_10022053 | |||
| 878 | Ga0207661_10037297 | |||
| 879 | Ga0207679_10052834 | |||
| 880 | Ga0207651_10000325 | |||
| 881 | Ga0207712_10020307 | |||
| 882 | Ga0207668_10000001 | |||
| 883 | Ga0207703_10014304 | |||
| 884 | Ga0207678_10018522 | |||
| 885 | Ga0207678_10023261 | |||
| 886 | Ga0207678_10061836 | |||
| 887 | Ga0207708_10003737 | |||
| 888 | Ga0207708_10009667 | |||
| 889 | Ga0207702_10003801 | |||
| 890 | Ga0207648_10003424 | |||
| 891 | Ga0207648_10060319 | |||
| 892 | Ga0207674_10000157 | |||
| 893 | Ga0207674_10016529 | |||
| 894 | Ga0207674_10027413 | |||
| 895 | Ga0207675_100011087 | |||
| 896 | Ga0207675_100070677 | |||
| 897 | Ga0207675_100079562 | |||
| 898 | Ga0207683_10000753 | |||
| 899 | Ga0207698_10062967 | |||
| 900 | Ga0207428_10004642 | |||
| 901 | Ga0207428_10009384 | |||
| 902 | Ga0207428_10035774 | |||
| 903 | Ga0207428_10079800 | |||
| 904 | Ga0268266_10001052 | |||
| 905 | Ga0268265_10010766 | |||
| 906 | Ga0265338_10002317 | |||
| 907 | Ga0265338_10007754 | |||
| 908 | Ga0265338_10047133 | |||
| 909 | Ga0307513_10046470 | |||
| 910 | Ga0316579_10003226 | |||
| 911 | Ga0316579_10009756 | |||
| 912 | Ga0316579_10012373 | |||
| 913 | Ga0316579_10022811 | |||
| 914 | Ga0265314_10003612 | |||
| 915 | Ga0265342_10011968 | |||
| 916 | Ga0316576_10048165 | |||
| 917 | Ga0316576_10055457 | |||
| 918 | Ga0316576_10065030 | |||
| 919 | Ga0316578_10006412 | |||
| 920 | Ga0316578_10033722 | |||
| 921 | Ga0316577_10001188 | |||
| 922 | Ga0316577_10009085 | |||
| 923 | Ga0316577_10014911 | |||
| 924 | Ga0316577_10032057 | |||
| 925 | Ga0307410_10009991 | |||
| 926 | Ga0307409_100007136 | |||
| 927 | Ga0307416_100005623 | |||
| 928 | Ga0316583_10015244 | |||
| 929 | Ga0316585_10010635 | |||
| 930 | Ga0316586_1000091 | |||
| 931 | Ga0316587_1000003 | |||
| 932 | Ga0373950_0000069 | |||
| 933 | Ga0373926_0001932 | |||
| 934 | Ga0373934_0007050 | |||
| 935 | Ga0373934_0012017 | |||
| 936 | Ga0373934_0015108 | |||
| 937 | Ga0373923_0001369 | |||
| 938 | Ga0373923_0012973 | |||
| 939 | Ga0373923_0013798 | |||
| 940 | Ga0373936_0000361 | |||
| 941 | Ga0373936_0000927 | |||
| 942 | Ga0373936_0016176 | |||
| 943 | Ga0373945_0000032 | |||
| 944 | Ga0373945_0001212 | |||
| 945 | Ga0373953_0001069 | |||
| 946 | Ga0373954_0008457 | |||
| 947 | Ga0373954_0015675 | |||
| 948 | Ga0373954_0021951 | |||
| 949 | Ga0373956_0002465 | |||
| 950 | Ga0373956_0018837 | |||
| 951 | Ga0373957_0001552 | |||
| 952 | Ga0373943_0000103 | |||
| 953 | Ga0373943_0002595 | |||
| 954 | Ga0373946_0000917 | |||
| 955 | Ga0373946_0001011 | |||
| 956 | Ga0373946_0001093 | |||
| 957 | Ga0373955_0005604 | |||
| 958 | Ga0373955_0015207 | |||
| 959 | Ga0316574_0000821 | |||
| 960 | Ga0316574_0005112 | |||
| 961 | Ga0373924_0004119 | |||
| 962 | Ga0373924_0011638 | |||
| 963 | Ga0373931_0009243 | |||
| 964 | Ga0373931_0037981 | |||
| 965 | Ga0373935_0000548 | |||
| 966 | Ga0373935_0005770 | |||
| 967 | Ga0373935_0012133 | |||
| 968 | Ga0373935_0015192 | |||
| 969 | Ga0373927_0003346 | |||
| 970 | Ga0373927_0004738 | |||
| 971 | Ga0373933_0008971 | |||
| 972 | Ga0373933_0031914 | |||
| 973 | Ga0373947_0000465 | |||
| 974 | Ga0373947_0002843 | |||
| 975 | Ga0373947_0004804 | |||
| 976 | Ga0373947_0019982 | |||
| 977 | Ga0373937_0007831 | |||
| 978 | Ga0373937_0014750 | |||
| 979 | Ga0373937_0024695 | |||
| 980 | Ga0373937_0042583 | |||
| 981 | Ga0373937_0057446 | |||
| 982 | Ga0373937_0098505 | |||
| 983 | Ga0316582_0001078 | |||
| 984 | Ga0316582_0005700 | |||
| 985 | Ga0316582_0005902 | |||
| 986 | Ga0316582_0030618 | |||
| 987 | Ga0316582_0046118 | |||
| 988 | Ga0316584_0001065 | |||
| 989 | Ga0316584_0008491 | |||
| 990 | Ga0316584_0020532 | |||
| 991 | Ga0316584_0020894 | |||
| 992 | Ga0316584_0024912 | |||
| 993 | Ga0316584_0032060 | |||
| 994 | Ga0316584_0041604 | |||
| 995 | Ga0316584_0046462 | |||
| 996 | Ga0316584_0056616 | |||
| 997 | Ga0316584_0067539 | |||
| 998 | Ga0373925_0000627 | |||
| 999 | Ga0373925_0002391 | |||
| 1000 | Ga0373925_0005244 | |||
| 1001 | Ga0373925_0005649 | |||
| 1002 | Ga0373925_0028331 | |||
| 1003 | Ga0395900_0009710 | |||
| 1004 | Ga0395898_0025637 | |||
| 1005 | Ga0395898_0074662 | |||
| 1006 | Ga0436364_0170857 | |||
| 1007 | Ga0395901_0009967 | |||
| 1008 | Ga0436361_0354204 | |||
| 1009 | Ga0436361_1141966 | |||
| 1010 | Ga0450903_000162 | |||
| 1011 | Ga0439458_0001019 | |||
| 1012 | Ga0451577_0009950 | |||
| 1013 | Ga0453684_0029356 | |||
| 1014 | Ga0453684_0147886 | |||
| 1015 | Ga0495592_0005024 | |||
| 1016 | Ga0495592_0026998 | |||
| 1017 | Ga0495592_0055989 | |||
| 1018 | Ga0495603_0000941 | |||
| 1019 | Ga0495629_0004422 | |||
| 1020 | Ga0495629_0024620 | |||
| 1021 | Ga0495641_0003706 | |||
| 1022 | Ga0495651_0001645 | |||
| 1023 | Ga0495651_0001800 | |||
| 1024 | Ga0495651_0017304 | |||
| 1025 | Ga0495651_0023982 | |||
| 1026 | Ga0495651_0024096 | |||
| 1027 | Ga0495651_0025013 | |||
| 1028 | Ga0495651_0026403 | |||
| 1029 | Ga0495651_0062474 | |||
| 1030 | Ga0495651_0079391 | |||
| 1031 | Ga0495653_0005136 | |||
| 1032 | Ga0495653_0010357 | |||
| 1033 | Ga0495653_0014179 | |||
| 1034 | Ga0495653_0043294 | |||
| 1035 | Ga0495653_0052781 | |||
| 1036 | Ga0495653_0056959 | |||
| 1037 | Ga0495653_0060768 | |||
| 1038 | Ga0495580_0005623 | |||
| 1039 | Ga0495582_0001230 | |||
| 1040 | Ga0495605_0024457 | |||
| 1041 | Ga0495639_0001312 | |||
| 1042 | Ga0495662_0001043 | |||
| 1043 | Ga0495662_0003567 | |||
| 1044 | Ga0495662_0006219 | |||
| 1045 | Ga0495664_0000761 | |||
| 1046 | Ga0495664_0003660 | |||
| 1047 | Ga0495664_0007410 | |||
| 1048 | Ga0495664_0016782 | |||
| 1049 | Ga0495584_0026193 | |||
| 1050 | Ga0495608_0002010 | |||
| 1051 | Ga0495608_0018430 | |||
| 1052 | Ga0495608_0047302 | |||
| 1053 | Ga0495608_0049092 | |||
| 1054 | Ga0495610_0000629 | |||
| 1055 | Ga0495618_0007784 | |||
| 1056 | Ga0495618_0016583 | |||
| 1057 | Ga0495618_0027014 | |||
| 1058 | Ga0495628_0010793 | |||
| 1059 | Ga0495628_0013266 | |||
| 1060 | Ga0495628_0016463 | |||
| 1061 | Ga0495628_0022603 | |||
| 1062 | Ga0495628_0043484 | |||
| 1063 | Ga0495628_0053278 | |||
| 1064 | Ga0495628_0070497 | |||
| 1065 | Ga0495628_0089710 | |||
| 1066 | Ga0495630_0001346 | |||
| 1067 | Ga0495630_0004983 | |||
| 1068 | Ga0495630_0028680 | |||
| 1069 | Ga0495631_0000128 | |||
| 1070 | Ga0495666_0014542 | |||
| 1071 | Ga0495652_0004310 | |||
| 1072 | Ga0495652_0007220 | |||
| 1073 | Ga0495652_0007693 | |||
| 1074 | Ga0495652_0009522 | |||
| 1075 | Ga0495652_0024480 | |||
| 1076 | Ga0495652_0043361 | |||
| 1077 | Ga0495652_0056255 | |||
| 1078 | Ga0495652_0070680 | |||
| 1079 | Ga0495665_0003786 | |||
| 1080 | Ga0495640_0007342 | |||
| 1081 | Ga0495640_0014231 | |||
| 1082 | Ga0495640_0020145 | |||
| 1083 | Ga0495640_0065056 | |||
| 1084 | Ga0495586_0001077 | |||
| 1085 | Ga0495587_0005544 | |||
| 1086 | Ga0495587_0014673 | |||
| 1087 | Ga0495587_0017801 | |||
| 1088 | Ga0495587_0021370 | |||
| 1089 | Ga0495645_0002041 | |||
| 1090 | Ga0495645_0005227 | |||
| 1091 | Ga0495645_0014927 | |||
| 1092 | Ga0495645_0039741 | |||
| 1093 | Ga0495645_0056507 | |||
| 1094 | Ga0495645_0057783 | |||
| 1095 | Ga0495645_0061733 | |||
| 1096 | Ga0495645_0091453 | |||
| 1097 | Ga0495667_0003307 | |||
| 1098 | Ga0495667_0008323 | |||
| 1099 | Ga0495667_0011984 | |||
| 1100 | Ga0495667_0013524 | |||
| 1101 | Ga0495667_0021185 | |||
| 1102 | Ga0495667_0045309 | |||
| 1103 | Ga0495634_0016884 | |||
| 1104 | Ga0495634_0025925 | |||
| 1105 | Ga0495634_0050850 | |||
| 1106 | Ga0495625_0021732 | |||
| 1107 | Ga0495635_0001088 | |||
| 1108 | Ga0495635_0004406 | |||
| 1109 | Ga0495635_0004997 | |||
| 1110 | Ga0495635_0059305 | |||
| 1111 | Ga0495588_0004318 | |||
| 1112 | Ga0495657_0007137 | |||
| 1113 | Ga0495657_0011422 | |||
| 1114 | Ga0495657_0012426 | |||
| 1115 | Ga0495657_0014136 | |||
| 1116 | Ga0495657_0024848 | |||
| 1117 | Ga0495657_0051695 | |||
| 1118 | Ga0495599_0004643 | |||
| 1119 | Ga0495599_0005968 | |||
| 1120 | Ga0495599_0010765 | |||
| 1121 | Ga0495599_0031390 | |||
| 1122 | Ga0495599_0037849 | |||
| 1123 | Ga0495623_0002925 | |||
| 1124 | Ga0495623_0010659 | |||
| 1125 | Ga0495623_0038340 | |||
| 1126 | Ga0495646_0004883 | |||
| 1127 | Ga0495646_0027356 | |||
| 1128 | Ga0495646_0030454 | |||
| 1129 | Ga0495646_0036671 | |||
| 1130 | Ga0495658_0002221 | |||
| 1131 | Ga0495658_0049084 | |||
| 1132 | Ga0495669_0001066 | |||
| 1133 | Ga0495613_0000186 | |||
| 1134 | Ga0495613_0016139 | |||
| 1135 | Ga0495613_0016140 | |||
| 1136 | Ga0495613_0020710 | |||
| 1137 | Ga0495613_0021842 | |||
| 1138 | Ga0495624_0004980 | |||
| 1139 | Ga0495624_0005812 | |||
| 1140 | Ga0495624_0009110 | |||
| 1141 | Ga0495600_0014104 | |||
| 1142 | Ga0495600_0027959 | |||
| 1143 | Ga0495600_0039226 | |||
| 1144 | Ga0495600_0040468 | |||
| 1145 | Ga0495581_0010322 | |||
| 1146 | Ga0495581_0056615 | |||
| 1147 | Ga0495604_0008396 | |||
| 1148 | Ga0495604_0018054 | |||
| 1149 | Ga0495604_0046444 | |||
| 1150 | Ga0495604_0057480 | |||
| 1151 | Ga0495604_0060091 | |||
| 1152 | Ga0495604_0060432 | |||
| 1153 | Ga0495636_0005100 | |||
| 1154 | Ga0495636_0009113 | |||
| 1155 | Ga0495674_0002225 | |||
| 1156 | Ga0495674_0018508 | |||
| 1157 | Ga0495674_0018687 | |||
| 1158 | Ga0495674_0027551 | |||
| 1159 | Ga0495674_0059154 | |||
| 1160 | Ga0495674_0074365 | |||
| 1161 | Ga0495672_0001313 | |||
| 1162 | Ga0495672_0008531 | |||
| 1163 | Ga0495676_0002295 | |||
| 1164 | Ga0495676_0006872 | |||
| 1165 | Ga0495680_0001811 | |||
| 1166 | Ga0495680_0007420 | |||
| 1167 | Ga0495680_0009933 | |||
| 1168 | Ga0495680_0018104 | |||
| 1169 | Ga0495680_0043579 | |||
| 1170 | Ga0495680_0056683 | |||
| 1171 | Ga0495675_0000906 | |||
| 1172 | Ga0495675_0008557 | |||
| 1173 | Ga0495675_0042438 | |||
| 1174 | Ga0495684_0000188 | |||
| 1175 | Ga0495684_0001074 | |||
| 1176 | Ga0495684_0004585 | |||
| 1177 | Ga0495684_0048159 | |||
| 1178 | Ga0495684_0068454 | |||
| 1179 | Ga0495686_0000028 | |||
| 1180 | Ga0495593_0005162 | |||
| 1181 | Ga0495593_0012898 | |||
| 1182 | Ga0495602_0007364 | |||
| 1183 | Ga0495602_0014255 | |||
| 1184 | Ga0495602_0034829 | |||
| 1185 | Ga0495602_0042848 | |||
| 1186 | Ga0495602_0043819 | |||
| 1187 | Ga0495602_0062237 | |||
| 1188 | Ga0495602_0073782 | |||
| 1189 | Ga0496101_0001239 | |||
| 1190 | Ga0496101_0021984 | |||
| 1191 | Ga0496102_0148001 | |||
| 1192 | Ga0496103_0014872 | |||
| 1193 | Ga0496104_0053464 | |||
| 1194 | Ga0496104_0113027 | |||
| 1195 | Ga0496105_0010325 | |||
| 1196 | Ga0496105_0023239 | |||
| 1197 | Ga0496106_0002244 | |||
| 1198 | Ga0496106_0035570 | |||
| 1199 | Ga0496107_0001051 | |||
| 1200 | Ga0496107_0043208 | |||
| 1201 | Ga0496107_0078279 | |||
| 1202 | Ga0496108_0019058 | |||
| 1203 | Ga0496108_0028739 | |||
| 1204 | Ga0496108_0069198 | |||
| 1205 | Ga0496108_0099549 | |||
| 1206 | Ga0496109_0000005 | |||
| 1207 | Ga0496109_0001161 | |||
| 1208 | Ga0496109_0009390 | |||
| 1209 | Ga0496109_0033920 | |||
| 1210 | Ga0496109_0034535 | |||
| 1211 | Ga0496109_0064028 | |||
| 1212 | Ga0496110_0006046 | |||
| 1213 | Ga0496110_0011606 | |||
| 1214 | Ga0496110_0041509 | |||
| 1215 | Ga0496111_0018069 | |||
| 1216 | Ga0496111_0027417 | |||
| 1217 | Ga0496111_0037576 | |||
| 1218 | Ga0496112_0020586 | |||
| 1219 | Ga0496114_0000918 | |||
| 1220 | Ga0496114_0001433 | |||
| 1221 | Ga0496114_0003147 | |||
| 1222 | Ga0496114_0029213 | |||
| 1223 | Ga0496114_0079763 | |||
| 1224 | Ga0496115_0002106 | |||
| 1225 | Ga0496115_0012185 | |||
| 1226 | Ga0496115_0039808 | |||
| 1227 | Ga0496117_0014433 | |||
| 1228 | Ga0496118_0000940 | |||
| 1229 | Ga0496118_0002837 | |||
| 1230 | Ga0496121_0000075 | |||
| 1231 | Ga0496121_0000832 | |||
| 1232 | Ga0496126_0037531 | |||
| 1233 | Ga0501031_0002727 | |||
| 1234 | Ga0501031_0027545 | |||
| 1235 | Ga0501032_0014186 | |||
| 1236 | Ga0501033_0000598 | |||
| 1237 | Ga0501033_0048010 | |||
| 1238 | Ga0501036_0000758 | |||
| 1239 | Ga0501036_0051435 | |||
| 1240 | Ga0501037_0006192 | |||
| 1241 | Ga0501037_0015050 | |||
| 1242 | Ga0501038_0019390 | |||
| 1243 | Ga0501038_0022865 | |||
| 1244 | Ga0501038_0051560 | |||
| 1245 | Ga0501039_0011531 | |||
| 1246 | Ga0501039_0024275 | |||
| 1247 | Ga0501039_0031177 | |||
| 1248 | Ga0501039_0037356 | |||
| 1249 | Ga0501039_0049886 | |||
| 1250 | Ga0501040_0001705 | |||
| 1251 | Ga0501040_0007388 | |||
| 1252 | Ga0501040_0014793 | |||
| 1253 | Ga0501041_0000634 | |||
| 1254 | Ga0501041_0007349 | |||
| 1255 | Ga0501041_0042856 | |||
| 1256 | Ga0501042_0000943 | |||
| 1257 | Ga0501042_0001500 | |||
| 1258 | Ga0501042_0001544 | |||
| 1259 | Ga0501042_0005061 | |||
| 1260 | Ga0501046_0000002 | |||
| 1261 | Ga0501046_0001656 | |||
| 1262 | Ga0501046_0027373 | |||
| 1263 | Ga0501046_0029356 | |||
| 1264 | Ga0501047_0004836 | |||
| 1265 | Ga0501047_0094361 | |||
| 1266 | Ga0501048_0003340 | |||
| 1267 | Ga0501048_0024298 | |||
| 1268 | Ga0501067_0000024 | |||
| 1269 | Ga0501067_0000851 | |||
| 1270 | Ga0501067_0005568 | |||
| 1271 | Ga0501067_0018664 | |||
| 1272 | Ga0501068_0001402 | |||
| 1273 | Ga0501068_0049291 | |||
| 1274 | Ga0501068_0050645 | |||
| 1275 | Ga0501069_0008019 | |||
| 1276 | Ga0501070_0000023 | |||
| 1277 | Ga0501070_0010567 | |||
| 1278 | Ga0501070_0017550 | |||
| 1279 | Ga0501071_0004627 | |||
| 1280 | Ga0501071_0005165 | |||
| 1281 | Ga0501071_0018933 | |||
| 1282 | Ga0501071_0026278 | |||
| 1283 | Ga0501071_0043336 | |||
| 1284 | Ga0501072_0000151 | |||
| 1285 | Ga0501072_0027592 | |||
| 1286 | Ga0501072_0036350 | |||
| 1287 | Ga0501073_0000133 | |||
| 1288 | Ga0501073_0006162 | |||
| 1289 | Ga0501073_0014038 | |||
| 1290 | Ga0501073_0015450 | |||
| 1291 | Ga0501073_0037676 | |||
| 1292 | Ga0501074_0012281 | |||
| 1293 | Ga0501075_0002274 | |||
| 1294 | Ga0501075_0007557 | |||
| 1295 | Ga0501076_0002173 | |||
| 1296 | Ga0501076_0005860 | |||
| 1297 | Ga0501076_0010254 | |||
| 1298 | Ga0501076_0068385 | |||
| 1299 | Ga0501077_0002347 | |||
| 1300 | Ga0501077_0005240 | |||
| 1301 | Ga0501077_0010438 | |||
| 1302 | Ga0501079_0001676 | |||
| 1303 | Ga0501079_0001707 | |||
| 1304 | Ga0501079_0003211 | |||
| 1305 | Ga0501080_0002849 | |||
| 1306 | Ga0501080_0017775 | |||
| 1307 | Ga0501080_0023887 | |||
| 1308 | Ga0501081_0003137 | |||
| 1309 | Ga0501081_0005227 | |||
| 1310 | Ga0501083_0011387 | |||
| 1311 | Ga0501035_0000006 | |||
| 1312 | Ga0501035_0000136 | |||
| 1313 | Ga0501035_0010681 | |||
| 1314 | Ga0501035_0057370 | |||
| 1315 | Ga0501045_0003406 | |||
| 1316 | Ga0501045_0042794 | |||
| 1317 | Ga0501045_0055429 | |||
| 1318 | nmdc:mga05p37_121606_c1 | |||
| 1319 | nmdc:mga05p37_169477_c1 | |||
| 1320 | nmdc:mga05p37_203931_c1 | |||
| 1321 | nmdc:mga05p37_210_c1 | |||
| 1322 | nmdc:mga05p37_28942_c1 | |||
| 1323 | nmdc:mga05p37_47491_c1 | |||
| 1324 | nmdc:mga09592_21156_c1 | |||
| 1325 | nmdc:mga09592_67342_c1 | |||
| 1326 | nmdc:mga0qj67_43541_c1 | |||
| 1327 | nmdc:mga06r32_108209_c1 | |||
| 1328 | nmdc:mga06r32_14946_c1 | |||
| 1329 | nmdc:mga06r32_2687_c1 | |||
| 1330 | nmdc:mga06r32_51744_c1 | |||
| 1331 | nmdc:mga08y16_11062_c1 | |||
| 1332 | nmdc:mga08y16_121958_c1 | |||
| 1333 | nmdc:mga08y16_34082_c1 | |||
| 1334 | nmdc:mga08y16_36998_c1 | |||
| 1335 | nmdc:mga08y16_3801_c1 | |||
| 1336 | nmdc:mga08y16_6452_c1 | |||
| 1337 | nmdc:mga08y16_66397_c1 | |||
| 1338 | nmdc:mga0rr50_38024_c1 | |||
| 1339 | nmdc:mga08x19_5857_c1 | |||
| 1340 | nmdc:mga0a205_70053_c1 | |||
| 1341 | Ga0495601_0005809 | |||
| 1342 | Ga0495601_0006218 | |||
| 1343 | Ga0495601_0036144 | |||
| 1344 | Ga0500635_0000696 | |||
| 1345 | Ga0495619_0009606 | |||
| 1346 | Ga0500643_005913 | |||
| 1347 | Ga0500616_0001539 | |||
| 1348 | Ga0501084_0000172 | |||
| 1349 | Ga0501084_0000885 | |||
| 1350 | Ga0501084_0001208 | |||
| 1351 | Ga0501084_0013944 | |||
| 1352 | Ga0501082_0002146 | |||
| 1353 | Ga0501082_0013628 | |||
| 1354 | Ga0501082_0014422 | |||
| 1355 | Ga0501082_0022512 | |||
| 1356 | Ga0501082_0111929 | |||
| 1357 | Ga0530510_0000312 | |||
| 1358 | Ga0530510_0000554 | |||
| 1359 | Ga0530510_0013127 | |||
| 1360 | Ga0530510_0019432 | |||
| 1361 | Ga0530510_0021465 | |||
| 1362 | Ga0530510_0024686 | |||
| 1363 | Ga0530510_0059522 | |||
| 1364 | Ga0530510_0062280 | |||
| 1365 | Ga0530510_0073023 | |||
| 1366 | 2506867855 | |||
| 1367 | 2644085380 | |||
| 1368 | 2644085609 | |||
| 1369 | 2644342932 | |||
| 1370 | 2644343160 | |||
| 1371 | 2644366232 | |||
| 1372 | 2644366460 | |||
| 1373 | 2808873197 | |||
| 1374 | 2837270096 | |||
| 1375 | 2902815151 | |||
| 1376 | 2913915778 | |||
| 1377 | 2913940840 | |||
| 1378 | 2941474835 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7all-assembly1.cif.gz_AAA | a single sulfatase is required for metabolism of colonic mucin o-glycans and intestinal colonization by a symbiotic human gut bacterium (bt4683-s1_4) | 0.9218 | 31 | 577 |
| 4cxs-assembly1.cif.gz_A | g4 mutant of pas, arylsulfatase from pseudomonas aeruginosa, in complex with phenylphosphonic acid | 0.8846 | 31 | 570 |
| 7all-assembly1.cif.gz_AAA | a single sulfatase is required for metabolism of colonic mucin o-glycans and intestinal colonization by a symbiotic human gut bacterium (bt4683-s1_4) | 0.8844 | 31 | 577 |
| 5aj9-assembly2.cif.gz_B | g7 mutant of pas, arylsulfatase from pseudomonas aeruginosa | 0.8788 | 31 | 573 |
| 4cxu-assembly2.cif.gz_B | g4 mutant of pas, arylsulfatase from pseudomonas aeruginosa, in complex with 3-br-phenolphenylphosphonate | 0.8781 | 31 | 570 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P95059_35_492_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.9835 | 31 | 486 | 3.40.720.10 |
| af_P95059_35_492_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.9771 | 31 | 486 | 3.40.720.10 |
| af_I6XVW9_41_489_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.968 | 31 | 489 | 3.40.720.10 |
| af_I6XVW9_41_489_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.9616 | 31 | 489 | 3.40.720.10 |
| af_O65931_209_662_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.9464 | 30 | 488 | 3.40.720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A562E120-F1-model_v4 | Arylsulfatase | 0.9817 | 32 | 213 |
GO:0016787
|
| AF-A0A520EQ29-F1-model_v4 | Arylsulfatase | 0.9801 | 3 | 515 |
GO:0016787
|
| AF-A0A368TKK5-F1-model_v4 | Arylsulfatase (EC 3.1.6.1) | 0.9783 | 50 | 201 |
GO:0004065
|
| AF-A0A6I2V894-F1-model_v4 | Sulfatase-like hydrolase/transferase | 0.9779 | 1 | 404 |
GO:0016740
GO:0016787 |
| AF-A0A535S7R9-F1-model_v4 | Arylsulfatase | 0.9772 | 1 | 670 |
GO:0016787
|