F475438

General Info

Members Datasets Scaffolds Average Seq Length
690 531 1380 327

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10002867|Ga0075369_100028675
Length 364
Sequence MARLAHMLKATPRTRRMEILEAAFGSRFGRPTSSVRPKSRLAKGVGVACLFFGAAIAGGSSGALAAGIPSWLMTYVGEGQGQIALPVLQRARALYIQKASQGAVSNPCYFAMDATRPNDPGSSGGRFYIICESQHSFRAISAGHGGGRNLRGVADFSNGRRCARHFGNAQDSELTTGGSYVTAETKTSFKGYYRVAANQDAAFLRSFIQFDGVGETANARQRAIGGHAAVALKGVCLRKAPSSPYANQDGYVPFGKLVDYAGGRSNGCTSWSLGDVKQILSMVRDYPTTLYIYPEAADVSNVARAVAAGQSPARAGLYWNAACLREIGAPKYWSRQVLEPVLAQYKLDHPAPPPRPTPICEGSE

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
53 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
119 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
121 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
122 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
147 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
255 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
256 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
261 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
262 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
263 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
264 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
265 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
266 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
267 2512875024
268 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
269 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
270 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
271 2519899620 Rhizobium sp. Pop5 Isolate Nodule
272 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
273 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
274 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
275 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
276 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
277 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
278 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
279 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
280 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
281 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
282 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
283 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
284 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
285 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
286 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
287 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
288 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
289 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
290 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
291 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
292 2718217882 Rhizobium sp. N741 Isolate Nodule
293 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
294 2718218009 Rhizobium sp. N561 Isolate Nodule
295 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
296 2718218363 Rhizobium sp. N113 Isolate Nodule
297 2718218365 Rhizobium sp. N731 Isolate Nodule
298 2718218366 Rhizobium sp. N621 Isolate Nodule
299 2721755514 Rhizobium sp. N6212 Isolate Nodule
300 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
301 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
302 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
303 2721755810 Rhizobium sp. N871 Isolate Nodule
304 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
305 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
306 2728369365 Rhizobium sp. N1341 Isolate Nodule
307 2728369397 Rhizobium sp. N1314 Isolate Nodule
308 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
309 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
310 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
311 2791355260 Rhizobium sp. L9 Isolate Nodule
312 2791355265 Rhizobium sp. H4 Isolate Nodule
313 2791355267 Rhizobium sp. L18 Isolate Nodule
314 2802429633 Rhizobium anhuiense J3 Isolate Nodule
315 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
316 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
317 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
318 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
319 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
320 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
321 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
322 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
323 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
324 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
325 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
326 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
327 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
328 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
329 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
330 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
331 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
332 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
333 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
334 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
335 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
336 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
337 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
338 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
339 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
340 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
341 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
342 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
343 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
344 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
345 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
346 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
347 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
348 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
349 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
350 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
351 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
352 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
353 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
354 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
355 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
356 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
357 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
358 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
359 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
360 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
361 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
362 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
363 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
364 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
365 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
366 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
367 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
368 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
369 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
370 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
371 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
372 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
373 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
374 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
375 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
376 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
377 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
378 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
379 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
380 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
381 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
382 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
383 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
384 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
385 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
386 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
387 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
388 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
389 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
390 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
391 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
392 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
393 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
394 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
395 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
396 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
397 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
398 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
399 2909042592 Labrys sp. LIt4 Isolate Nodule
400 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
401 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
402 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
403 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
404 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
405 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
406 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
407 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
408 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
409 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
410 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
411 2936381700 Rhizobium chutanense C16 Isolate Unclassified
412 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
413 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
414 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
415 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
416 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
417 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
418 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
419 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
420 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
421 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
422 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
423 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
424 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
425 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
426 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
427 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
428 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
429 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
430 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
431 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
432 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
433 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
434 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
435 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
436 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
437 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
438 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
439 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
440 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
441 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
442 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
443 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
444 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
445 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
446 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
447 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
448 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
449 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
450 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
451 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
452 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
453 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
454 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
455 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
456 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
457 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
458 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
459 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
460 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
461 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
462 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
463 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
464 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
465 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
466 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
467 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
468 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
469 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
470 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
471 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
472 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
473 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
474 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
475 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
476 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
477 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
478 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
479 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
480 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
481 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
482 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
483 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
484 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
485 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
486 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
487 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
488 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
489 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
490 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
491 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
492 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
493 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
494 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
495 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
496 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
497 2996893221 Rhizobium sp. R635 Isolate Nodule
498 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
499 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
500 3004167301 Mesorhizobium loti 582 Isolate Unclassified
501 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
502 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
503 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
504 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
505 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
506 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
507 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
508 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
509 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
510 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
511 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
512 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
513 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
514 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
515 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
516 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
517 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
518 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
519 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
520 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
521 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
522 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
523 8005382845 Rhizobium sp. R634 Isolate Nodule
524 8005395548 Rhizobium sp. R339 Isolate Nodule
525 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
526 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
527 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
528 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
529 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
530 8018176218 Rhizobium sp. N122 Isolate Nodule
531 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.86
Metatranscriptomes 0
Isolates 40.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.86
Nodule 34.93
Rhizoplane 6.38
Rhizosphere 38.41
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10002867 3300006186 Bacteria 6216
2 JGI24735J21928_10057478 3300002067 Bacteria 1119
3 JGI25155J39150_1000183 3300002704 Bacteria 26908
4 JGI25156J39149_1000405 3300002705 Bacteria 27011
5 JGI25156J39149_1008154 3300002705 Bacteria 2667
6 JGI25162J39368_1000111 3300002737 Bacteria 89317
7 JGI25154J39366_1000342 3300002738 Bacteria 26841
8 JGI25157J39369_1000437 3300002741 Bacteria 27009
9 JGI25157J39369_1000667 3300002741 Bacteria 18873
10 JGI25150J39212_1000028 3300002774 Bacteria 105831
11 JGI25151J46595_10000123 3300003187 Bacteria 105339
12 JGI25151J46595_10000582 3300003187 Bacteria 32553
13 JGI25165J46597_1000006 3300003214 Bacteria 529784
14 JGI25165J46597_1000018 3300003214 Bacteria 374701
15 JGI25165J46597_1000440 3300003214 Bacteria 41868
16 rootL2_10017530 3300003322 Bacteria 26451
17 rootH1_10007065 3300003323 Bacteria 26406
18 rootH1_10102124 3300003323 Bacteria 4348
19 JGI25160J50197_1000095 3300003354 Bacteria 88326
20 JGI25161J50226_1000071 3300003374 Bacteria 88326
21 Ga0055542_1000675 3300003762 Bacteria 27508
22 Ga0055529_1002284 3300003763 Bacteria 3859
23 Ga0055526_1012112 3300003771 Bacteria 3799
24 Ga0055528_1000266 3300003790 Bacteria 44336
25 Ga0055543_1000250 3300004625 Bacteria 40740
26 Ga0065165_1000408 3300005262 Bacteria 68789
27 Ga0070670_100017672 3300005331 Bacteria 6119
28 Ga0070688_100013794 3300005365 Bacteria 4568
29 Ga0070688_100130504 3300005365 Bacteria 1695
30 Ga0070659_100003500 3300005366 Bacteria 11180
31 Ga0070663_100014193 3300005455 Bacteria 5107
32 Ga0070678_100131626 3300005456 Bacteria 1988
33 Ga0070662_100002562 3300005457 Bacteria 11193
34 Ga0070662_100130501 3300005457 Unclassified 1937
35 Ga0070697_100235397 3300005536 Bacteria 1563
36 Ga0068853_100006123 3300005539 Bacteria 9526
37 Ga0068853_100521709 3300005539 Bacteria 1123
38 Ga0070695_100337804 3300005545 Bacteria 1125
39 Ga0070696_100280550 3300005546 Bacteria 1270
40 Ga0070665_100013224 3300005548 Bacteria 8314
41 Ga0070665_100117858 3300005548 Bacteria 2658
42 Ga0070665_100182921 3300005548 Bacteria 2096
43 Ga0070704_100023332 3300005549 Bacteria 4039
44 Ga0068857_100023552 3300005577 Bacteria 5421
45 Ga0068857_100168348 3300005577 Bacteria 1991
46 Ga0068854_100043279 3300005578 Bacteria 3191
47 Ga0068856_100008489 3300005614 Bacteria 9991
48 Ga0068856_100123122 3300005614 Bacteria 2596
49 Ga0068856_100239981 3300005614 Bacteria 1828
50 Ga0068856_100248267 3300005614 Bacteria 1795
51 Ga0068851_10071177 3300005834 Bacteria 1799
52 Ga0068858_100132096 3300005842 Bacteria 2342
53 Ga0068858_100479678 3300005842 Bacteria 1200
54 Ga0081455_10004397 3300005937 Bacteria 15843
55 Ga0081455_10048374 3300005937 Bacteria 3675
56 Ga0081455_10279987 3300005937 Bacteria 1205
57 Ga0081540_1012683 3300005983 Bacteria 5529
58 Ga0070717_10035625 3300006028 Bacteria 4031
59 Ga0075368_10026371 3300006042 Bacteria 2235
60 Ga0075364_10043782 3300006051 Bacteria 2911
61 Ga0070712_100005373 3300006175 Bacteria 7933
62 Ga0070712_100145639 3300006175 Bacteria 1813
63 Ga0075362_10020877 3300006177 Bacteria 2740
64 Ga0075362_10145230 3300006177 Bacteria 1135
65 Ga0075367_10102900 3300006178 Bacteria 1747
66 Ga0075367_10124175 3300006178 Bacteria 1592
67 Ga0075370_10020400 3300006353 Bacteria 3622
68 Ga0075428_100045321 3300006844 Bacteria 4832
69 Ga0075431_100144562 3300006847 Bacteria 2451
70 Ga0075433_10003583 3300006852 Bacteria 11991
71 Ga0075434_100003765 3300006871 Bacteria 13550
72 Ga0075436_100021371 3300006914 Bacteria 4443
73 Ga0099825_1026238 3300006941 Bacteria 3128
74 Ga0099822_1008884 3300006943 Bacteria 12777
75 Ga0099822_1036162 3300006943 Bacteria 3126
76 Ga0075435_100007194 3300007076 Bacteria 7915
77 Ga0105251_10077404 3300009011 Bacteria 1542
78 Ga0105240_10244742 3300009093 Bacteria 2077
79 Ga0111539_10052616 3300009094 Bacteria 4848
80 Ga0105247_10012304 3300009101 Bacteria 5140
81 Ga0105247_10024565 3300009101 Bacteria 3632
82 Ga0114129_10019913 3300009147 Bacteria 9550
83 Ga0105241_10038836 3300009174 Bacteria 3589
84 Ga0105241_10056102 3300009174 Bacteria 3020
85 Ga0105242_10009636 3300009176 Bacteria 7402
86 Ga0105242_10243320 3300009176 Bacteria 1618
87 Ga0105237_10012127 3300009545 Bacteria 9094
88 Ga0105237_10197811 3300009545 Bacteria 2009
89 Ga0105249_10103373 3300009553 Bacteria 2683
90 Ga0123342_1019876 3300009766 Bacteria 5024
91 Ga0105239_10040094 3300010375 Bacteria 5130
92 Ga0105239_10100974 3300010375 Bacteria 3192
93 Ga0105239_10216133 3300010375 Bacteria 2149
94 Ga0105239_10318958 3300010375 Bacteria 1752
95 Ga0105246_10002703 3300011119 Bacteria 10735
96 Ga0157369_10025687 3300013105 Bacteria 6536
97 Ga0157369_10204921 3300013105 Bacteria 2069
98 Ga0157374_10052373 3300013296 Bacteria 3801
99 Ga0157374_10409901 3300013296 Bacteria 1353
100 Ga0157378_10010443 3300013297 Bacteria 8110
101 Ga0157378_10025475 3300013297 Bacteria 5207
102 Ga0157375_10002209 3300013308 Bacteria 16831
103 Ga0157375_10011082 3300013308 Bacteria 7949
104 Ga0182008_10008376 3300014497 Bacteria 5646
105 Ga0157379_10100811 3300014968 Bacteria 2592
106 Ga0157376_10221147 3300014969 Bacteria 1754
107 Ga0209435_100039 3300025206 Bacteria 116879
108 Ga0209436_104527 3300025208 Bacteria 3421
109 Ga0209672_103894 3300025228 Bacteria 2931
110 Ga0209437_100022 3300025233 Bacteria 625694
111 Ga0209437_100064 3300025233 Bacteria 334360
112 Ga0209437_104235 3300025233 Bacteria 2543
113 Ga0207425_1000077 3300025245 Bacteria 105391
114 Ga0209646_1000137 3300025246 Bacteria 116791
115 Ga0209026_1000135 3300025250 Bacteria 117001
116 Ga0209026_1000247 3300025250 Bacteria 68920
117 Ga0209677_102562 3300025253 Bacteria 6698
118 Ga0209148_1000124 3300025254 Bacteria 185123
119 Ga0209759_1000154 3300025256 Bacteria 119427
120 Ga0209759_1000585 3300025256 Bacteria 35847
121 Ga0209129_1000036 3300025258 Bacteria 328331
122 Ga0209129_1000070 3300025258 Bacteria 212476
123 Ga0209233_1000010 3300025261 Bacteria 1194329
124 Ga0209233_1000031 3300025261 Bacteria 624646
125 Ga0209233_1000081 3300025261 Bacteria 336832
126 Ga0209233_1000203 3300025261 Bacteria 118984
127 Ga0209233_1012521 3300025261 Bacteria 2458
128 Ga0209455_1000062 3300025272 Bacteria 335169
129 Ga0209673_1000005 3300025273 Bacteria 692788
130 Ga0209673_1015706 3300025273 Bacteria 2862
131 Ga0209130_1000180 3300025284 Bacteria 89520
132 Ga0209025_1000239 3300025294 Bacteria 128436
133 Ga0209025_1000329 3300025294 Bacteria 105391
134 Ga0209025_1015999 3300025294 Bacteria 4468
135 Ga0209564_1008492 3300025295 Bacteria 5059
136 Ga0209758_1000259 3300025297 Bacteria 105391
137 Ga0209758_1008525 3300025297 Bacteria 6609
138 Ga0209758_1016180 3300025297 Bacteria 3804
139 Ga0209758_1039505 3300025297 Bacteria 1794
140 Ga0209256_1001252 3300025299 Bacteria 27983
141 Ga0207426_1000017 3300025302 Bacteria 577913
142 Ga0209051_1014356 3300025303 Bacteria 3702
143 Ga0207710_10020432 3300025900 Bacteria 2831
144 Ga0207647_10004530 3300025904 Bacteria 10300
145 Ga0207654_10054593 3300025911 Bacteria 2310
146 Ga0207695_10000118 3300025913 Bacteria 237085
147 Ga0207671_10001634 3300025914 Bacteria 25505
148 Ga0207693_10018579 3300025915 Bacteria 5535
149 Ga0207693_10025573 3300025915 Bacteria 4680
150 Ga0207657_10017311 3300025919 Bacteria 6914
151 Ga0207681_10297578 3300025923 Bacteria 1276
152 Ga0207694_10027043 3300025924 Bacteria 4367
153 Ga0207650_10011291 3300025925 Bacteria 6145
154 Ga0207690_10012744 3300025932 Bacteria 5038
155 Ga0207706_10005948 3300025933 Bacteria 11347
156 Ga0207706_10127767 3300025933 Bacteria 2235
157 Ga0207665_10169100 3300025939 Bacteria 1577
158 Ga0207679_10021491 3300025945 Bacteria 4376
159 Ga0207667_10280376 3300025949 Bacteria 1703
160 Ga0207668_10042642 3300025972 Bacteria 3074
161 Ga0207668_10142162 3300025972 Bacteria 1847
162 Ga0207640_10070828 3300025981 Bacteria 2347
163 Ga0207640_10075654 3300025981 Bacteria 2283
164 Ga0207639_10023099 3300026041 Bacteria 4487
165 Ga0207639_10335319 3300026041 Bacteria 1347
166 Ga0207678_10005382 3300026067 Bacteria 11465
167 Ga0207702_10026926 3300026078 Bacteria 4775
168 Ga0207702_10365015 3300026078 Bacteria 1385
169 Ga0207674_10031304 3300026116 Bacteria 5590
170 Ga0207674_10568160 3300026116 Bacteria 1096
171 Ga0207683_10054109 3300026121 Bacteria 3519
172 Ga0207683_10251259 3300026121 Bacteria 1614
173 Ga0207698_10242608 3300026142 Bacteria 1643
174 Ga0209389_1000046 3300027296 Bacteria 117363
175 Ga0209389_1000260 3300027296 Bacteria 33559
176 Ga0209371_1001381 3300027312 Bacteria 16726
177 Ga0209589_1000175 3300027357 Bacteria 73346
178 Ga0209589_1006990 3300027357 Bacteria 18386
179 Ga0209489_100112 3300027361 Bacteria 117364
180 Ga0209489_104601 3300027361 Bacteria 25214
181 Ga0209489_106620 3300027361 Bacteria 18386
182 Ga0209700_100029 3300027363 Bacteria 214607
183 Ga0209700_102937 3300027363 Bacteria 33569
184 Ga0209700_106374 3300027363 Bacteria 18386
185 Ga0207428_10005960 3300027907 Bacteria 11285
186 Ga0268266_10031949 3300028379 Bacteria 4473
187 Ga0268266_10050305 3300028379 Bacteria 3575
188 Ga0268266_10055237 3300028379 Bacteria 3414
189 Ga0268266_10389957 3300028379 Bacteria 1315
190 Ga0268264_10056786 3300028381 Bacteria 3273
191 Ga0268256_1000851 3300030500 Bacteria 21457
192 Ga0265330_10006943 3300031235 Bacteria 5561
193 Ga0265313_10017938 3300031595 Bacteria 3996
194 Ga0265342_10006640 3300031712 Bacteria 8587
195 Ga0307412_10048640 3300031911 Bacteria 2790
196 Ga0373928_0013404 3300035084 Unclassified 1646
197 Ga0373923_0010872 3300035111 Bacteria 3324
198 Ga0373955_0013111 3300035172 Bacteria 3998
199 Ga0373924_0015934 3300035410 Bacteria 2864
200 Ga0373927_0094172 3300035695 Unclassified 1946
201 Ga0373927_0102367 3300035695 Bacteria 1863
202 Ga0373933_0019279 3300035724 Bacteria 3850
203 Ga0373947_0098696 3300035725 Bacteria 1832
204 Ga0373937_0029258 3300036401 Bacteria 4988
205 Ga0316582_0121807 3300036647 Bacteria 1746
206 Ga0373925_0041213 3300037068 Bacteria 3422
207 Ga0373925_0063577 3300037068 Bacteria 2777
208 Ga0395899_0236486 3300037312 Bacteria 1259
209 Ga0395900_0046118 3300037418 Bacteria 4488
210 Ga0395900_0052058 3300037418 Bacteria 4215
211 Ga0395900_0187635 3300037418 Bacteria 2098
212 Ga0395898_0098236 3300037466 Bacteria 2811
213 Ga0395898_0106615 3300037466 Bacteria 2687
214 Ga0395905_0000453 3300037471 Bacteria 57443
215 Ga0395905_0100559 3300037471 Bacteria 2715
216 Ga0395905_0122792 3300037471 Bacteria 2442
217 Ga0395905_0128431 3300037471 Bacteria 2384
218 Ga0395905_0653430 3300037471 Bacteria 953
219 Ga0395901_0215888 3300038443 Bacteria 2006
220 Ga0395901_0218817 3300038443 Bacteria 1991
221 Ga0395901_0474374 3300038443 Bacteria 1277
222 Ga0395901_0613680 3300038443 Bacteria 1095
223 Ga0400485_11087 3300038735 Bacteria 1905
224 Ga0400486_14522 3300038742 Bacteria 2209
225 Ga0436360_0934992 3300039438 Bacteria 2612
226 Ga0436363_1586464 3300039450 Bacteria 5105
227 Ga0439450_009916 3300042008 Bacteria 1823
228 Ga0466972_0043178 3300044658 Bacteria 2190
229 Ga0466967_0180644 3300045976 Bacteria 1990
230 Ga0466967_0407301 3300045976 Bacteria 1324
231 Ga0495592_0005999 3300046454 Bacteria 9031
232 Ga0495603_0012906 3300046455 Bacteria 5051
233 Ga0495603_0056315 3300046455 Bacteria 2328
234 Ga0495629_0009718 3300046459 Bacteria 7024
235 Ga0495629_0019054 3300046459 Bacteria 4907
236 Ga0495651_0003482 3300046462 Bacteria 12066
237 Ga0495580_0006645 3300046472 Bacteria 9397
238 Ga0495582_0065990 3300046473 Bacteria 1999
239 Ga0495639_0014679 3300046475 Bacteria 3393
240 Ga0495639_0051043 3300046475 Bacteria 1880
241 Ga0495664_0152099 3300046477 Bacteria 1404
242 Ga0495594_0045275 3300046499 Unclassified 2415
243 Ga0495606_0001553 3300046507 Bacteria 30251
244 Ga0495606_0149738 3300046507 Bacteria 1371
245 Ga0495608_0007325 3300046511 Bacteria 7798
246 Ga0495618_0001008 3300046514 Bacteria 19283
247 Ga0495628_0086013 3300046516 Bacteria 2438
248 Ga0495666_0106087 3300046526 Unclassified 1322
249 Ga0495652_0018566 3300046529 Bacteria 6198
250 Ga0495640_0013082 3300046533 Bacteria 6319
251 Ga0495622_0048038 3300046557 Bacteria 1983
252 Ga0495667_0011350 3300046559 Bacteria 6032
253 Ga0495634_0028224 3300046642 Bacteria 3897
254 Ga0495625_0020589 3300046660 Bacteria 5089
255 Ga0495625_0205137 3300046660 Bacteria 1299
256 Ga0495588_0058275 3300046674 Bacteria 1996
257 Ga0495657_0042675 3300046675 Bacteria 3095
258 Ga0495599_0039534 3300046678 Bacteria 2963
259 Ga0495623_0001454 3300046679 Bacteria 16044
260 Ga0495646_0097961 3300046680 Bacteria 1684
261 Ga0495613_0012706 3300046689 Bacteria 6262
262 Ga0495624_0099694 3300046690 Bacteria 1789
263 Ga0495600_0026453 3300046809 Bacteria 3744
264 Ga0495581_0011585 3300047315 Bacteria 5102
265 Ga0495604_0001548 3300047317 Bacteria 18937
266 Ga0495674_0004555 3300047319 Bacteria 13337
267 Ga0495672_0166712 3300047320 Bacteria 1127
268 Ga0495680_0007192 3300047322 Bacteria 10254
269 Ga0495680_0172685 3300047322 Unclassified 1564
270 Ga0495675_0046477 3300047444 Bacteria 2763
271 Ga0495675_0173179 3300047444 Bacteria 1325
272 Ga0495686_0000547 3300047472 Bacteria 53728
273 Ga0495593_0020131 3300047673 Plasmid 3736
274 Ga0495602_0018335 3300048088 Bacteria 6995
275 Ga0496100_0002466 3300048903 Bacteria 9400
276 Ga0496100_0025159 3300048903 Bacteria 3638
277 Ga0496100_0135721 3300048903 Bacteria 1738
278 Ga0496101_0035429 3300048904 Bacteria 3530
279 Ga0496101_0091530 3300048904 Bacteria 2263
280 Ga0496102_0022788 3300048905 Bacteria 5551
281 Ga0496102_0051287 3300048905 Bacteria 3759
282 Ga0496103_0003061 3300048906 Bacteria 10281
283 Ga0496103_0051952 3300048906 Bacteria 2538
284 Ga0496103_0271853 3300048906 Bacteria 1090
285 Ga0496104_0010694 3300048907 Bacteria 8204
286 Ga0496104_0011582 3300048907 Bacteria 7904
287 Ga0496104_0239025 3300048907 Bacteria 1728
288 Ga0496105_0047601 3300048908 Bacteria 3539
289 Ga0496106_0018362 3300048909 Bacteria 5168
290 Ga0496106_0155449 3300048909 Bacteria 1806
291 Ga0496107_0008334 3300048910 Bacteria 7172
292 Ga0496107_0081722 3300048910 Bacteria 2357
293 Ga0496107_0218641 3300048910 Bacteria 1417
294 Ga0496108_0041407 3300048911 Bacteria 3846
295 Ga0496108_0273499 3300048911 Bacteria 1470
296 Ga0496108_0286702 3300048911 Bacteria 1433
297 Ga0496109_0026514 3300048912 Bacteria 5168
298 Ga0496109_0071719 3300048912 Bacteria 3181
299 Ga0496109_0078680 3300048912 Bacteria 3036
300 Ga0496109_0081879 3300048912 Bacteria 2974
301 Ga0496109_0086019 3300048912 Bacteria 2903
302 Ga0496110_0019558 3300048913 Bacteria 5701
303 Ga0496111_0002845 3300048914 Bacteria 10558
304 Ga0496111_0386851 3300048914 Bacteria 1034
305 Ga0496112_0008947 3300048915 Bacteria 8990
306 Ga0496112_0027784 3300048915 Bacteria 5457
307 Ga0496112_0035556 3300048915 Bacteria 4854
308 Ga0496112_0107322 3300048915 Bacteria 2762
309 Ga0496112_0134220 3300048915 Bacteria 2446
310 Ga0496113_0013278 3300048916 Bacteria 5573
311 Ga0496113_0098800 3300048916 Bacteria 2260
312 Ga0496113_0187729 3300048916 Bacteria 1640
313 Ga0496114_0003929 3300048917 Bacteria 11466
314 Ga0496114_0026245 3300048917 Bacteria 4768
315 Ga0496115_0006307 3300048918 Bacteria 8678
316 Ga0496115_0029809 3300048918 Bacteria 4288
317 Ga0496116_0064260 3300048919 Bacteria 2359
318 Ga0496116_0120519 3300048919 Unclassified 1519
319 Ga0496116_0132261 3300048919 Bacteria 1420
320 Ga0496117_0009121 3300048920 Bacteria 9315
321 Ga0496118_0122435 3300048921 Unclassified 1692
322 Ga0496119_0025321 3300048922 Bacteria 4148
323 Ga0496119_0030687 3300048922 Bacteria 3619
324 Ga0496119_0056763 3300048922 Bacteria 2371
325 Ga0496119_0175406 3300048922 Bacteria 1128
326 Ga0496120_0002639 3300048923 Bacteria 17745
327 Ga0496120_0084150 3300048923 Bacteria 1716
328 Ga0496121_0037640 3300048924 Bacteria 4294
329 Ga0496121_0087387 3300048924 Bacteria 2447
330 Ga0496123_0008448 3300048926 Bacteria 9456
331 Ga0496123_0031281 3300048926 Bacteria 3874
332 Ga0496124_0024322 3300048927 Bacteria 5511
333 Ga0496124_0093995 3300048927 Bacteria 2439
334 Ga0496124_0167086 3300048927 Bacteria 1709
335 Ga0496125_0088451 3300048928 Bacteria 2334
336 Ga0496126_0197392 3300048929 Bacteria 1701
337 Ga0496126_0239785 3300048929 Bacteria 1515
338 Ga0496126_0301467 3300048929 Bacteria 1322
339 Ga0501031_0000202 3300049568 Bacteria 33947
340 Ga0501032_0000443 3300049569 Bacteria 33947
341 Ga0501032_0136546 3300049569 Bacteria 1616
342 Ga0501033_0000097 3300049570 Bacteria 83228
343 Ga0501033_0371457 3300049570 Bacteria 1000
344 Ga0501034_0000186 3300049571 Bacteria 116500
345 Ga0501034_0050275 3300049571 Bacteria 4205
346 Ga0501034_0186666 3300049571 Bacteria 2036
347 Ga0501036_0000002 3300049572 Bacteria 293106
348 Ga0501036_0109252 3300049572 Bacteria 2337
349 Ga0501037_0000443 3300049573 Bacteria 33927
350 Ga0501037_0046428 3300049573 Bacteria 3185
351 Ga0501038_0000867 3300049574 Bacteria 26767
352 Ga0501038_0048154 3300049574 Bacteria 3690
353 Ga0501039_0000002 3300049575 Bacteria 375152
354 Ga0501039_0114633 3300049575 Bacteria 2109
355 Ga0501040_0001925 3300049576 Bacteria 13348
356 Ga0501040_0021610 3300049576 Bacteria 4300
357 Ga0501040_0054717 3300049576 Bacteria 2736
358 Ga0501040_0136636 3300049576 Bacteria 1726
359 Ga0501041_0027405 3300049577 Bacteria 3433
360 Ga0501042_0154504 3300049578 Bacteria 1655
361 Ga0501043_0000543 3300049579 Bacteria 33914
362 Ga0501047_0002364 3300049581 Bacteria 18037
363 Ga0501070_0012803 3300049586 Bacteria 7072
364 Ga0501070_0088306 3300049586 Bacteria 2566
365 Ga0501071_0016107 3300049587 Bacteria 5139
366 Ga0501071_0216932 3300049587 Bacteria 1439
367 Ga0501076_0129915 3300049592 Bacteria 2043
368 Ga0501077_0012266 3300049593 Bacteria 5368
369 Ga0501079_0096992 3300049741 Bacteria 2286
370 Ga0501080_0249223 3300049742 Bacteria 1620
371 Ga0501081_0007896 3300049743 Bacteria 6903
372 Ga0501081_0080054 3300049743 Bacteria 2286
373 Ga0501035_0000100 3300049822 Bacteria 107321
374 Ga0501035_0032386 3300049822 Bacteria 4756
375 Ga0501044_0000002 3300049823 Bacteria 375152
376 Ga0501044_0052784 3300049823 Bacteria 4186
377 Ga0501044_0360284 3300049823 Bacteria 1372
378 Ga0501045_0018382 3300049824 Bacteria 4972
379 Ga0501045_0090203 3300049824 Bacteria 2265
380 nmdc:mga00v17_277550_c1 3300050491 Bacteria 1088
381 nmdc:mga0yw44_218701_c1 3300050492 Bacteria 1262
382 nmdc:mga0yw44_235089_c1 3300050492 Bacteria 1217
383 nmdc:mga0yw44_241515_c1 3300050492 Bacteria 1200
384 nmdc:mga0yw44_38577_c1 3300050492 Bacteria 2828
385 nmdc:mga07m45_76491_c1 3300050496 Unclassified 1908
386 nmdc:mga05p37_157530_c1 3300050507 Bacteria 2775
387 nmdc:mga05p37_413446_c1 3300050507 Bacteria 1572
388 nmdc:mga06r32_269012_c1 3300050510 Bacteria 1692
389 nmdc:mga08y16_7637_c1 3300050511 Bacteria 11317
390 nmdc:mga0n895_3912_c1 3300050512 Bacteria 12100
391 nmdc:mga0rr50_8560_c1 3300050513 Bacteria 6376
392 nmdc:mga08x19_87064_c1 3300050514 Bacteria 2057
393 nmdc:mga0a205_7475_c1 3300050515 Bacteria 9893
394 Ga0495601_0011422 3300053077 Bacteria 5311
395 Ga0495612_0008778 3300053078 Bacteria 4097
396 Ga0495595_0000901 3300053084 Bacteria 11440
397 Ga0495619_0014841 3300053085 Plasmid 4920
398 Ga0495619_0032453 3300053085 Bacteria 3389
399 Ga0500608_117869 3300053122 Bacteria 1208
400 Ga0500618_000190 3300053125 Bacteria 50341
401 Ga0500618_001154 3300053125 Bacteria 12817
402 Ga0500618_002143 3300053125 Bacteria 7756
403 Ga0500618_007745 3300053125 Bacteria 3040
404 Ga0500620_000058 3300053155 Bacteria 20321
405 Ga0500627_0063583 3300053158 Bacteria 1626
406 Ga0500627_0160637 3300053158 Bacteria 1014
407 Ga0500636_0131564 3300053177 Bacteria 1393
408 Ga0501084_0007651 3300054114 Bacteria 8905
409 Ga0501084_0144864 3300054114 Bacteria 2001
410 Ga0501082_0065853 3300060353 Bacteria 3120
411 Ga0501082_0300851 3300060353 Bacteria 1397
412 Ga0530510_0001126 3300061734 Bacteria 17781
413 Ga0530510_0085782 3300061734 Bacteria 2294
414 2503200471 2503198000 Bacteria 6884444
415 2509117953 2508501123 Bacteria 6283661
416 2509148646 2508501128 Bacteria 8613869
417 2509395254 2509276022 Bacteria 6200534
418 2511131290 2510917022 Bacteria 6504556
419 2512932166 2512875016 Bacteria 6529530
420 2512960169 2512875024 Bacteria 7195110
421 2513611968 2513237090 Bacteria 7096802
422 2514034747 2513237164 Bacteria 7563725
423 2514420553 2513237305 Bacteria 7293571
424 2520378297 2519899620 Bacteria 6499161
425 2530648899 2529292951 Bacteria 6916614
426 2585204482 2582581294 Bacteria 6626667
427 2585205757 2582581294 Bacteria 6626667
428 2585274499 2582581307 Bacteria 6597605
429 2585335466 2582581316 Bacteria 7774528
430 2585561857 2585427531 Bacteria 6992870
431 2585902457 2585427608 Bacteria 6544331
432 2585907588 2585427609 Bacteria 6667127
433 2585993344 2585427633 Bacteria 6413184
434 2586003993 2585427634 Bacteria 6455027
435 2587983009 2585428125 Bacteria 6662905
436 2588518216 2588253730 Bacteria 6881675
437 2599936098 2599185301 Bacteria 6161860
438 2616297312 2615840624 Bacteria 6557588
439 2616552678 2615840698 Bacteria 7319877
440 2617386716 2617270742 Bacteria 6808054
441 2643987992 2643221595 Bacteria 6565519
442 2644158162 2643221627 Bacteria 6761570
443 2671113035 2667528174 Bacteria 6435400
444 2694632403 2693429783 Bacteria 7019804
445 2694639153 2693429784 Bacteria 7241525
446 2719178841 2718217882 Bacteria 6556348
447 2719663204 2718217997 Bacteria 6740740
448 2719729206 2718218009 Bacteria 6478651
449 2720488608 2718218199 Bacteria 6740745
450 2721143453 2718218363 Bacteria 6524337
451 2721155201 2718218365 Bacteria 6274507
452 2721166546 2718218366 Bacteria 6425255
453 2722837524 2721755514 Bacteria 6424414
454 2723563623 2721755684 Bacteria 6859907
455 2723570491 2721755685 Bacteria 6704835
456 2723574275 2721755686 Bacteria 7343952
457 2724041099 2721755810 Bacteria 6479005
458 2724102038 2721755822 Bacteria 6726041
459 2724107227 2721755823 Bacteria 6752556
460 2730161302 2728369365 Bacteria 6555560
461 2730296083 2728369397 Bacteria 6274511
462 2756671920 2756170246 Bacteria 7451806
463 2778176932 2775507266 Bacteria 7392367
464 2792752116 2791355123 Bacteria 8049106
465 2793325274 2791355260 Bacteria 6598818
466 2793356345 2791355265 Bacteria 6539969
467 2793370206 2791355267 Bacteria 7222458
468 2806048762 2802429633 Bacteria 7341974
469 2806063600 2802429635 Bacteria 7650140
470 2806070547 2802429636 Bacteria 7597525
471 2819613588 2818991448 Bacteria 6772224
472 2819685303 2818991461 Bacteria 7026071
473 2838031554 2838029111 Bacteria 6603031
474 2842478286 2842475841 Bacteria 6603183
475 2842484285 2842482326 Bacteria 7212537
476 2842495278 2842489311 Bacteria 6620893
477 2842501629 2842495871 Bacteria 6820686
478 2842505768 2842502639 Bacteria 6604161
479 2844008136 2844002411 Bacteria 7168230
480 2847675317 2847670302 Bacteria 6165597
481 2847691501 2847686936 Bacteria 6278406
482 2856314877 2856314179 Bacteria 6477897
483 2856326729 2856320880 Bacteria 7263508
484 2856333533 2856328259 Bacteria 6528202
485 2856337938 2856334872 Bacteria 7037011
486 2856366247 2856364286 Bacteria 6939991
487 2857351416 2857349434 Bacteria 7926032
488 2857368951 2857367948 Bacteria 6965560
489 2869167496 2869162929 Bacteria 6399702
490 2869169516 2869169390 Bacteria 6659796
491 2869236767 2869234852 Bacteria 6654993
492 2869246605 2869242130 Bacteria 6609239
493 2869261638 2869256925 Bacteria 6981691
494 2869277960 2869271264 Bacteria 6908218
495 2869283718 2869278585 Bacteria 7077053
496 2869287282 2869285874 Bacteria 6901219
497 2871430581 2871429161 Bacteria 6547891
498 2871440545 2871435913 Bacteria 6880295
499 2871459546 2871451962 Bacteria 7336357
500 2871468306 2871466892 Bacteria 6923287
501 2871482683 2871481445 Bacteria 6700002
502 2871502634 2871495908 Bacteria 6935695
503 2874102774 2874102143 Bacteria 6342645
504 2874140175 2874139085 Bacteria 7021506
505 2874149140 2874146452 Bacteria 7533118
506 2874156073 2874155637 Bacteria 6724144
507 2874165359 2874162495 Bacteria 6174670
508 2874169063 2874168670 Bacteria 8062617
509 2876367805 2876363079 Bacteria 6544991
510 2876386394 2876386047 Bacteria 6698674
511 2876394061 2876392853 Bacteria 6660880
512 2876402895 2876399893 Bacteria 6927900
513 2876408750 2876406927 Bacteria 6191900
514 2876415436 2876413966 Bacteria 6831344
515 2876426676 2876420981 Bacteria 6687741
516 2878042120 2878035449 Bacteria 6555736
517 2878738852 2878738818 Bacteria 7136951
518 2878747014 2878745973 Bacteria 6867388
519 2878753100 2878753008 Bacteria 6922523
520 2878766526 2878760144 Bacteria 6823465
521 2878773722 2878767105 Bacteria 6898628
522 2878776219 2878774303 Bacteria 6108671
523 2878786684 2878781027 Bacteria 6834456
524 2881860029 2881853255 Bacteria 6698367
525 2881866480 2881861095 Bacteria 7128710
526 2885308681 2885305155 Bacteria 7348390
527 2885319775 2885318864 Bacteria 6729568
528 2885328799 2885326080 Bacteria 7134805
529 2885340522 2885334103 Bacteria 7216818
530 2885349557 2885342637 Bacteria 7011821
531 2885350843 2885350715 Bacteria 6787678
532 2885384813 2885383462 Bacteria 9473874
533 2885388735 2885383462 Bacteria 9473874
534 2888338696 2888337043 Bacteria 6629336
535 2888355502 2888350351 Bacteria 7372807
536 2889017859 2889016732 Bacteria 6700763
537 2891378060 2891373044 Bacteria 5202277
538 2903450584 2903448605 Bacteria 7357801
539 2903500469 2903492973 Bacteria 13473544
540 2903520441 2903513507 Bacteria 6344008
541 2903521677 2903521522 Bacteria 6525694
542 2903528055 2903528002 Bacteria 6586099
543 2903547675 2903540706 Bacteria 7062119
544 2903776304 2903768456 Bacteria 9749579
545 2903777793 2903768456 Bacteria 9749579
546 2904660392 2904659560 Bacteria 6685615
547 2906309827 2906308376 Bacteria 6841989
548 2906322462 2906321335 Bacteria 6579571
549 2906330318 2906328253 Bacteria 6585166
550 2906378889 2906378014 Bacteria 6911440
551 2906392040 2906386501 Bacteria 5977019
552 2906403548 2906401398 Bacteria 6693206
553 2906412516 2906408224 Bacteria 6162342
554 2906419521 2906414383 Bacteria 6580790
555 2909045358 2909042592 Bacteria 6499737
556 2919412824 2919408235 Bacteria 6149349
557 2922134202 2922130491 Bacteria 7173936
558 2922152031 2922151315 Bacteria 6902399
559 2922175858 2922172374 Bacteria 6167644
560 2924722401 2924718760 Bacteria 6331356
561 2924740208 2924733363 Bacteria 7574837
562 2924741146 2924741084 Bacteria 6661321
563 2924752684 2924748358 Bacteria 6154725
564 2924767990 2924762789 Bacteria 6561353
565 2924776214 2924776078 Bacteria 7492003
566 2924786249 2924784321 Bacteria 7416538
567 2936385624 2936381700 Bacteria 7006523
568 2937814874 2937813078 Bacteria 7783518
569 2937822394 2937822353 Bacteria 7290551
570 2937849950 2937848649 Bacteria 6983481
571 2937864492 2937861824 Bacteria 6660327
572 2937884327 2937877337 Bacteria 7246526
573 2937892108 2937891427 Bacteria 6357007
574 2937979570 2937972304 Bacteria 7532020
575 2937981514 2937980651 Bacteria 6517427
576 2938001550 2937994558 Bacteria 7036190
577 2938016038 2938014810 Bacteria 6700592
578 2958040230 2958034702 Bacteria 6989922
579 2958046704 2958041894 Bacteria 13082850
580 2958054574 2958041894 Bacteria 13082850
581 2958069308 2958064165 Bacteria 7158582
582 2958091638 2958084443 Bacteria 7312792
583 2958097771 2958092219 Bacteria 6861151
584 2958104819 2958100919 Bacteria 6800575
585 2958113191 2958108152 Bacteria 6681128
586 2958116351 2958115193 Bacteria 6923548
587 2958124134 2958122699 Bacteria 7280457
588 2958131782 2958130278 Bacteria 6897202
589 2958138658 2958137437 Bacteria 6050276
590 2958148214 2958144490 Bacteria 6677056
591 2958163668 2958158011 Bacteria 6058449
592 2958171704 2958165035 Bacteria 6906348
593 2958172894 2958172287 Bacteria 6716688
594 2958180842 2958179912 Bacteria 6874908
595 2961078680 2961077736 Bacteria 7079850
596 2961115717 2961114664 Bacteria 6680456
597 2961136622 2961127735 Bacteria 7196641
598 2961139831 2961136820 Bacteria 6775228
599 2961170145 2961163497 Bacteria 6901077
600 2961171100 2961170736 Bacteria 7072258
601 2961186640 2961183825 Bacteria 6688536
602 2963647041 2963644680 Bacteria 6530403
603 2965024896 2965018300 Bacteria 6883036
604 2965025826 2965025482 Bacteria 6532201
605 2965036790 2965032056 Bacteria 6887443
606 2965052032 2965047637 Bacteria 6623551
607 2965065768 2965062239 Bacteria 7412989
608 2965105123 2965102966 Bacteria 6800987
609 2965116232 2965110997 Bacteria 6693150
610 2965124033 2965119406 Bacteria 6956431
611 2968019072 2968016561 Bacteria 7022047
612 2968088157 2968083720 Bacteria 7351627
613 2968095137 2968091066 Bacteria 6052692
614 2968101864 2968097103 Bacteria 6107094
615 2968111450 2968110612 Bacteria 6814636
616 2968119720 2968117919 Bacteria 6536078
617 2968130693 2968128360 Bacteria 6270294
618 2968142513 2968138860 Bacteria 6605449
619 2968178537 2968171901 Bacteria 6894245
620 2970470755 2970469710 Bacteria 6969209
621 2970493426 2970489779 Bacteria 6517260
622 2970503694 2970503327 Bacteria 7099517
623 2970511183 2970510686 Bacteria 7006402
624 2970551519 2970547951 Bacteria 6931819
625 2970561382 2970554993 Bacteria 6814252
626 2970597857 2970593180 Bacteria 7073582
627 2970627576 2970627176 Bacteria 6680862
628 2977822032 2977821940 Bacteria 6906439
629 2977837073 2977828996 Bacteria 7007971
630 2977845665 2977843712 Bacteria 6753583
631 2977853929 2977851361 Bacteria 6694324
632 2977864775 2977858184 Bacteria 6215359
633 2977874281 2977872689 Bacteria 7270173
634 2977908047 2977907340 Bacteria 6577984
635 2977928564 2977922695 Bacteria 6956781
636 2977939065 2977935797 Bacteria 6252826
637 2977945236 2977942078 Bacteria 7570577
638 2977963823 2977957713 Bacteria 6877875
639 2977980237 2977971508 Bacteria 7472917
640 2977992788 2977986579 Bacteria 6581278
641 2979716463 2979710463 Bacteria 6785254
642 2979768774 2979764755 Bacteria 6610066
643 2979781488 2979779861 Bacteria 6219781
644 2979793335 2979793036 Bacteria 6808957
645 2979808330 2979808191 Bacteria 7179355
646 2987638600 2987636660 Bacteria 8088555
647 2987645650 2987645492 Bacteria 6117018
648 2987659428 2987652177 Bacteria 6969023
649 2987666386 2987659509 Bacteria 6966464
650 2987669711 2987666974 Bacteria 6509233
651 2987674327 2987673487 Bacteria 6884027
652 2996356708 2996348954 Bacteria 7239054
653 2996388525 2996386984 Bacteria 6978667
654 2996895456 2996893221 Bacteria 5823108
655 3000139998 3000135777 Bacteria 6891109
656 3002142290 3002141150 Bacteria 5254435
657 3004168064 3004167301 Bacteria 8330599
658 3004195392 3004188549 Bacteria 6952365
659 3004205157 3004203850 Bacteria 7307914
660 3004215433 3004211236 Bacteria 7417683
661 3004225724 3004218560 Bacteria 7421728
662 3004237464 3004232784 Bacteria 6662140
663 3004247225 3004239961 Bacteria 6892290
664 3004283011 3004275668 Bacteria 7114440
665 3004335269 3004334049 Bacteria 8449246
666 3005420952 3005416602 Bacteria 7064308
667 637075262 637000159 Bacteria 7596297
668 649872179 649633066 Bacteria 6690028
669 8004306548 8004300914 Bacteria 6132239
670 8004320880 8004312739 Bacteria 7444653
671 8004374672 8004374579 Bacteria 6898112
672 8004389119 8004387939 Bacteria 7049250
673 8004448862 8004445564 Bacteria 6322258
674 8004641027 8004640170 Bacteria 6723001
675 8004702057 8004695233 Bacteria 6731676
676 8004708957 8004703790 Bacteria 8006957
677 8004716182 8004714634 Bacteria 6776161
678 8004728687 8004727605 Bacteria 6643904
679 8005319313 8005314921 Bacteria 7072929
680 8005384315 8005382845 Bacteria 6732062
681 8005401488 8005395548 Bacteria 6806915
682 8005489348 8005484373 Bacteria 6297373
683 8005624929 8005619151 Bacteria 7030230
684 8005650247 8005645114 Bacteria 6950293
685 8005683886 8005682033 Bacteria 6726518
686 8005698072 8005695170 Bacteria 6912330
687 8018181267 8018176218 Bacteria 6896178
688 8056681885 8056681323 Bacteria 8472857
689 8056686330 8056681323 Bacteria 8472857
690 8056689409 8056681323 Bacteria 8472857
691 Ga0075369_10002867
692 JGI24735J21928_10057478
693 JGI25155J39150_1000183
694 JGI25156J39149_1000405
695 JGI25156J39149_1008154
696 JGI25162J39368_1000111
697 JGI25154J39366_1000342
698 JGI25157J39369_1000437
699 JGI25157J39369_1000667
700 JGI25150J39212_1000028
701 JGI25151J46595_10000123
702 JGI25151J46595_10000582
703 JGI25165J46597_1000006
704 JGI25165J46597_1000018
705 JGI25165J46597_1000440
706 rootL2_10017530
707 rootH1_10007065
708 rootH1_10102124
709 JGI25160J50197_1000095
710 JGI25161J50226_1000071
711 Ga0055542_1000675
712 Ga0055529_1002284
713 Ga0055526_1012112
714 Ga0055528_1000266
715 Ga0055543_1000250
716 Ga0065165_1000408
717 Ga0070670_100017672
718 Ga0070688_100013794
719 Ga0070688_100130504
720 Ga0070659_100003500
721 Ga0070663_100014193
722 Ga0070678_100131626
723 Ga0070662_100002562
724 Ga0070662_100130501
725 Ga0070697_100235397
726 Ga0068853_100006123
727 Ga0068853_100521709
728 Ga0070695_100337804
729 Ga0070696_100280550
730 Ga0070665_100013224
731 Ga0070665_100117858
732 Ga0070665_100182921
733 Ga0070704_100023332
734 Ga0068857_100023552
735 Ga0068857_100168348
736 Ga0068854_100043279
737 Ga0068856_100008489
738 Ga0068856_100123122
739 Ga0068856_100239981
740 Ga0068856_100248267
741 Ga0068851_10071177
742 Ga0068858_100132096
743 Ga0068858_100479678
744 Ga0081455_10004397
745 Ga0081455_10048374
746 Ga0081455_10279987
747 Ga0081540_1012683
748 Ga0070717_10035625
749 Ga0075368_10026371
750 Ga0075364_10043782
751 Ga0070712_100005373
752 Ga0070712_100145639
753 Ga0075362_10020877
754 Ga0075362_10145230
755 Ga0075367_10102900
756 Ga0075367_10124175
757 Ga0075370_10020400
758 Ga0075428_100045321
759 Ga0075431_100144562
760 Ga0075433_10003583
761 Ga0075434_100003765
762 Ga0075436_100021371
763 Ga0099825_1026238
764 Ga0099822_1008884
765 Ga0099822_1036162
766 Ga0075435_100007194
767 Ga0105251_10077404
768 Ga0105240_10244742
769 Ga0111539_10052616
770 Ga0105247_10012304
771 Ga0105247_10024565
772 Ga0114129_10019913
773 Ga0105241_10038836
774 Ga0105241_10056102
775 Ga0105242_10009636
776 Ga0105242_10243320
777 Ga0105237_10012127
778 Ga0105237_10197811
779 Ga0105249_10103373
780 Ga0123342_1019876
781 Ga0105239_10040094
782 Ga0105239_10100974
783 Ga0105239_10216133
784 Ga0105239_10318958
785 Ga0105246_10002703
786 Ga0157369_10025687
787 Ga0157369_10204921
788 Ga0157374_10052373
789 Ga0157374_10409901
790 Ga0157378_10010443
791 Ga0157378_10025475
792 Ga0157375_10002209
793 Ga0157375_10011082
794 Ga0182008_10008376
795 Ga0157379_10100811
796 Ga0157376_10221147
797 Ga0209435_100039
798 Ga0209436_104527
799 Ga0209672_103894
800 Ga0209437_100022
801 Ga0209437_100064
802 Ga0209437_104235
803 Ga0207425_1000077
804 Ga0209646_1000137
805 Ga0209026_1000135
806 Ga0209026_1000247
807 Ga0209677_102562
808 Ga0209148_1000124
809 Ga0209759_1000154
810 Ga0209759_1000585
811 Ga0209129_1000036
812 Ga0209129_1000070
813 Ga0209233_1000010
814 Ga0209233_1000031
815 Ga0209233_1000081
816 Ga0209233_1000203
817 Ga0209233_1012521
818 Ga0209455_1000062
819 Ga0209673_1000005
820 Ga0209673_1015706
821 Ga0209130_1000180
822 Ga0209025_1000239
823 Ga0209025_1000329
824 Ga0209025_1015999
825 Ga0209564_1008492
826 Ga0209758_1000259
827 Ga0209758_1008525
828 Ga0209758_1016180
829 Ga0209758_1039505
830 Ga0209256_1001252
831 Ga0207426_1000017
832 Ga0209051_1014356
833 Ga0207710_10020432
834 Ga0207647_10004530
835 Ga0207654_10054593
836 Ga0207695_10000118
837 Ga0207671_10001634
838 Ga0207693_10018579
839 Ga0207693_10025573
840 Ga0207657_10017311
841 Ga0207681_10297578
842 Ga0207694_10027043
843 Ga0207650_10011291
844 Ga0207690_10012744
845 Ga0207706_10005948
846 Ga0207706_10127767
847 Ga0207665_10169100
848 Ga0207679_10021491
849 Ga0207667_10280376
850 Ga0207668_10042642
851 Ga0207668_10142162
852 Ga0207640_10070828
853 Ga0207640_10075654
854 Ga0207639_10023099
855 Ga0207639_10335319
856 Ga0207678_10005382
857 Ga0207702_10026926
858 Ga0207702_10365015
859 Ga0207674_10031304
860 Ga0207674_10568160
861 Ga0207683_10054109
862 Ga0207683_10251259
863 Ga0207698_10242608
864 Ga0209389_1000046
865 Ga0209389_1000260
866 Ga0209371_1001381
867 Ga0209589_1000175
868 Ga0209589_1006990
869 Ga0209489_100112
870 Ga0209489_104601
871 Ga0209489_106620
872 Ga0209700_100029
873 Ga0209700_102937
874 Ga0209700_106374
875 Ga0207428_10005960
876 Ga0268266_10031949
877 Ga0268266_10050305
878 Ga0268266_10055237
879 Ga0268266_10389957
880 Ga0268264_10056786
881 Ga0268256_1000851
882 Ga0265330_10006943
883 Ga0265313_10017938
884 Ga0265342_10006640
885 Ga0307412_10048640
886 Ga0373928_0013404
887 Ga0373923_0010872
888 Ga0373955_0013111
889 Ga0373924_0015934
890 Ga0373927_0094172
891 Ga0373927_0102367
892 Ga0373933_0019279
893 Ga0373947_0098696
894 Ga0373937_0029258
895 Ga0316582_0121807
896 Ga0373925_0041213
897 Ga0373925_0063577
898 Ga0395899_0236486
899 Ga0395900_0046118
900 Ga0395900_0052058
901 Ga0395900_0187635
902 Ga0395898_0098236
903 Ga0395898_0106615
904 Ga0395905_0000453
905 Ga0395905_0100559
906 Ga0395905_0122792
907 Ga0395905_0128431
908 Ga0395905_0653430
909 Ga0395901_0215888
910 Ga0395901_0218817
911 Ga0395901_0474374
912 Ga0395901_0613680
913 Ga0400485_11087
914 Ga0400486_14522
915 Ga0436360_0934992
916 Ga0436363_1586464
917 Ga0439450_009916
918 Ga0466972_0043178
919 Ga0466967_0180644
920 Ga0466967_0407301
921 Ga0495592_0005999
922 Ga0495603_0012906
923 Ga0495603_0056315
924 Ga0495629_0009718
925 Ga0495629_0019054
926 Ga0495651_0003482
927 Ga0495580_0006645
928 Ga0495582_0065990
929 Ga0495639_0014679
930 Ga0495639_0051043
931 Ga0495664_0152099
932 Ga0495594_0045275
933 Ga0495606_0001553
934 Ga0495606_0149738
935 Ga0495608_0007325
936 Ga0495618_0001008
937 Ga0495628_0086013
938 Ga0495666_0106087
939 Ga0495652_0018566
940 Ga0495640_0013082
941 Ga0495622_0048038
942 Ga0495667_0011350
943 Ga0495634_0028224
944 Ga0495625_0020589
945 Ga0495625_0205137
946 Ga0495588_0058275
947 Ga0495657_0042675
948 Ga0495599_0039534
949 Ga0495623_0001454
950 Ga0495646_0097961
951 Ga0495613_0012706
952 Ga0495624_0099694
953 Ga0495600_0026453
954 Ga0495581_0011585
955 Ga0495604_0001548
956 Ga0495674_0004555
957 Ga0495672_0166712
958 Ga0495680_0007192
959 Ga0495680_0172685
960 Ga0495675_0046477
961 Ga0495675_0173179
962 Ga0495686_0000547
963 Ga0495593_0020131
964 Ga0495602_0018335
965 Ga0496100_0002466
966 Ga0496100_0025159
967 Ga0496100_0135721
968 Ga0496101_0035429
969 Ga0496101_0091530
970 Ga0496102_0022788
971 Ga0496102_0051287
972 Ga0496103_0003061
973 Ga0496103_0051952
974 Ga0496103_0271853
975 Ga0496104_0010694
976 Ga0496104_0011582
977 Ga0496104_0239025
978 Ga0496105_0047601
979 Ga0496106_0018362
980 Ga0496106_0155449
981 Ga0496107_0008334
982 Ga0496107_0081722
983 Ga0496107_0218641
984 Ga0496108_0041407
985 Ga0496108_0273499
986 Ga0496108_0286702
987 Ga0496109_0026514
988 Ga0496109_0071719
989 Ga0496109_0078680
990 Ga0496109_0081879
991 Ga0496109_0086019
992 Ga0496110_0019558
993 Ga0496111_0002845
994 Ga0496111_0386851
995 Ga0496112_0008947
996 Ga0496112_0027784
997 Ga0496112_0035556
998 Ga0496112_0107322
999 Ga0496112_0134220
1000 Ga0496113_0013278
1001 Ga0496113_0098800
1002 Ga0496113_0187729
1003 Ga0496114_0003929
1004 Ga0496114_0026245
1005 Ga0496115_0006307
1006 Ga0496115_0029809
1007 Ga0496116_0064260
1008 Ga0496116_0120519
1009 Ga0496116_0132261
1010 Ga0496117_0009121
1011 Ga0496118_0122435
1012 Ga0496119_0025321
1013 Ga0496119_0030687
1014 Ga0496119_0056763
1015 Ga0496119_0175406
1016 Ga0496120_0002639
1017 Ga0496120_0084150
1018 Ga0496121_0037640
1019 Ga0496121_0087387
1020 Ga0496123_0008448
1021 Ga0496123_0031281
1022 Ga0496124_0024322
1023 Ga0496124_0093995
1024 Ga0496124_0167086
1025 Ga0496125_0088451
1026 Ga0496126_0197392
1027 Ga0496126_0239785
1028 Ga0496126_0301467
1029 Ga0501031_0000202
1030 Ga0501032_0000443
1031 Ga0501032_0136546
1032 Ga0501033_0000097
1033 Ga0501033_0371457
1034 Ga0501034_0000186
1035 Ga0501034_0050275
1036 Ga0501034_0186666
1037 Ga0501036_0000002
1038 Ga0501036_0109252
1039 Ga0501037_0000443
1040 Ga0501037_0046428
1041 Ga0501038_0000867
1042 Ga0501038_0048154
1043 Ga0501039_0000002
1044 Ga0501039_0114633
1045 Ga0501040_0001925
1046 Ga0501040_0021610
1047 Ga0501040_0054717
1048 Ga0501040_0136636
1049 Ga0501041_0027405
1050 Ga0501042_0154504
1051 Ga0501043_0000543
1052 Ga0501047_0002364
1053 Ga0501070_0012803
1054 Ga0501070_0088306
1055 Ga0501071_0016107
1056 Ga0501071_0216932
1057 Ga0501076_0129915
1058 Ga0501077_0012266
1059 Ga0501079_0096992
1060 Ga0501080_0249223
1061 Ga0501081_0007896
1062 Ga0501081_0080054
1063 Ga0501035_0000100
1064 Ga0501035_0032386
1065 Ga0501044_0000002
1066 Ga0501044_0052784
1067 Ga0501044_0360284
1068 Ga0501045_0018382
1069 Ga0501045_0090203
1070 nmdc:mga00v17_277550_c1
1071 nmdc:mga0yw44_218701_c1
1072 nmdc:mga0yw44_235089_c1
1073 nmdc:mga0yw44_241515_c1
1074 nmdc:mga0yw44_38577_c1
1075 nmdc:mga07m45_76491_c1
1076 nmdc:mga05p37_157530_c1
1077 nmdc:mga05p37_413446_c1
1078 nmdc:mga06r32_269012_c1
1079 nmdc:mga08y16_7637_c1
1080 nmdc:mga0n895_3912_c1
1081 nmdc:mga0rr50_8560_c1
1082 nmdc:mga08x19_87064_c1
1083 nmdc:mga0a205_7475_c1
1084 Ga0495601_0011422
1085 Ga0495612_0008778
1086 Ga0495595_0000901
1087 Ga0495619_0014841
1088 Ga0495619_0032453
1089 Ga0500608_117869
1090 Ga0500618_000190
1091 Ga0500618_001154
1092 Ga0500618_002143
1093 Ga0500618_007745
1094 Ga0500620_000058
1095 Ga0500627_0063583
1096 Ga0500627_0160637
1097 Ga0500636_0131564
1098 Ga0501084_0007651
1099 Ga0501084_0144864
1100 Ga0501082_0065853
1101 Ga0501082_0300851
1102 Ga0530510_0001126
1103 Ga0530510_0085782
1104 2503200471
1105 2509117953
1106 2509148646
1107 2509395254
1108 2511131290
1109 2512932166
1110 2512960169
1111 2513611968
1112 2514034747
1113 2514420553
1114 2520378297
1115 2530648899
1116 2585204482
1117 2585205757
1118 2585274499
1119 2585335466
1120 2585561857
1121 2585902457
1122 2585907588
1123 2585993344
1124 2586003993
1125 2587983009
1126 2588518216
1127 2599936098
1128 2616297312
1129 2616552678
1130 2617386716
1131 2643987992
1132 2644158162
1133 2671113035
1134 2694632403
1135 2694639153
1136 2719178841
1137 2719663204
1138 2719729206
1139 2720488608
1140 2721143453
1141 2721155201
1142 2721166546
1143 2722837524
1144 2723563623
1145 2723570491
1146 2723574275
1147 2724041099
1148 2724102038
1149 2724107227
1150 2730161302
1151 2730296083
1152 2756671920
1153 2778176932
1154 2792752116
1155 2793325274
1156 2793356345
1157 2793370206
1158 2806048762
1159 2806063600
1160 2806070547
1161 2819613588
1162 2819685303
1163 2838031554
1164 2842478286
1165 2842484285
1166 2842495278
1167 2842501629
1168 2842505768
1169 2844008136
1170 2847675317
1171 2847691501
1172 2856314877
1173 2856326729
1174 2856333533
1175 2856337938
1176 2856366247
1177 2857351416
1178 2857368951
1179 2869167496
1180 2869169516
1181 2869236767
1182 2869246605
1183 2869261638
1184 2869277960
1185 2869283718
1186 2869287282
1187 2871430581
1188 2871440545
1189 2871459546
1190 2871468306
1191 2871482683
1192 2871502634
1193 2874102774
1194 2874140175
1195 2874149140
1196 2874156073
1197 2874165359
1198 2874169063
1199 2876367805
1200 2876386394
1201 2876394061
1202 2876402895
1203 2876408750
1204 2876415436
1205 2876426676
1206 2878042120
1207 2878738852
1208 2878747014
1209 2878753100
1210 2878766526
1211 2878773722
1212 2878776219
1213 2878786684
1214 2881860029
1215 2881866480
1216 2885308681
1217 2885319775
1218 2885328799
1219 2885340522
1220 2885349557
1221 2885350843
1222 2885384813
1223 2885388735
1224 2888338696
1225 2888355502
1226 2889017859
1227 2891378060
1228 2903450584
1229 2903500469
1230 2903520441
1231 2903521677
1232 2903528055
1233 2903547675
1234 2903776304
1235 2903777793
1236 2904660392
1237 2906309827
1238 2906322462
1239 2906330318
1240 2906378889
1241 2906392040
1242 2906403548
1243 2906412516
1244 2906419521
1245 2909045358
1246 2919412824
1247 2922134202
1248 2922152031
1249 2922175858
1250 2924722401
1251 2924740208
1252 2924741146
1253 2924752684
1254 2924767990
1255 2924776214
1256 2924786249
1257 2936385624
1258 2937814874
1259 2937822394
1260 2937849950
1261 2937864492
1262 2937884327
1263 2937892108
1264 2937979570
1265 2937981514
1266 2938001550
1267 2938016038
1268 2958040230
1269 2958046704
1270 2958054574
1271 2958069308
1272 2958091638
1273 2958097771
1274 2958104819
1275 2958113191
1276 2958116351
1277 2958124134
1278 2958131782
1279 2958138658
1280 2958148214
1281 2958163668
1282 2958171704
1283 2958172894
1284 2958180842
1285 2961078680
1286 2961115717
1287 2961136622
1288 2961139831
1289 2961170145
1290 2961171100
1291 2961186640
1292 2963647041
1293 2965024896
1294 2965025826
1295 2965036790
1296 2965052032
1297 2965065768
1298 2965105123
1299 2965116232
1300 2965124033
1301 2968019072
1302 2968088157
1303 2968095137
1304 2968101864
1305 2968111450
1306 2968119720
1307 2968130693
1308 2968142513
1309 2968178537
1310 2970470755
1311 2970493426
1312 2970503694
1313 2970511183
1314 2970551519
1315 2970561382
1316 2970597857
1317 2970627576
1318 2977822032
1319 2977837073
1320 2977845665
1321 2977853929
1322 2977864775
1323 2977874281
1324 2977908047
1325 2977928564
1326 2977939065
1327 2977945236
1328 2977963823
1329 2977980237
1330 2977992788
1331 2979716463
1332 2979768774
1333 2979781488
1334 2979793335
1335 2979808330
1336 2987638600
1337 2987645650
1338 2987659428
1339 2987666386
1340 2987669711
1341 2987674327
1342 2996356708
1343 2996388525
1344 2996895456
1345 3000139998
1346 3002142290
1347 3004168064
1348 3004195392
1349 3004205157
1350 3004215433
1351 3004225724
1352 3004237464
1353 3004247225
1354 3004283011
1355 3004335269
1356 3005420952
1357 637075262
1358 649872179
1359 8004306548
1360 8004320880
1361 8004374672
1362 8004389119
1363 8004448862
1364 8004641027
1365 8004702057
1366 8004708957
1367 8004716182
1368 8004728687
1369 8005319313
1370 8005384315
1371 8005401488
1372 8005489348
1373 8005624929
1374 8005650247
1375 8005683886
1376 8005698072
1377 8018181267
1378 8056681885
1379 8056686330
1380 8056689409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y4v-assembly1.cif.gz_B structure of helicobacter pylori csd6 in the d-ala-bound state 0.5747 75 263
7o21-assembly1.cif.gz_A structure of bdellovibrio bacteriovorus bd1075 0.5659 98 263
1pn2-assembly2.cif.gz_C crystal structure analysis of the selenomethionine labelled 2-enoyl-coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2 0.5207 146 179
1pn2-assembly1.cif.gz_B crystal structure analysis of the selenomethionine labelled 2-enoyl-coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2 0.5118 146 179
4ml9-assembly1.cif.gz_A crystal structure of uncharacterized tim barrel protein with the conserved phosphate binding site fromsebaldella termitidis 0.4853 290 318
ID Description Score Start End Superfamily
af_Q9U2U6_567_691_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.6795 152 197 3.30.1520.10
af_Q8LSQ2_65_122_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.5729 154 181 2.40.50.40
af_Q6MWW2_15_285_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.5369 148 179 3.10.129.10
1pn2C01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.512 144 179 3.10.129.10
4h83D01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.5037 145 180 3.30.390.10
ID Description Score Start End GO Terms
AF-G2E0M9-F1-model_v4 ErfK/YbiS/YcfS/YnhG family protein 0.9507 28 331
AF-A0A435C132-F1-model_v4 deleted 0.9504 81 332
AF-A0A0A8K4M9-F1-model_v4 YkuD domain-containing protein 0.9419 30 332
AF-A0A435C132-F1-model_v4 deleted 0.9393 81 332
AF-N6V0H3-F1-model_v4 YkuD domain-containing protein 0.9392 28 331

Map