F475449
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 271 | 689 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300015265|Ga0182005_1198308|Ga0182005_11983081 |
| Length | 144 |
| Sequence | LQAANNKICTREAVKSPLMAKKQMFTLEYPVRCSPPILYGFLSTPAGLQEWFADKVDERDNVFMFSWNGSVEKAEVVDSEIDKFIRFRWLTSAKDEYFEFRIEKTEITNQTILVIRDFAEKAEIKDQSQLWETQVKDLFHRLGN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 203 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 207 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 210 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 211 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 212 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 213 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 214 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 237 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 238 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 252 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 257 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 264 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 265 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 266 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 267 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 268 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 269 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 270 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 271 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0.14 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.46 |
| Nodule | 0 |
| Rhizoplane | 1.3 |
| Rhizosphere | 92.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10029653 | 3300001979 | Bacteria | 1794 |
| 2 | JGI24743J22301_10079672 | 3300001991 | Bacteria | 690 |
| 3 | JGI24743J22301_10097633 | 3300001991 | Bacteria | 631 |
| 4 | JGI25406J46586_10001126 | 3300003203 | Bacteria | 12525 |
| 5 | rootH1_10067506 | 3300003316 | Bacteria | 1737 |
| 6 | rootL2_10116707 | 3300003322 | Bacteria | 1542 |
| 7 | rootL2_10146122 | 3300003322 | Bacteria | 1943 |
| 8 | rootH1_10143165 | 3300003323 | Bacteria | 5013 |
| 9 | JGI25160J50197_1002483 | 3300003354 | Bacteria | 8564 |
| 10 | Ga0058862_11132398 | 3300004803 | Unclassified | 572 |
| 11 | Ga0065714_10343038 | 3300005288 | Unclassified | 643 |
| 12 | Ga0065714_10403580 | 3300005288 | Unclassified | 588 |
| 13 | Ga0065704_10375605 | 3300005289 | Bacteria | 780 |
| 14 | Ga0065712_10001725 | 3300005290 | Bacteria | 5366 |
| 15 | Ga0065712_10003696 | 3300005290 | Bacteria | 5348 |
| 16 | Ga0065715_10002173 | 3300005293 | Bacteria | 5596 |
| 17 | Ga0065707_10127439 | 3300005295 | Unclassified | 1984 |
| 18 | Ga0065707_10171062 | 3300005295 | Bacteria | 1484 |
| 19 | Ga0070658_10028772 | 3300005327 | Bacteria | 4462 |
| 20 | Ga0070658_10171993 | 3300005327 | Bacteria | 1820 |
| 21 | Ga0070683_100005997 | 3300005329 | Bacteria | 10180 |
| 22 | Ga0070683_100654742 | 3300005329 | Unclassified | 1006 |
| 23 | Ga0070690_100115733 | 3300005330 | Bacteria | 1794 |
| 24 | Ga0070670_100085915 | 3300005331 | Bacteria | 2703 |
| 25 | Ga0070670_100137214 | 3300005331 | Bacteria | 2114 |
| 26 | Ga0070670_100188277 | 3300005331 | Bacteria | 1792 |
| 27 | Ga0070670_100507342 | 3300005331 | Bacteria | 1073 |
| 28 | Ga0070670_100728859 | 3300005331 | Bacteria | 892 |
| 29 | Ga0070670_101076922 | 3300005331 | Bacteria | 732 |
| 30 | Ga0070670_101784477 | 3300005331 | Unclassified | 566 |
| 31 | Ga0070677_10030389 | 3300005333 | Bacteria | 2056 |
| 32 | Ga0070677_10417757 | 3300005333 | Unclassified | 710 |
| 33 | Ga0068869_100108348 | 3300005334 | Bacteria | 2110 |
| 34 | Ga0068869_100134207 | 3300005334 | Unclassified | 1905 |
| 35 | Ga0068869_100328471 | 3300005334 | Unclassified | 1242 |
| 36 | Ga0070666_10006755 | 3300005335 | Bacteria | 7066 |
| 37 | Ga0070680_100028343 | 3300005336 | Bacteria | 4491 |
| 38 | Ga0070680_100114416 | 3300005336 | Bacteria | 2248 |
| 39 | Ga0070682_100002896 | 3300005337 | Bacteria | 9517 |
| 40 | Ga0070682_100235899 | 3300005337 | Bacteria | 1310 |
| 41 | Ga0068868_100007430 | 3300005338 | Bacteria | 7801 |
| 42 | Ga0068868_100016254 | 3300005338 | Bacteria | 5521 |
| 43 | Ga0068868_100221482 | 3300005338 | Bacteria | 1584 |
| 44 | Ga0068868_100244957 | 3300005338 | Bacteria | 1507 |
| 45 | Ga0068868_100421982 | 3300005338 | Bacteria | 1155 |
| 46 | Ga0070660_100002586 | 3300005339 | Bacteria | 12419 |
| 47 | Ga0070660_100165849 | 3300005339 | Bacteria | 1782 |
| 48 | Ga0070689_100054741 | 3300005340 | Bacteria | 3089 |
| 49 | Ga0070689_100753677 | 3300005340 | Bacteria | 853 |
| 50 | Ga0070689_101182814 | 3300005340 | Unclassified | 686 |
| 51 | Ga0070689_101199668 | 3300005340 | Bacteria | 681 |
| 52 | Ga0070691_10089528 | 3300005341 | Bacteria | 1516 |
| 53 | Ga0070687_100155599 | 3300005343 | Bacteria | 1346 |
| 54 | Ga0070687_100996376 | 3300005343 | Bacteria | 607 |
| 55 | Ga0070687_101106574 | 3300005343 | Bacteria | 580 |
| 56 | Ga0070661_100002631 | 3300005344 | Bacteria | 12276 |
| 57 | Ga0070661_100557090 | 3300005344 | Bacteria | 923 |
| 58 | Ga0070661_100578262 | 3300005344 | Bacteria | 906 |
| 59 | Ga0070668_100356185 | 3300005347 | Bacteria | 1240 |
| 60 | Ga0070668_100620860 | 3300005347 | Bacteria | 947 |
| 61 | Ga0070669_100433280 | 3300005353 | Unclassified | 1081 |
| 62 | Ga0070669_100600415 | 3300005353 | Bacteria | 922 |
| 63 | Ga0070669_100627282 | 3300005353 | Bacteria | 902 |
| 64 | Ga0070669_101010914 | 3300005353 | Unclassified | 714 |
| 65 | Ga0070669_101614860 | 3300005353 | Bacteria | 564 |
| 66 | Ga0070669_101746479 | 3300005353 | Bacteria | 543 |
| 67 | Ga0070675_100048920 | 3300005354 | Bacteria | 3468 |
| 68 | Ga0070675_100221708 | 3300005354 | Bacteria | 1647 |
| 69 | Ga0070675_100272287 | 3300005354 | Bacteria | 1486 |
| 70 | Ga0070675_100816683 | 3300005354 | Bacteria | 853 |
| 71 | Ga0070671_100008104 | 3300005355 | Bacteria | 8414 |
| 72 | Ga0070671_100060942 | 3300005355 | Bacteria | 3142 |
| 73 | Ga0070671_101413896 | 3300005355 | Unclassified | 615 |
| 74 | Ga0070674_100221708 | 3300005356 | Bacteria | 1471 |
| 75 | Ga0070674_100505232 | 3300005356 | Bacteria | 1007 |
| 76 | Ga0070673_100023983 | 3300005364 | Bacteria | 4465 |
| 77 | Ga0070673_100052455 | 3300005364 | Bacteria | 3200 |
| 78 | Ga0070673_100110151 | 3300005364 | Bacteria | 2282 |
| 79 | Ga0070673_100150339 | 3300005364 | Bacteria | 1972 |
| 80 | Ga0070673_102219752 | 3300005364 | Bacteria | 522 |
| 81 | Ga0070688_100012568 | 3300005365 | Bacteria | 4746 |
| 82 | Ga0070688_100561878 | 3300005365 | Bacteria | 869 |
| 83 | Ga0070659_100002110 | 3300005366 | Bacteria | 14167 |
| 84 | Ga0070667_100002640 | 3300005367 | Bacteria | 15524 |
| 85 | Ga0070667_100068354 | 3300005367 | Bacteria | 3023 |
| 86 | Ga0070667_100257326 | 3300005367 | Bacteria | 1562 |
| 87 | Ga0070667_100431782 | 3300005367 | Bacteria | 1202 |
| 88 | Ga0070709_10973324 | 3300005434 | Bacteria | 674 |
| 89 | Ga0070710_10444206 | 3300005437 | Unclassified | 878 |
| 90 | Ga0070701_10078103 | 3300005438 | Bacteria | 1785 |
| 91 | Ga0070701_10081869 | 3300005438 | Bacteria | 1749 |
| 92 | Ga0070711_101565931 | 3300005439 | Bacteria | 576 |
| 93 | Ga0070700_100116326 | 3300005441 | Bacteria | 1785 |
| 94 | Ga0070694_100467393 | 3300005444 | Bacteria | 999 |
| 95 | Ga0070663_100804190 | 3300005455 | Bacteria | 806 |
| 96 | Ga0070663_101213739 | 3300005455 | Unclassified | 663 |
| 97 | Ga0070663_101561803 | 3300005455 | Bacteria | 588 |
| 98 | Ga0070678_100018048 | 3300005456 | Bacteria | 4563 |
| 99 | Ga0070662_100005618 | 3300005457 | Bacteria | 8020 |
| 100 | Ga0070662_100114020 | 3300005457 | Bacteria | 2063 |
| 101 | Ga0070662_100305695 | 3300005457 | Bacteria | 1293 |
| 102 | Ga0070681_10137758 | 3300005458 | Bacteria | 2371 |
| 103 | Ga0070681_10448110 | 3300005458 | Bacteria | 1203 |
| 104 | Ga0068867_100302590 | 3300005459 | Unclassified | 1319 |
| 105 | Ga0068867_100333660 | 3300005459 | Bacteria | 1260 |
| 106 | Ga0068867_100340013 | 3300005459 | Bacteria | 1249 |
| 107 | Ga0068867_101197224 | 3300005459 | Bacteria | 697 |
| 108 | Ga0070685_10270614 | 3300005466 | Bacteria | 1133 |
| 109 | Ga0070685_10338963 | 3300005466 | Bacteria | 1024 |
| 110 | Ga0070685_10942243 | 3300005466 | Bacteria | 645 |
| 111 | Ga0070707_100143289 | 3300005468 | Bacteria | 2326 |
| 112 | Ga0070698_100000267 | 3300005471 | Bacteria | 52849 |
| 113 | Ga0070698_100056165 | 3300005471 | Bacteria | 3990 |
| 114 | Ga0070679_100027317 | 3300005530 | Bacteria | 5616 |
| 115 | Ga0070679_100085573 | 3300005530 | Bacteria | 3140 |
| 116 | Ga0070679_101310501 | 3300005530 | Unclassified | 670 |
| 117 | Ga0070679_102021057 | 3300005530 | Bacteria | 525 |
| 118 | Ga0070684_100001215 | 3300005535 | Bacteria | 18504 |
| 119 | Ga0070684_100259073 | 3300005535 | Bacteria | 1591 |
| 120 | Ga0070684_100390540 | 3300005535 | Unclassified | 1282 |
| 121 | Ga0070684_100577728 | 3300005535 | Bacteria | 1044 |
| 122 | Ga0070697_100330333 | 3300005536 | Bacteria | 1314 |
| 123 | Ga0068853_100013898 | 3300005539 | Bacteria | 6581 |
| 124 | Ga0068853_100326092 | 3300005539 | Bacteria | 1424 |
| 125 | Ga0068853_100339403 | 3300005539 | Bacteria | 1396 |
| 126 | Ga0068853_100345483 | 3300005539 | Bacteria | 1383 |
| 127 | Ga0068853_100374970 | 3300005539 | Unclassified | 1328 |
| 128 | Ga0068853_100780451 | 3300005539 | Unclassified | 914 |
| 129 | Ga0068853_100802234 | 3300005539 | Bacteria | 902 |
| 130 | Ga0068853_101253964 | 3300005539 | Bacteria | 716 |
| 131 | Ga0070672_100311963 | 3300005543 | Bacteria | 1335 |
| 132 | Ga0070672_100519840 | 3300005543 | Bacteria | 1031 |
| 133 | Ga0070672_100896556 | 3300005543 | Bacteria | 783 |
| 134 | Ga0070672_101261771 | 3300005543 | Unclassified | 659 |
| 135 | Ga0070672_101279245 | 3300005543 | Unclassified | 654 |
| 136 | Ga0070672_101711054 | 3300005543 | Bacteria | 565 |
| 137 | Ga0070686_100594516 | 3300005544 | Unclassified | 871 |
| 138 | Ga0070686_100756874 | 3300005544 | Bacteria | 779 |
| 139 | Ga0070693_100431633 | 3300005547 | Bacteria | 920 |
| 140 | Ga0070693_100568503 | 3300005547 | Bacteria | 814 |
| 141 | Ga0070665_100237515 | 3300005548 | Bacteria | 1823 |
| 142 | Ga0070704_100048379 | 3300005549 | Bacteria | 2976 |
| 143 | Ga0070704_100382258 | 3300005549 | Bacteria | 1197 |
| 144 | Ga0068855_100023607 | 3300005563 | Bacteria | 7366 |
| 145 | Ga0068855_101655718 | 3300005563 | Bacteria | 653 |
| 146 | Ga0070664_100004754 | 3300005564 | Bacteria | 10890 |
| 147 | Ga0070664_100948704 | 3300005564 | Unclassified | 807 |
| 148 | Ga0070664_100965497 | 3300005564 | Unclassified | 800 |
| 149 | Ga0068857_100014523 | 3300005577 | Bacteria | 6869 |
| 150 | Ga0068857_100021834 | 3300005577 | Bacteria | 5633 |
| 151 | Ga0068857_100090163 | 3300005577 | Bacteria | 2744 |
| 152 | Ga0068857_100321883 | 3300005577 | Bacteria | 1428 |
| 153 | Ga0068854_100014594 | 3300005578 | Bacteria | 5182 |
| 154 | Ga0068854_100982093 | 3300005578 | Bacteria | 747 |
| 155 | Ga0068854_101628915 | 3300005578 | Bacteria | 589 |
| 156 | Ga0068856_100016680 | 3300005614 | Bacteria | 7114 |
| 157 | Ga0068856_100046347 | 3300005614 | Bacteria | 4282 |
| 158 | Ga0068856_100775841 | 3300005614 | Unclassified | 978 |
| 159 | Ga0068856_101734754 | 3300005614 | Bacteria | 636 |
| 160 | Ga0070702_101007560 | 3300005615 | Bacteria | 660 |
| 161 | Ga0068852_100001659 | 3300005616 | Bacteria | 15178 |
| 162 | Ga0068852_100014178 | 3300005616 | Bacteria | 6123 |
| 163 | Ga0068852_100070866 | 3300005616 | Bacteria | 3059 |
| 164 | Ga0068852_100093543 | 3300005616 | Bacteria | 2695 |
| 165 | Ga0068852_100134320 | 3300005616 | Bacteria | 2283 |
| 166 | Ga0068852_100170673 | 3300005616 | Bacteria | 2038 |
| 167 | Ga0068852_100253146 | 3300005616 | Bacteria | 1688 |
| 168 | Ga0068852_100664554 | 3300005616 | Bacteria | 1050 |
| 169 | Ga0068852_100818284 | 3300005616 | Unclassified | 946 |
| 170 | Ga0068859_100031009 | 3300005617 | Bacteria | 5366 |
| 171 | Ga0068859_100076094 | 3300005617 | Bacteria | 3397 |
| 172 | Ga0068859_100514566 | 3300005617 | Bacteria | 1292 |
| 173 | Ga0068859_100590054 | 3300005617 | Bacteria | 1204 |
| 174 | Ga0068859_100611453 | 3300005617 | Bacteria | 1183 |
| 175 | Ga0068859_100774946 | 3300005617 | Bacteria | 1047 |
| 176 | Ga0068859_100818637 | 3300005617 | Bacteria | 1018 |
| 177 | Ga0068859_100820479 | 3300005617 | Bacteria | 1017 |
| 178 | Ga0068859_101418885 | 3300005617 | Bacteria | 766 |
| 179 | Ga0068859_101670103 | 3300005617 | Bacteria | 703 |
| 180 | Ga0068859_102806984 | 3300005617 | Unclassified | 534 |
| 181 | Ga0068864_100105344 | 3300005618 | Bacteria | 2506 |
| 182 | Ga0068864_100270365 | 3300005618 | Bacteria | 1583 |
| 183 | Ga0068864_100316414 | 3300005618 | Bacteria | 1465 |
| 184 | Ga0068864_100632865 | 3300005618 | Bacteria | 1040 |
| 185 | Ga0068864_101149251 | 3300005618 | Bacteria | 774 |
| 186 | Ga0068864_102048744 | 3300005618 | Unclassified | 578 |
| 187 | Ga0068866_10261797 | 3300005718 | Bacteria | 1063 |
| 188 | Ga0068861_100019358 | 3300005719 | Bacteria | 4862 |
| 189 | Ga0068861_100126207 | 3300005719 | Bacteria | 2070 |
| 190 | Ga0068861_101212787 | 3300005719 | Bacteria | 730 |
| 191 | Ga0068851_10011250 | 3300005834 | Bacteria | 4194 |
| 192 | Ga0068851_10400198 | 3300005834 | Bacteria | 808 |
| 193 | Ga0068870_10186074 | 3300005840 | Bacteria | 1250 |
| 194 | Ga0068863_100039165 | 3300005841 | Bacteria | 4510 |
| 195 | Ga0068863_100323810 | 3300005841 | Bacteria | 1497 |
| 196 | Ga0068863_100778736 | 3300005841 | Bacteria | 953 |
| 197 | Ga0068858_101002155 | 3300005842 | Bacteria | 818 |
| 198 | Ga0068858_101244194 | 3300005842 | Bacteria | 732 |
| 199 | Ga0068858_101971556 | 3300005842 | Unclassified | 577 |
| 200 | Ga0068860_100000052 | 3300005843 | Bacteria | 207351 |
| 201 | Ga0068860_100001511 | 3300005843 | Bacteria | 25059 |
| 202 | Ga0068860_100003681 | 3300005843 | Bacteria | 15776 |
| 203 | Ga0068860_100431557 | 3300005843 | Unclassified | 1307 |
| 204 | Ga0068862_100189755 | 3300005844 | Bacteria | 1849 |
| 205 | Ga0068862_100865500 | 3300005844 | Bacteria | 886 |
| 206 | Ga0068862_101370150 | 3300005844 | Bacteria | 710 |
| 207 | Ga0081539_10000885 | 3300005985 | Bacteria | 57257 |
| 208 | Ga0075366_10114174 | 3300006195 | Bacteria | 1626 |
| 209 | Ga0075366_10693690 | 3300006195 | Bacteria | 632 |
| 210 | Ga0097621_100000118 | 3300006237 | Bacteria | 45384 |
| 211 | Ga0097621_100014934 | 3300006237 | Bacteria | 5828 |
| 212 | Ga0097621_100059277 | 3300006237 | Bacteria | 3133 |
| 213 | Ga0097621_100145640 | 3300006237 | Bacteria | 2028 |
| 214 | Ga0097621_100363638 | 3300006237 | Bacteria | 1289 |
| 215 | Ga0097621_100405122 | 3300006237 | Bacteria | 1222 |
| 216 | Ga0097621_101328429 | 3300006237 | Bacteria | 679 |
| 217 | Ga0097621_101774726 | 3300006237 | Bacteria | 588 |
| 218 | Ga0068871_100006528 | 3300006358 | Bacteria | 8261 |
| 219 | Ga0068871_100019364 | 3300006358 | Bacteria | 5196 |
| 220 | Ga0068871_100030647 | 3300006358 | Bacteria | 4238 |
| 221 | Ga0068871_100476567 | 3300006358 | Bacteria | 1122 |
| 222 | Ga0068871_100567068 | 3300006358 | Bacteria | 1030 |
| 223 | Ga0068871_100975384 | 3300006358 | Bacteria | 788 |
| 224 | Ga0075428_100003257 | 3300006844 | Bacteria | 17776 |
| 225 | Ga0075428_100019714 | 3300006844 | Bacteria | 7463 |
| 226 | Ga0075428_100068646 | 3300006844 | Bacteria | 3877 |
| 227 | Ga0075428_100568495 | 3300006844 | Bacteria | 1212 |
| 228 | Ga0075428_101572528 | 3300006844 | Bacteria | 688 |
| 229 | Ga0075430_100018363 | 3300006846 | Bacteria | 5952 |
| 230 | Ga0075430_100199083 | 3300006846 | Bacteria | 1664 |
| 231 | Ga0075430_100425018 | 3300006846 | Bacteria | 1097 |
| 232 | Ga0075431_100092318 | 3300006847 | Bacteria | 3124 |
| 233 | Ga0075431_100118915 | 3300006847 | Bacteria | 2726 |
| 234 | Ga0075429_100054367 | 3300006880 | Bacteria | 3482 |
| 235 | Ga0075429_101567893 | 3300006880 | Bacteria | 573 |
| 236 | Ga0068865_100167098 | 3300006881 | Bacteria | 1683 |
| 237 | Ga0068865_100303956 | 3300006881 | Bacteria | 1278 |
| 238 | Ga0068865_100442243 | 3300006881 | Bacteria | 1073 |
| 239 | Ga0097620_100031009 | 3300006931 | Bacteria | 5366 |
| 240 | Ga0097620_100076089 | 3300006931 | Bacteria | 3397 |
| 241 | Ga0097620_100514482 | 3300006931 | Bacteria | 1292 |
| 242 | Ga0097620_100590027 | 3300006931 | Bacteria | 1204 |
| 243 | Ga0097620_100611429 | 3300006931 | Bacteria | 1183 |
| 244 | Ga0097620_100774986 | 3300006931 | Bacteria | 1047 |
| 245 | Ga0097620_100818740 | 3300006931 | Bacteria | 1018 |
| 246 | Ga0097620_100820439 | 3300006931 | Bacteria | 1017 |
| 247 | Ga0097620_101418714 | 3300006931 | Bacteria | 766 |
| 248 | Ga0097620_101670067 | 3300006931 | Bacteria | 703 |
| 249 | Ga0097620_102807037 | 3300006931 | Unclassified | 534 |
| 250 | Ga0105251_10167846 | 3300009011 | Bacteria | 989 |
| 251 | Ga0105240_10022086 | 3300009093 | Bacteria | 8445 |
| 252 | Ga0105240_11331757 | 3300009093 | Bacteria | 756 |
| 253 | Ga0111539_10419252 | 3300009094 | Bacteria | 1559 |
| 254 | Ga0111539_11027871 | 3300009094 | Bacteria | 958 |
| 255 | Ga0111539_12689174 | 3300009094 | Bacteria | 577 |
| 256 | Ga0111539_13274333 | 3300009094 | Bacteria | 522 |
| 257 | Ga0105245_11022539 | 3300009098 | Bacteria | 871 |
| 258 | Ga0114129_10270014 | 3300009147 | Bacteria | 2276 |
| 259 | Ga0114129_11243441 | 3300009147 | Bacteria | 925 |
| 260 | Ga0105241_10018266 | 3300009174 | Bacteria | 5157 |
| 261 | Ga0105241_10309763 | 3300009174 | Bacteria | 1358 |
| 262 | Ga0105241_10428110 | 3300009174 | Bacteria | 1166 |
| 263 | Ga0105241_10616681 | 3300009174 | Bacteria | 982 |
| 264 | Ga0105241_11122849 | 3300009174 | Bacteria | 741 |
| 265 | Ga0105241_11180567 | 3300009174 | Bacteria | 724 |
| 266 | Ga0105241_11419537 | 3300009174 | Bacteria | 665 |
| 267 | Ga0105241_11462805 | 3300009174 | Bacteria | 656 |
| 268 | Ga0105241_12347541 | 3300009174 | Bacteria | 531 |
| 269 | Ga0105242_10134758 | 3300009176 | Bacteria | 2136 |
| 270 | Ga0105242_10598981 | 3300009176 | Bacteria | 1064 |
| 271 | Ga0105242_11104499 | 3300009176 | Bacteria | 807 |
| 272 | Ga0105242_11846343 | 3300009176 | Unclassified | 644 |
| 273 | Ga0105248_10014430 | 3300009177 | Bacteria | 8696 |
| 274 | Ga0105237_10016806 | 3300009545 | Bacteria | 7595 |
| 275 | Ga0105237_10398104 | 3300009545 | Bacteria | 1382 |
| 276 | Ga0105237_10629792 | 3300009545 | Bacteria | 1079 |
| 277 | Ga0105237_10884182 | 3300009545 | Unclassified | 900 |
| 278 | Ga0105237_12173159 | 3300009545 | Bacteria | 564 |
| 279 | Ga0105238_10079918 | 3300009551 | Bacteria | 3259 |
| 280 | Ga0105238_10102620 | 3300009551 | Bacteria | 2841 |
| 281 | Ga0105238_11414675 | 3300009551 | Bacteria | 723 |
| 282 | Ga0105249_10025456 | 3300009553 | Bacteria | 5328 |
| 283 | Ga0105249_10027907 | 3300009553 | Bacteria | 5095 |
| 284 | Ga0105249_10087032 | 3300009553 | Bacteria | 2915 |
| 285 | Ga0105249_10247388 | 3300009553 | Bacteria | 1766 |
| 286 | Ga0105249_10432361 | 3300009553 | Bacteria | 1352 |
| 287 | Ga0105249_10934961 | 3300009553 | Bacteria | 935 |
| 288 | Ga0105249_12040307 | 3300009553 | Bacteria | 646 |
| 289 | Ga0105239_10001888 | 3300010375 | Bacteria | 27395 |
| 290 | Ga0105239_10038490 | 3300010375 | Bacteria | 5241 |
| 291 | Ga0105239_10218000 | 3300010375 | Bacteria | 2140 |
| 292 | Ga0105239_10717644 | 3300010375 | Bacteria | 1143 |
| 293 | Ga0105239_10750457 | 3300010375 | Bacteria | 1117 |
| 294 | Ga0105239_12728323 | 3300010375 | Bacteria | 576 |
| 295 | Ga0105239_12838920 | 3300010375 | Bacteria | 565 |
| 296 | Ga0105239_13019986 | 3300010375 | Bacteria | 548 |
| 297 | Ga0105246_10107348 | 3300011119 | Bacteria | 2044 |
| 298 | Ga0105246_10825886 | 3300011119 | Unclassified | 825 |
| 299 | Ga0105246_10903590 | 3300011119 | Bacteria | 792 |
| 300 | Ga0105246_12397709 | 3300011119 | Bacteria | 517 |
| 301 | Ga0157373_10003884 | 3300013100 | Bacteria | 11294 |
| 302 | Ga0157373_10300863 | 3300013100 | Bacteria | 1138 |
| 303 | Ga0157373_10340442 | 3300013100 | Bacteria | 1069 |
| 304 | Ga0157373_10992428 | 3300013100 | Bacteria | 626 |
| 305 | Ga0157371_10066429 | 3300013102 | Bacteria | 2553 |
| 306 | Ga0157371_10576598 | 3300013102 | Bacteria | 835 |
| 307 | Ga0157371_10847500 | 3300013102 | Bacteria | 691 |
| 308 | Ga0157370_10003253 | 3300013104 | Bacteria | 19143 |
| 309 | Ga0157370_10149775 | 3300013104 | Bacteria | 2172 |
| 310 | Ga0157370_10301326 | 3300013104 | Bacteria | 1479 |
| 311 | Ga0157370_10513005 | 3300013104 | Unclassified | 1101 |
| 312 | Ga0157369_10004961 | 3300013105 | Bacteria | 15592 |
| 313 | Ga0157369_10022438 | 3300013105 | Bacteria | 7043 |
| 314 | Ga0157369_10282780 | 3300013105 | Bacteria | 1728 |
| 315 | Ga0157369_10321308 | 3300013105 | Bacteria | 1609 |
| 316 | Ga0157369_11383196 | 3300013105 | Bacteria | 717 |
| 317 | Ga0157374_10005011 | 3300013296 | Bacteria | 11112 |
| 318 | Ga0157374_10057986 | 3300013296 | Bacteria | 3618 |
| 319 | Ga0157374_10233985 | 3300013296 | Bacteria | 1805 |
| 320 | Ga0157374_10861294 | 3300013296 | Bacteria | 923 |
| 321 | Ga0157374_12049466 | 3300013296 | Unclassified | 599 |
| 322 | Ga0157378_10005153 | 3300013297 | Bacteria | 11475 |
| 323 | Ga0157378_10011525 | 3300013297 | Bacteria | 7740 |
| 324 | Ga0157378_10012883 | 3300013297 | Bacteria | 7323 |
| 325 | Ga0157378_10019286 | 3300013297 | Bacteria | 5995 |
| 326 | Ga0157378_10120808 | 3300013297 | Bacteria | 2415 |
| 327 | Ga0157378_10365328 | 3300013297 | Bacteria | 1413 |
| 328 | Ga0157378_10591958 | 3300013297 | Unclassified | 1119 |
| 329 | Ga0157378_10731502 | 3300013297 | Unclassified | 1011 |
| 330 | Ga0157378_12012442 | 3300013297 | Unclassified | 628 |
| 331 | Ga0163162_10000086 | 3300013306 | Bacteria | 85949 |
| 332 | Ga0163162_10000464 | 3300013306 | Bacteria | 37564 |
| 333 | Ga0163162_10004156 | 3300013306 | Bacteria | 13900 |
| 334 | Ga0163162_10013496 | 3300013306 | Bacteria | 7975 |
| 335 | Ga0163162_10242378 | 3300013306 | Bacteria | 1934 |
| 336 | Ga0163162_10272042 | 3300013306 | Bacteria | 1826 |
| 337 | Ga0163162_10621079 | 3300013306 | Bacteria | 1206 |
| 338 | Ga0163162_10730753 | 3300013306 | Bacteria | 1110 |
| 339 | Ga0163162_10968537 | 3300013306 | Bacteria | 961 |
| 340 | Ga0157372_10020933 | 3300013307 | Bacteria | 7060 |
| 341 | Ga0157372_10024792 | 3300013307 | Bacteria | 6518 |
| 342 | Ga0157372_10033647 | 3300013307 | Bacteria | 5632 |
| 343 | Ga0157372_10048401 | 3300013307 | Bacteria | 4726 |
| 344 | Ga0157372_10054590 | 3300013307 | Bacteria | 4458 |
| 345 | Ga0157372_10054606 | 3300013307 | Bacteria | 4457 |
| 346 | Ga0157372_10658413 | 3300013307 | Bacteria | 1219 |
| 347 | Ga0157372_10755660 | 3300013307 | Bacteria | 1130 |
| 348 | Ga0157372_11569796 | 3300013307 | Bacteria | 758 |
| 349 | Ga0157372_13031117 | 3300013307 | Bacteria | 537 |
| 350 | Ga0157375_10000115 | 3300013308 | Bacteria | 77964 |
| 351 | Ga0157375_10027854 | 3300013308 | Bacteria | 5287 |
| 352 | Ga0157375_10132456 | 3300013308 | Unclassified | 2613 |
| 353 | Ga0157375_10281410 | 3300013308 | Bacteria | 1826 |
| 354 | Ga0157375_10447738 | 3300013308 | Bacteria | 1457 |
| 355 | Ga0157375_10529799 | 3300013308 | Bacteria | 1341 |
| 356 | Ga0157375_10561012 | 3300013308 | Bacteria | 1303 |
| 357 | Ga0157375_10751224 | 3300013308 | Bacteria | 1127 |
| 358 | Ga0157375_10789743 | 3300013308 | Bacteria | 1099 |
| 359 | Ga0157375_10800290 | 3300013308 | Unclassified | 1091 |
| 360 | Ga0157375_10866269 | 3300013308 | Bacteria | 1049 |
| 361 | Ga0157375_10902366 | 3300013308 | Bacteria | 1028 |
| 362 | Ga0163163_10396031 | 3300014325 | Bacteria | 1439 |
| 363 | Ga0163163_10433688 | 3300014325 | Bacteria | 1373 |
| 364 | Ga0163163_11003109 | 3300014325 | Unclassified | 898 |
| 365 | Ga0163163_11007566 | 3300014325 | Bacteria | 896 |
| 366 | Ga0163163_12095391 | 3300014325 | Unclassified | 625 |
| 367 | Ga0157380_10008681 | 3300014326 | Bacteria | 7263 |
| 368 | Ga0157380_10189007 | 3300014326 | Unclassified | 1816 |
| 369 | Ga0157380_10781112 | 3300014326 | Bacteria | 970 |
| 370 | Ga0157380_11730613 | 3300014326 | Bacteria | 683 |
| 371 | Ga0157377_10006202 | 3300014745 | Bacteria | 5686 |
| 372 | Ga0157377_10098365 | 3300014745 | Unclassified | 1739 |
| 373 | Ga0157377_10376927 | 3300014745 | Bacteria | 959 |
| 374 | Ga0157377_10716034 | 3300014745 | Bacteria | 728 |
| 375 | Ga0157379_10033649 | 3300014968 | Bacteria | 4571 |
| 376 | Ga0157379_10590918 | 3300014968 | Bacteria | 1036 |
| 377 | Ga0157379_10784602 | 3300014968 | Bacteria | 898 |
| 378 | Ga0157376_10001060 | 3300014969 | Bacteria | 18012 |
| 379 | Ga0157376_10243590 | 3300014969 | Bacteria | 1676 |
| 380 | Ga0157376_10972044 | 3300014969 | Bacteria | 870 |
| 381 | Ga0157376_11132678 | 3300014969 | Bacteria | 809 |
| 382 | Ga0182005_1198308 | 3300015265 | Bacteria | 603 |
| 383 | Ga0163161_10006573 | 3300017792 | Bacteria | 8049 |
| 384 | Ga0163161_10010591 | 3300017792 | Bacteria | 6383 |
| 385 | Ga0163161_10065108 | 3300017792 | Bacteria | 2660 |
| 386 | Ga0163161_11998025 | 3300017792 | Bacteria | 516 |
| 387 | Ga0213876_10002683 | 3300021384 | Bacteria | 10387 |
| 388 | Ga0213876_10042901 | 3300021384 | Bacteria | 2390 |
| 389 | Ga0213876_10580682 | 3300021384 | Bacteria | 596 |
| 390 | Ga0207666_1007296 | 3300025271 | Bacteria | 1453 |
| 391 | Ga0207426_1000170 | 3300025302 | Bacteria | 164216 |
| 392 | Ga0207697_10051902 | 3300025315 | Bacteria | 1695 |
| 393 | Ga0207656_10037489 | 3300025321 | Bacteria | 2040 |
| 394 | Ga0207656_10439569 | 3300025321 | Bacteria | 658 |
| 395 | Ga0207656_10493150 | 3300025321 | Bacteria | 621 |
| 396 | Ga0207682_10015346 | 3300025893 | Bacteria | 2982 |
| 397 | Ga0207682_10457084 | 3300025893 | Unclassified | 605 |
| 398 | Ga0207692_10098521 | 3300025898 | Bacteria | 1600 |
| 399 | Ga0207642_10266579 | 3300025899 | Bacteria | 979 |
| 400 | Ga0207642_10401491 | 3300025899 | Bacteria | 820 |
| 401 | Ga0207688_10282020 | 3300025901 | Bacteria | 1012 |
| 402 | Ga0207680_10104366 | 3300025903 | Bacteria | 1827 |
| 403 | Ga0207680_10696142 | 3300025903 | Bacteria | 728 |
| 404 | Ga0207680_10780871 | 3300025903 | Bacteria | 685 |
| 405 | Ga0207647_10014937 | 3300025904 | Bacteria | 5336 |
| 406 | Ga0207647_10179952 | 3300025904 | Bacteria | 1228 |
| 407 | Ga0207647_10211054 | 3300025904 | Bacteria | 1121 |
| 408 | Ga0207685_10352099 | 3300025905 | Bacteria | 743 |
| 409 | Ga0207645_10074490 | 3300025907 | Bacteria | 2173 |
| 410 | Ga0207643_10041304 | 3300025908 | Bacteria | 2599 |
| 411 | Ga0207643_10242777 | 3300025908 | Bacteria | 1108 |
| 412 | Ga0207643_10459958 | 3300025908 | Bacteria | 810 |
| 413 | Ga0207705_10098526 | 3300025909 | Bacteria | 2148 |
| 414 | Ga0207705_10994000 | 3300025909 | Unclassified | 648 |
| 415 | Ga0207654_10819695 | 3300025911 | Bacteria | 673 |
| 416 | Ga0207654_11019422 | 3300025911 | Bacteria | 602 |
| 417 | Ga0207707_10148968 | 3300025912 | Bacteria | 2046 |
| 418 | Ga0207707_10688136 | 3300025912 | Bacteria | 859 |
| 419 | Ga0207695_10791457 | 3300025913 | Bacteria | 828 |
| 420 | Ga0207671_10024059 | 3300025914 | Bacteria | 4584 |
| 421 | Ga0207671_10583542 | 3300025914 | Unclassified | 891 |
| 422 | Ga0207663_10682873 | 3300025916 | Bacteria | 812 |
| 423 | Ga0207660_10341093 | 3300025917 | Bacteria | 1199 |
| 424 | Ga0207660_10808190 | 3300025917 | Bacteria | 765 |
| 425 | Ga0207662_10039442 | 3300025918 | Bacteria | 2771 |
| 426 | Ga0207662_10110915 | 3300025918 | Bacteria | 1710 |
| 427 | Ga0207657_10010494 | 3300025919 | Bacteria | 9240 |
| 428 | Ga0207657_10316532 | 3300025919 | Bacteria | 1234 |
| 429 | Ga0207649_10427298 | 3300025920 | Bacteria | 996 |
| 430 | Ga0207649_10624932 | 3300025920 | Bacteria | 830 |
| 431 | Ga0207649_10745036 | 3300025920 | Bacteria | 762 |
| 432 | Ga0207649_10848645 | 3300025920 | Unclassified | 714 |
| 433 | Ga0207652_10131694 | 3300025921 | Bacteria | 2230 |
| 434 | Ga0207652_10165910 | 3300025921 | Bacteria | 1980 |
| 435 | Ga0207652_11806204 | 3300025921 | Bacteria | 516 |
| 436 | Ga0207646_10228377 | 3300025922 | Bacteria | 1682 |
| 437 | Ga0207681_10288536 | 3300025923 | Bacteria | 1294 |
| 438 | Ga0207681_10545827 | 3300025923 | Bacteria | 953 |
| 439 | Ga0207681_10696015 | 3300025923 | Unclassified | 845 |
| 440 | Ga0207681_11073802 | 3300025923 | Bacteria | 676 |
| 441 | Ga0207681_11203718 | 3300025923 | Bacteria | 636 |
| 442 | Ga0207681_11844561 | 3300025923 | Bacteria | 504 |
| 443 | Ga0207694_10320601 | 3300025924 | Bacteria | 1279 |
| 444 | Ga0207650_10032059 | 3300025925 | Bacteria | 3800 |
| 445 | Ga0207650_10135502 | 3300025925 | Bacteria | 1931 |
| 446 | Ga0207650_10793840 | 3300025925 | Unclassified | 802 |
| 447 | Ga0207650_10884667 | 3300025925 | Bacteria | 758 |
| 448 | Ga0207659_10487047 | 3300025926 | Bacteria | 1042 |
| 449 | Ga0207659_11061442 | 3300025926 | Bacteria | 697 |
| 450 | Ga0207644_10013035 | 3300025931 | Bacteria | 5533 |
| 451 | Ga0207644_10914854 | 3300025931 | Bacteria | 735 |
| 452 | Ga0207690_10016741 | 3300025932 | Bacteria | 4467 |
| 453 | Ga0207690_11453891 | 3300025932 | Bacteria | 573 |
| 454 | Ga0207706_10009158 | 3300025933 | Bacteria | 9104 |
| 455 | Ga0207686_10000429 | 3300025934 | Bacteria | 28636 |
| 456 | Ga0207686_10076175 | 3300025934 | Bacteria | 2174 |
| 457 | Ga0207686_10446922 | 3300025934 | Bacteria | 994 |
| 458 | Ga0207686_10868051 | 3300025934 | Bacteria | 727 |
| 459 | Ga0207686_11689175 | 3300025934 | Unclassified | 523 |
| 460 | Ga0207670_10364557 | 3300025936 | Bacteria | 1147 |
| 461 | Ga0207670_11726164 | 3300025936 | Unclassified | 532 |
| 462 | Ga0207669_10782733 | 3300025937 | Bacteria | 790 |
| 463 | Ga0207669_10963429 | 3300025937 | Bacteria | 715 |
| 464 | Ga0207704_10115657 | 3300025938 | Bacteria | 1823 |
| 465 | Ga0207704_10125735 | 3300025938 | Bacteria | 1765 |
| 466 | Ga0207704_10517668 | 3300025938 | Bacteria | 964 |
| 467 | Ga0207704_11495476 | 3300025938 | Bacteria | 579 |
| 468 | Ga0207691_10504339 | 3300025940 | Bacteria | 1027 |
| 469 | Ga0207691_10863763 | 3300025940 | Unclassified | 758 |
| 470 | Ga0207711_10070479 | 3300025941 | Bacteria | 3032 |
| 471 | Ga0207689_10019898 | 3300025942 | Bacteria | 5653 |
| 472 | Ga0207689_10341002 | 3300025942 | Unclassified | 1245 |
| 473 | Ga0207661_10021161 | 3300025944 | Unclassified | 4874 |
| 474 | Ga0207661_10372998 | 3300025944 | Bacteria | 1290 |
| 475 | Ga0207661_11911373 | 3300025944 | Unclassified | 539 |
| 476 | Ga0207679_10032071 | 3300025945 | Bacteria | 3684 |
| 477 | Ga0207679_10182779 | 3300025945 | Bacteria | 1736 |
| 478 | Ga0207679_10188840 | 3300025945 | Bacteria | 1711 |
| 479 | Ga0207679_10899560 | 3300025945 | Bacteria | 810 |
| 480 | Ga0207667_10001711 | 3300025949 | Bacteria | 27600 |
| 481 | Ga0207667_10140405 | 3300025949 | Bacteria | 2487 |
| 482 | Ga0207651_10150943 | 3300025960 | Bacteria | 1808 |
| 483 | Ga0207651_10152963 | 3300025960 | Bacteria | 1798 |
| 484 | Ga0207651_10264589 | 3300025960 | Bacteria | 1413 |
| 485 | Ga0207651_11159372 | 3300025960 | Bacteria | 693 |
| 486 | Ga0207712_10003042 | 3300025961 | Bacteria | 10707 |
| 487 | Ga0207712_10011848 | 3300025961 | Bacteria | 5559 |
| 488 | Ga0207712_10034955 | 3300025961 | Bacteria | 3410 |
| 489 | Ga0207712_10087178 | 3300025961 | Bacteria | 2288 |
| 490 | Ga0207712_10551514 | 3300025961 | Bacteria | 991 |
| 491 | Ga0207712_10866905 | 3300025961 | Bacteria | 796 |
| 492 | Ga0207712_11881378 | 3300025961 | Unclassified | 536 |
| 493 | Ga0207668_10274404 | 3300025972 | Bacteria | 1380 |
| 494 | Ga0207640_10027834 | 3300025981 | Bacteria | 3449 |
| 495 | Ga0207640_10147515 | 3300025981 | Bacteria | 1723 |
| 496 | Ga0207640_10231370 | 3300025981 | Bacteria | 1422 |
| 497 | Ga0207658_10021523 | 3300025986 | Bacteria | 4479 |
| 498 | Ga0207658_10134482 | 3300025986 | Bacteria | 1991 |
| 499 | Ga0207658_10444914 | 3300025986 | Bacteria | 1146 |
| 500 | Ga0207677_10003558 | 3300026023 | Bacteria | 8257 |
| 501 | Ga0207677_10019166 | 3300026023 | Bacteria | 4125 |
| 502 | Ga0207677_10352614 | 3300026023 | Bacteria | 1233 |
| 503 | Ga0207677_10727162 | 3300026023 | Bacteria | 883 |
| 504 | Ga0207677_10757576 | 3300026023 | Bacteria | 866 |
| 505 | Ga0207703_10199518 | 3300026035 | Bacteria | 1777 |
| 506 | Ga0207703_11450971 | 3300026035 | Bacteria | 660 |
| 507 | Ga0207703_12286230 | 3300026035 | Unclassified | 516 |
| 508 | Ga0207639_10051722 | 3300026041 | Bacteria | 3126 |
| 509 | Ga0207639_10315207 | 3300026041 | Bacteria | 1387 |
| 510 | Ga0207639_10400178 | 3300026041 | Bacteria | 1237 |
| 511 | Ga0207639_10653689 | 3300026041 | Unclassified | 973 |
| 512 | Ga0207639_10975943 | 3300026041 | Bacteria | 793 |
| 513 | Ga0207639_11136072 | 3300026041 | Bacteria | 733 |
| 514 | Ga0207639_11177477 | 3300026041 | Unclassified | 719 |
| 515 | Ga0207678_10358172 | 3300026067 | Bacteria | 1259 |
| 516 | Ga0207678_10656454 | 3300026067 | Unclassified | 922 |
| 517 | Ga0207708_10218247 | 3300026075 | Bacteria | 1527 |
| 518 | Ga0207702_10128680 | 3300026078 | Bacteria | 2276 |
| 519 | Ga0207702_10737277 | 3300026078 | Bacteria | 972 |
| 520 | Ga0207641_10011426 | 3300026088 | Bacteria | 7288 |
| 521 | Ga0207641_10091145 | 3300026088 | Bacteria | 2667 |
| 522 | Ga0207641_10181821 | 3300026088 | Bacteria | 1926 |
| 523 | Ga0207641_10222608 | 3300026088 | Bacteria | 1750 |
| 524 | Ga0207648_10094936 | 3300026089 | Bacteria | 2608 |
| 525 | Ga0207648_10146511 | 3300026089 | Bacteria | 2083 |
| 526 | Ga0207648_10384590 | 3300026089 | Unclassified | 1269 |
| 527 | Ga0207648_10463611 | 3300026089 | Bacteria | 1155 |
| 528 | Ga0207648_11126018 | 3300026089 | Bacteria | 736 |
| 529 | Ga0207648_11213489 | 3300026089 | Unclassified | 708 |
| 530 | Ga0207648_11346704 | 3300026089 | Bacteria | 671 |
| 531 | Ga0207676_10064837 | 3300026095 | Bacteria | 2907 |
| 532 | Ga0207676_10081633 | 3300026095 | Bacteria | 2627 |
| 533 | Ga0207676_10281340 | 3300026095 | Bacteria | 1510 |
| 534 | Ga0207676_10355968 | 3300026095 | Bacteria | 1355 |
| 535 | Ga0207676_12142943 | 3300026095 | Bacteria | 557 |
| 536 | Ga0207674_10197620 | 3300026116 | Bacteria | 1960 |
| 537 | Ga0207674_10242487 | 3300026116 | Bacteria | 1749 |
| 538 | Ga0207674_10527578 | 3300026116 | Bacteria | 1140 |
| 539 | Ga0207674_10593369 | 3300026116 | Bacteria | 1070 |
| 540 | Ga0207675_100007383 | 3300026118 | Bacteria | 10388 |
| 541 | Ga0207675_100398640 | 3300026118 | Bacteria | 1356 |
| 542 | Ga0207675_101942683 | 3300026118 | Bacteria | 606 |
| 543 | Ga0207683_10031651 | 3300026121 | Bacteria | 4591 |
| 544 | Ga0207683_10954669 | 3300026121 | Bacteria | 796 |
| 545 | Ga0207698_10003137 | 3300026142 | Bacteria | 9906 |
| 546 | Ga0207698_10036585 | 3300026142 | Bacteria | 3605 |
| 547 | Ga0207698_10042824 | 3300026142 | Bacteria | 3387 |
| 548 | Ga0207698_10096703 | 3300026142 | Bacteria | 2434 |
| 549 | Ga0207698_10733129 | 3300026142 | Bacteria | 986 |
| 550 | Ga0207698_11607100 | 3300026142 | Bacteria | 665 |
| 551 | Ga0207428_10085361 | 3300027907 | Bacteria | 2458 |
| 552 | Ga0207428_10730359 | 3300027907 | Bacteria | 707 |
| 553 | Ga0207428_11134351 | 3300027907 | Bacteria | 545 |
| 554 | Ga0268266_10000071 | 3300028379 | Bacteria | 232887 |
| 555 | Ga0268266_10347496 | 3300028379 | Bacteria | 1393 |
| 556 | Ga0268265_10052843 | 3300028380 | Bacteria | 3075 |
| 557 | Ga0268265_10302748 | 3300028380 | Bacteria | 1440 |
| 558 | Ga0268265_11264157 | 3300028380 | Unclassified | 737 |
| 559 | Ga0268265_12231541 | 3300028380 | Bacteria | 554 |
| 560 | Ga0268264_10001196 | 3300028381 | Bacteria | 25064 |
| 561 | Ga0268264_10236965 | 3300028381 | Bacteria | 1688 |
| 562 | Ga0268264_11890866 | 3300028381 | Bacteria | 607 |
| 563 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 564 | Ga0265338_10125422 | 3300028800 | Bacteria | 2038 |
| 565 | Ga0265324_10115654 | 3300029957 | Bacteria | 911 |
| 566 | Ga0307511_10002930 | 3300030521 | Bacteria | 17674 |
| 567 | Ga0265327_10025126 | 3300031251 | Bacteria | 3481 |
| 568 | Ga0265316_10315997 | 3300031344 | Bacteria | 1135 |
| 569 | Ga0307513_10170590 | 3300031456 | Bacteria | 2054 |
| 570 | Ga0307513_10319197 | 3300031456 | Bacteria | 1312 |
| 571 | Ga0307513_11063533 | 3300031456 | Bacteria | 520 |
| 572 | Ga0307509_10679272 | 3300031507 | Bacteria | 697 |
| 573 | Ga0307509_10712124 | 3300031507 | Bacteria | 670 |
| 574 | Ga0307408_100700099 | 3300031548 | Bacteria | 911 |
| 575 | Ga0307408_102490317 | 3300031548 | Bacteria | 503 |
| 576 | Ga0307516_10368767 | 3300031730 | Bacteria | 1099 |
| 577 | Ga0307413_10386864 | 3300031824 | Bacteria | 1092 |
| 578 | Ga0307409_102742989 | 3300031995 | Bacteria | 521 |
| 579 | Ga0307411_12138135 | 3300032005 | Bacteria | 524 |
| 580 | Ga0307415_101342483 | 3300032126 | Bacteria | 679 |
| 581 | Ga0373937_0454279 | 3300036401 | Bacteria | 1217 |
| 582 | Ga0395900_0529223 | 3300037418 | Unclassified | 1126 |
| 583 | Ga0395900_1283570 | 3300037418 | Unclassified | 646 |
| 584 | Ga0395905_0422485 | 3300037471 | Bacteria | 1229 |
| 585 | Ga0395905_1186790 | 3300037471 | Unclassified | 667 |
| 586 | Ga0395901_0821317 | 3300038443 | Bacteria | 917 |
| 587 | Ga0436365_0014802 | 3300039437 | Bacteria | 848 |
| 588 | Ga0436365_0038916 | 3300039437 | Bacteria | 17419 |
| 589 | Ga0436365_0852964 | 3300039437 | Bacteria | 1240 |
| 590 | Ga0436365_1788000 | 3300039437 | Bacteria | 1547 |
| 591 | Ga0436365_1814713 | 3300039437 | Bacteria | 12344 |
| 592 | Ga0439439_0137581 | 3300041406 | Bacteria | 688 |
| 593 | Ga0451800_1534946 | 3300041459 | Bacteria | 1689 |
| 594 | Ga0451804_0788977 | 3300041463 | Bacteria | 1063 |
| 595 | Ga0451807_1622340 | 3300041486 | Unclassified | 577 |
| 596 | Ga0451839_1103437 | 3300041496 | Bacteria | 502 |
| 597 | Ga0451851_1010984 | 3300041507 | Bacteria | 693 |
| 598 | Ga0451853_1577816 | 3300041512 | Bacteria | 1417 |
| 599 | Ga0451853_1587238 | 3300041512 | Bacteria | 586 |
| 600 | Ga0451853_2545082 | 3300041512 | Bacteria | 1431 |
| 601 | Ga0439441_001071 | 3300042001 | Bacteria | 3399 |
| 602 | Ga0439441_084094 | 3300042001 | Bacteria | 697 |
| 603 | Ga0439449_0001249 | 3300042007 | Bacteria | 9967 |
| 604 | Ga0439457_005901 | 3300042014 | Bacteria | 3036 |
| 605 | Ga0439457_147102 | 3300042014 | Bacteria | 566 |
| 606 | Ga0439462_0076497 | 3300042015 | Bacteria | 912 |
| 607 | Ga0450923_162377 | 3300042125 | Unclassified | 544 |
| 608 | Ga0439444_0020005 | 3300042437 | Bacteria | 1174 |
| 609 | Ga0453684_2523482 | 3300044712 | Bacteria | 507 |
| 610 | Ga0466967_0362708 | 3300045976 | Bacteria | 1404 |
| 611 | Ga0495629_0960488 | 3300046459 | Unclassified | 558 |
| 612 | Ga0495594_0034689 | 3300046499 | Bacteria | 2746 |
| 613 | Ga0495648_0006665 | 3300046524 | Bacteria | 9353 |
| 614 | Ga0495598_0032877 | 3300046537 | Bacteria | 1469 |
| 615 | Ga0495621_0106672 | 3300046539 | Bacteria | 1071 |
| 616 | Ga0495667_0188037 | 3300046559 | Bacteria | 1324 |
| 617 | Ga0495656_0193085 | 3300046615 | Bacteria | 1007 |
| 618 | Ga0495634_0438545 | 3300046642 | Bacteria | 772 |
| 619 | Ga0495635_0346618 | 3300046663 | Bacteria | 991 |
| 620 | Ga0495670_0379402 | 3300046691 | Bacteria | 763 |
| 621 | Ga0495674_0207326 | 3300047319 | Bacteria | 1625 |
| 622 | Ga0495676_0305635 | 3300047321 | Bacteria | 1072 |
| 623 | Ga0495684_0711238 | 3300047471 | Bacteria | 665 |
| 624 | Ga0495615_0059635 | 3300048090 | Bacteria | 1004 |
| 625 | Ga0496100_0424305 | 3300048903 | Bacteria | 1016 |
| 626 | Ga0496101_0322326 | 3300048904 | Bacteria | 1212 |
| 627 | Ga0496104_0865350 | 3300048907 | Bacteria | 809 |
| 628 | Ga0496106_1455033 | 3300048909 | Bacteria | 528 |
| 629 | Ga0496114_0006425 | 3300048917 | Bacteria | 9254 |
| 630 | Ga0496114_1395005 | 3300048917 | Bacteria | 588 |
| 631 | Ga0496120_0349754 | 3300048923 | Bacteria | 664 |
| 632 | Ga0501300_059896 | 3300049523 | Unclassified | 601 |
| 633 | Ga0501031_0008041 | 3300049568 | Bacteria | 6868 |
| 634 | Ga0501032_0070165 | 3300049569 | Bacteria | 2337 |
| 635 | Ga0501032_0201920 | 3300049569 | Bacteria | 1297 |
| 636 | Ga0501033_0092551 | 3300049570 | Bacteria | 2211 |
| 637 | Ga0501034_0008845 | 3300049571 | Bacteria | 10590 |
| 638 | Ga0501034_0028381 | 3300049571 | Bacteria | 5694 |
| 639 | Ga0501034_0098974 | 3300049571 | Bacteria | 2911 |
| 640 | Ga0501034_0119357 | 3300049571 | Unclassified | 2623 |
| 641 | Ga0501036_0030055 | 3300049572 | Bacteria | 4589 |
| 642 | Ga0501037_0072787 | 3300049573 | Bacteria | 2499 |
| 643 | Ga0501037_0208357 | 3300049573 | Unclassified | 1379 |
| 644 | Ga0501038_0011536 | 3300049574 | Bacteria | 8063 |
| 645 | Ga0501038_0073780 | 3300049574 | Bacteria | 2888 |
| 646 | Ga0501039_0057892 | 3300049575 | Bacteria | 3001 |
| 647 | Ga0501039_0116502 | 3300049575 | Bacteria | 2091 |
| 648 | Ga0501043_0008513 | 3300049579 | Bacteria | 8078 |
| 649 | Ga0501043_0074448 | 3300049579 | Bacteria | 2667 |
| 650 | Ga0501046_0191848 | 3300049580 | Unclassified | 1523 |
| 651 | Ga0501047_0137884 | 3300049581 | Bacteria | 2319 |
| 652 | Ga0501047_0620885 | 3300049581 | Bacteria | 902 |
| 653 | Ga0501072_0387387 | 3300049588 | Bacteria | 1109 |
| 654 | Ga0501073_1059625 | 3300049589 | Bacteria | 557 |
| 655 | Ga0501219_000734 | 3300049703 | Bacteria | 4447 |
| 656 | Ga0501225_0066205 | 3300049705 | Bacteria | 1021 |
| 657 | Ga0501225_0073536 | 3300049705 | Unclassified | 974 |
| 658 | Ga0501080_0104269 | 3300049742 | Unclassified | 2630 |
| 659 | Ga0501080_0186850 | 3300049742 | Bacteria | 1905 |
| 660 | Ga0501035_0208234 | 3300049822 | Bacteria | 1674 |
| 661 | Ga0501044_0018314 | 3300049823 | Bacteria | 7505 |
| 662 | Ga0501044_0124634 | 3300049823 | Bacteria | 2574 |
| 663 | Ga0501044_0192163 | 3300049823 | Bacteria | 2003 |
| 664 | Ga0501044_0270035 | 3300049823 | Bacteria | 1637 |
| 665 | Ga0501284_00005 | 3300050005 | Bacteria | 164758 |
| 666 | nmdc:mga0k408_390250_c1 | 3300050493 | Bacteria | 829 |
| 667 | nmdc:mga05p37_242686_c1 | 3300050507 | Bacteria | 2165 |
| 668 | nmdc:mga09592_10511_c1 | 3300050508 | Bacteria | 7532 |
| 669 | nmdc:mga09592_961456_c1 | 3300050508 | Unclassified | 715 |
| 670 | nmdc:mga0qj67_15755_c1 | 3300050509 | Bacteria | 5726 |
| 671 | nmdc:mga0qj67_337731_c1 | 3300050509 | Bacteria | 1219 |
| 672 | nmdc:mga06r32_243882_c1 | 3300050510 | Bacteria | 1784 |
| 673 | nmdc:mga06r32_38982_c1 | 3300050510 | Bacteria | 4505 |
| 674 | nmdc:mga08y16_124164_c1 | 3300050511 | Bacteria | 2686 |
| 675 | nmdc:mga08y16_1580117_c1 | 3300050511 | Bacteria | 614 |
| 676 | nmdc:mga08y16_1859433_c1 | 3300050511 | Bacteria | 554 |
| 677 | nmdc:mga08y16_250255_c1 | 3300050511 | Bacteria | 1831 |
| 678 | Ga0500644_0106368 | 3300053088 | Bacteria | 1074 |
| 679 | Ga0500646_0026750 | 3300053090 | Bacteria | 1566 |
| 680 | Ga0500646_0028265 | 3300053090 | Bacteria | 1530 |
| 681 | Ga0500646_0058421 | 3300053090 | Bacteria | 1129 |
| 682 | Ga0500583_0022499 | 3300053092 | Bacteria | 2642 |
| 683 | Ga0500562_000035 | 3300053108 | Bacteria | 81116 |
| 684 | Ga0500559_0154224 | 3300053136 | Bacteria | 1078 |
| 685 | Ga0500616_0080369 | 3300053153 | Bacteria | 1639 |
| 686 | Ga0500622_0000298 | 3300053156 | Bacteria | 50798 |
| 687 | Ga0500622_0004063 | 3300053156 | Bacteria | 9401 |
| 688 | Ga0500645_064797 | 3300053730 | Bacteria | 1053 |
| 689 | Ga0500661_016655 | 3300055283 | Bacteria | 1314 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050511 | nmdc:mga08y16_1580117_c1 | nmdc:mga08y16_1580117_c1_54_377 | 107 |
| 2 | 3300053153 | Ga0500616_0080369 | Ga0500616_0080369_1283_1609 | 107 |
| 3 | 3300053730 | Ga0500645_064797 | Ga0500645_064797_33_359 | 107 |
| 4 | 3300025961 | Ga0207712_11881378 | Ga0207712_118813781 | 110 |
| 5 | 3300005438 | Ga0070701_10081869 | Ga0070701_100818692 | 113 |
| 6 | 3300013296 | Ga0157374_10233985 | Ga0157374_102339853 | 115 |
| 7 | 3300013308 | Ga0157375_10866269 | Ga0157375_108662691 | 118 |
| 8 | 3300014326 | Ga0157380_11730613 | Ga0157380_117306131 | 118 |
| 9 | 3300005340 | Ga0070689_101182814 | Ga0070689_1011828141 | 119 |
| 10 | 3300005353 | Ga0070669_100600415 | Ga0070669_1006004152 | 119 |
| 11 | 3300005543 | Ga0070672_101261771 | Ga0070672_1012617712 | 119 |
| 12 | 3300005618 | Ga0068864_101149251 | Ga0068864_1011492512 | 119 |
| 13 | 3300025918 | Ga0207662_10110915 | Ga0207662_101109152 | 119 |
| 14 | 3300025923 | Ga0207681_11203718 | Ga0207681_112037182 | 119 |
| 15 | 3300025934 | Ga0207686_11689175 | Ga0207686_116891751 | 119 |
| 16 | 3300025936 | Ga0207670_11726164 | Ga0207670_117261641 | 119 |
| 17 | 3300025945 | Ga0207679_10182779 | Ga0207679_101827793 | 119 |
| 18 | 3300026089 | Ga0207648_11346704 | Ga0207648_113467041 | 119 |
| 19 | iso_pu_bacteria | 2929154850 | 2929160073 | 122 |
| 20 | 3300027907 | Ga0207428_10085361 | Ga0207428_100853613 | 124 |
| 21 | 3300005288 | Ga0065714_10343038 | Ga0065714_103430381 | 125 |
| 22 | 3300005288 | Ga0065714_10403580 | Ga0065714_104035801 | 125 |
| 23 | 3300005289 | Ga0065704_10375605 | Ga0065704_103756052 | 125 |
| 24 | 3300005290 | Ga0065712_10001725 | Ga0065712_100017258 | 125 |
| 25 | 3300005290 | Ga0065712_10003696 | Ga0065712_100036962 | 125 |
| 26 | 3300005293 | Ga0065715_10002173 | Ga0065715_100021733 | 125 |
| 27 | 3300005295 | Ga0065707_10127439 | Ga0065707_101274392 | 125 |
| 28 | 3300005295 | Ga0065707_10171062 | Ga0065707_101710622 | 125 |
| 29 | 3300005331 | Ga0070670_100188277 | Ga0070670_1001882773 | 125 |
| 30 | 3300005331 | Ga0070670_100728859 | Ga0070670_1007288592 | 125 |
| 31 | 3300005331 | Ga0070670_101076922 | Ga0070670_1010769222 | 125 |
| 32 | 3300005333 | Ga0070677_10030389 | Ga0070677_100303893 | 125 |
| 33 | 3300005333 | Ga0070677_10417757 | Ga0070677_104177572 | 125 |
| 34 | 3300005334 | Ga0068869_100108348 | Ga0068869_1001083482 | 125 |
| 35 | 3300005334 | Ga0068869_100134207 | Ga0068869_1001342073 | 125 |
| 36 | 3300005334 | Ga0068869_100328471 | Ga0068869_1003284712 | 125 |
| 37 | 3300005337 | Ga0070682_100235899 | Ga0070682_1002358992 | 125 |
| 38 | 3300005340 | Ga0070689_100054741 | Ga0070689_1000547412 | 125 |
| 39 | 3300005340 | Ga0070689_100753677 | Ga0070689_1007536772 | 125 |
| 40 | 3300005340 | Ga0070689_101199668 | Ga0070689_1011996682 | 125 |
| 41 | 3300005341 | Ga0070691_10089528 | Ga0070691_100895282 | 125 |
| 42 | 3300005343 | Ga0070687_100155599 | Ga0070687_1001555993 | 125 |
| 43 | 3300005343 | Ga0070687_100996376 | Ga0070687_1009963762 | 125 |
| 44 | 3300005343 | Ga0070687_101106574 | Ga0070687_1011065742 | 125 |
| 45 | 3300005347 | Ga0070668_100356185 | Ga0070668_1003561852 | 125 |
| 46 | 3300005353 | Ga0070669_100627282 | Ga0070669_1006272822 | 125 |
| 47 | 3300005353 | Ga0070669_101010914 | Ga0070669_1010109141 | 125 |
| 48 | 3300005353 | Ga0070669_101614860 | Ga0070669_1016148602 | 125 |
| 49 | 3300005353 | Ga0070669_101746479 | Ga0070669_1017464791 | 125 |
| 50 | 3300005354 | Ga0070675_100048920 | Ga0070675_1000489203 | 125 |
| 51 | 3300005354 | Ga0070675_100816683 | Ga0070675_1008166832 | 125 |
| 52 | 3300005355 | Ga0070671_101413896 | Ga0070671_1014138961 | 125 |
| 53 | 3300005356 | Ga0070674_100221708 | Ga0070674_1002217081 | 125 |
| 54 | 3300005356 | Ga0070674_100505232 | Ga0070674_1005052322 | 125 |
| 55 | 3300005364 | Ga0070673_100023983 | Ga0070673_1000239833 | 125 |
| 56 | 3300005364 | Ga0070673_100110151 | Ga0070673_1001101513 | 125 |
| 57 | 3300005365 | Ga0070688_100012568 | Ga0070688_1000125681 | 125 |
| 58 | 3300005438 | Ga0070701_10078103 | Ga0070701_100781032 | 125 |
| 59 | 3300005441 | Ga0070700_100116326 | Ga0070700_1001163262 | 125 |
| 60 | 3300005444 | Ga0070694_100467393 | Ga0070694_1004673931 | 125 |
| 61 | 3300005459 | Ga0068867_101197224 | Ga0068867_1011972242 | 125 |
| 62 | 3300005466 | Ga0070685_10270614 | Ga0070685_102706141 | 125 |
| 63 | 3300005466 | Ga0070685_10338963 | Ga0070685_103389632 | 125 |
| 64 | 3300005468 | Ga0070707_100143289 | Ga0070707_1001432893 | 125 |
| 65 | 3300005471 | Ga0070698_100000267 | Ga0070698_1000002673 | 125 |
| 66 | 3300005536 | Ga0070697_100330333 | Ga0070697_1003303332 | 125 |
| 67 | 3300005539 | Ga0068853_100802234 | Ga0068853_1008022341 | 125 |
| 68 | 3300005543 | Ga0070672_100311963 | Ga0070672_1003119632 | 125 |
| 69 | 3300005543 | Ga0070672_101279245 | Ga0070672_1012792452 | 125 |
| 70 | 3300005544 | Ga0070686_100756874 | Ga0070686_1007568742 | 125 |
| 71 | 3300005549 | Ga0070704_100048379 | Ga0070704_1000483794 | 125 |
| 72 | 3300005549 | Ga0070704_100382258 | Ga0070704_1003822582 | 125 |
| 73 | 3300005577 | Ga0068857_100014523 | Ga0068857_1000145235 | 125 |
| 74 | 3300005578 | Ga0068854_100982093 | Ga0068854_1009820932 | 125 |
| 75 | 3300005615 | Ga0070702_101007560 | Ga0070702_1010075602 | 125 |
| 76 | 3300005616 | Ga0068852_100170673 | Ga0068852_1001706732 | 125 |
| 77 | 3300005617 | Ga0068859_100076094 | Ga0068859_1000760942 | 125 |
| 78 | 3300005617 | Ga0068859_100514566 | Ga0068859_1005145662 | 125 |
| 79 | 3300005617 | Ga0068859_100590054 | Ga0068859_1005900542 | 125 |
| 80 | 3300005617 | Ga0068859_100774946 | Ga0068859_1007749462 | 125 |
| 81 | 3300005617 | Ga0068859_100820479 | Ga0068859_1008204793 | 125 |
| 82 | 3300005617 | Ga0068859_101670103 | Ga0068859_1016701032 | 125 |
| 83 | 3300005617 | Ga0068859_102806984 | Ga0068859_1028069842 | 125 |
| 84 | 3300005618 | Ga0068864_100632865 | Ga0068864_1006328651 | 125 |
| 85 | 3300005618 | Ga0068864_102048744 | Ga0068864_1020487441 | 125 |
| 86 | 3300005719 | Ga0068861_100019358 | Ga0068861_1000193586 | 125 |
| 87 | 3300005719 | Ga0068861_100126207 | Ga0068861_1001262073 | 125 |
| 88 | 3300005841 | Ga0068863_100039165 | Ga0068863_1000391652 | 125 |
| 89 | 3300005841 | Ga0068863_100778736 | Ga0068863_1007787361 | 125 |
| 90 | 3300005842 | Ga0068858_101002155 | Ga0068858_1010021552 | 125 |
| 91 | 3300005843 | Ga0068860_100431557 | Ga0068860_1004315572 | 125 |
| 92 | 3300005844 | Ga0068862_100189755 | Ga0068862_1001897553 | 125 |
| 93 | 3300005844 | Ga0068862_100865500 | Ga0068862_1008655001 | 125 |
| 94 | 3300006237 | Ga0097621_100363638 | Ga0097621_1003636381 | 125 |
| 95 | 3300006237 | Ga0097621_101328429 | Ga0097621_1013284292 | 125 |
| 96 | 3300006358 | Ga0068871_100567068 | Ga0068871_1005670682 | 125 |
| 97 | 3300006844 | Ga0075428_100003257 | Ga0075428_10000325716 | 125 |
| 98 | 3300006844 | Ga0075428_100019714 | Ga0075428_1000197147 | 125 |
| 99 | 3300006844 | Ga0075428_100068646 | Ga0075428_1000686464 | 125 |
| 100 | 3300006844 | Ga0075428_100568495 | Ga0075428_1005684952 | 125 |
| 101 | 3300006846 | Ga0075430_100018363 | Ga0075430_1000183633 | 125 |
| 102 | 3300006846 | Ga0075430_100199083 | Ga0075430_1001990832 | 125 |
| 103 | 3300006846 | Ga0075430_100425018 | Ga0075430_1004250182 | 125 |
| 104 | 3300006847 | Ga0075431_100092318 | Ga0075431_1000923183 | 125 |
| 105 | 3300006847 | Ga0075431_100118915 | Ga0075431_1001189153 | 125 |
| 106 | 3300006880 | Ga0075429_100054367 | Ga0075429_1000543674 | 125 |
| 107 | 3300006880 | Ga0075429_101567893 | Ga0075429_1015678932 | 125 |
| 108 | 3300006881 | Ga0068865_100303956 | Ga0068865_1003039562 | 125 |
| 109 | 3300006931 | Ga0097620_100076089 | Ga0097620_1000760892 | 125 |
| 110 | 3300006931 | Ga0097620_100514482 | Ga0097620_1005144822 | 125 |
| 111 | 3300006931 | Ga0097620_100590027 | Ga0097620_1005900272 | 125 |
| 112 | 3300006931 | Ga0097620_100774986 | Ga0097620_1007749862 | 125 |
| 113 | 3300006931 | Ga0097620_100820439 | Ga0097620_1008204392 | 125 |
| 114 | 3300006931 | Ga0097620_101670067 | Ga0097620_1016700671 | 125 |
| 115 | 3300006931 | Ga0097620_102807037 | Ga0097620_1028070372 | 125 |
| 116 | 3300009011 | Ga0105251_10167846 | Ga0105251_101678462 | 125 |
| 117 | 3300009094 | Ga0111539_11027871 | Ga0111539_110278712 | 125 |
| 118 | 3300009147 | Ga0114129_10270014 | Ga0114129_102700143 | 125 |
| 119 | 3300009147 | Ga0114129_11243441 | Ga0114129_112434412 | 125 |
| 120 | 3300009174 | Ga0105241_10616681 | Ga0105241_106166811 | 125 |
| 121 | 3300009176 | Ga0105242_10598981 | Ga0105242_105989812 | 125 |
| 122 | 3300009176 | Ga0105242_11846343 | Ga0105242_118463432 | 125 |
| 123 | 3300009553 | Ga0105249_10027907 | Ga0105249_100279076 | 125 |
| 124 | 3300009553 | Ga0105249_10247388 | Ga0105249_102473882 | 125 |
| 125 | 3300009553 | Ga0105249_10432361 | Ga0105249_104323611 | 125 |
| 126 | 3300009553 | Ga0105249_12040307 | Ga0105249_120403072 | 125 |
| 127 | 3300013297 | Ga0157378_10731502 | Ga0157378_107315021 | 125 |
| 128 | 3300013306 | Ga0163162_10621079 | Ga0163162_106210791 | 125 |
| 129 | 3300013306 | Ga0163162_10730753 | Ga0163162_107307532 | 125 |
| 130 | 3300013308 | Ga0157375_10751224 | Ga0157375_107512241 | 125 |
| 131 | 3300013308 | Ga0157375_10789743 | Ga0157375_107897432 | 125 |
| 132 | 3300013308 | Ga0157375_10902366 | Ga0157375_109023661 | 125 |
| 133 | 3300014325 | Ga0163163_10396031 | Ga0163163_103960312 | 125 |
| 134 | 3300014325 | Ga0163163_10433688 | Ga0163163_104336883 | 125 |
| 135 | 3300014326 | Ga0157380_10008681 | Ga0157380_100086812 | 125 |
| 136 | 3300014326 | Ga0157380_10189007 | Ga0157380_101890071 | 125 |
| 137 | 3300014326 | Ga0157380_10781112 | Ga0157380_107811122 | 125 |
| 138 | 3300014745 | Ga0157377_10376927 | Ga0157377_103769272 | 125 |
| 139 | 3300014745 | Ga0157377_10716034 | Ga0157377_107160342 | 125 |
| 140 | 3300025271 | Ga0207666_1007296 | Ga0207666_10072962 | 125 |
| 141 | 3300025315 | Ga0207697_10051902 | Ga0207697_100519022 | 125 |
| 142 | 3300025893 | Ga0207682_10015346 | Ga0207682_100153462 | 125 |
| 143 | 3300025893 | Ga0207682_10457084 | Ga0207682_104570841 | 125 |
| 144 | 3300025899 | Ga0207642_10401491 | Ga0207642_104014911 | 125 |
| 145 | 3300025901 | Ga0207688_10282020 | Ga0207688_102820202 | 125 |
| 146 | 3300025905 | Ga0207685_10352099 | Ga0207685_103520991 | 125 |
| 147 | 3300025907 | Ga0207645_10074490 | Ga0207645_100744902 | 125 |
| 148 | 3300025908 | Ga0207643_10041304 | Ga0207643_100413042 | 125 |
| 149 | 3300025908 | Ga0207643_10459958 | Ga0207643_104599581 | 125 |
| 150 | 3300025918 | Ga0207662_10039442 | Ga0207662_100394422 | 125 |
| 151 | 3300025922 | Ga0207646_10228377 | Ga0207646_102283772 | 125 |
| 152 | 3300025923 | Ga0207681_10288536 | Ga0207681_102885362 | 125 |
| 153 | 3300025923 | Ga0207681_10545827 | Ga0207681_105458271 | 125 |
| 154 | 3300025925 | Ga0207650_10032059 | Ga0207650_100320594 | 125 |
| 155 | 3300025934 | Ga0207686_10000429 | Ga0207686_1000042921 | 125 |
| 156 | 3300025934 | Ga0207686_10446922 | Ga0207686_104469222 | 125 |
| 157 | 3300025936 | Ga0207670_10364557 | Ga0207670_103645571 | 125 |
| 158 | 3300025937 | Ga0207669_10782733 | Ga0207669_107827332 | 125 |
| 159 | 3300025938 | Ga0207704_10115657 | Ga0207704_101156572 | 125 |
| 160 | 3300025940 | Ga0207691_10863763 | Ga0207691_108637631 | 125 |
| 161 | 3300025942 | Ga0207689_10019898 | Ga0207689_100198983 | 125 |
| 162 | 3300025942 | Ga0207689_10341002 | Ga0207689_103410022 | 125 |
| 163 | 3300025945 | Ga0207679_10899560 | Ga0207679_108995601 | 125 |
| 164 | 3300025960 | Ga0207651_10150943 | Ga0207651_101509433 | 125 |
| 165 | 3300025960 | Ga0207651_10152963 | Ga0207651_101529632 | 125 |
| 166 | 3300025961 | Ga0207712_10011848 | Ga0207712_100118484 | 125 |
| 167 | 3300025961 | Ga0207712_10087178 | Ga0207712_100871783 | 125 |
| 168 | 3300025961 | Ga0207712_10551514 | Ga0207712_105515142 | 125 |
| 169 | 3300025961 | Ga0207712_10866905 | Ga0207712_108669052 | 125 |
| 170 | 3300026023 | Ga0207677_10757576 | Ga0207677_107575761 | 125 |
| 171 | 3300026035 | Ga0207703_10199518 | Ga0207703_101995182 | 125 |
| 172 | 3300026035 | Ga0207703_12286230 | Ga0207703_122862301 | 125 |
| 173 | 3300026041 | Ga0207639_10975943 | Ga0207639_109759431 | 125 |
| 174 | 3300026075 | Ga0207708_10218247 | Ga0207708_102182471 | 125 |
| 175 | 3300026088 | Ga0207641_10011426 | Ga0207641_100114267 | 125 |
| 176 | 3300026088 | Ga0207641_10091145 | Ga0207641_100911453 | 125 |
| 177 | 3300026089 | Ga0207648_10094936 | Ga0207648_100949361 | 125 |
| 178 | 3300026089 | Ga0207648_10463611 | Ga0207648_104636112 | 125 |
| 179 | 3300026095 | Ga0207676_10281340 | Ga0207676_102813402 | 125 |
| 180 | 3300026116 | Ga0207674_10527578 | Ga0207674_105275782 | 125 |
| 181 | 3300026118 | Ga0207675_100007383 | Ga0207675_10000738310 | 125 |
| 182 | 3300026118 | Ga0207675_100398640 | Ga0207675_1003986402 | 125 |
| 183 | 3300026121 | Ga0207683_10954669 | Ga0207683_109546691 | 125 |
| 184 | 3300026142 | Ga0207698_10042824 | Ga0207698_100428242 | 125 |
| 185 | 3300028380 | Ga0268265_10052843 | Ga0268265_100528433 | 125 |
| 186 | 3300028380 | Ga0268265_10302748 | Ga0268265_103027482 | 125 |
| 187 | 3300028380 | Ga0268265_11264157 | Ga0268265_112641572 | 125 |
| 188 | 3300028380 | Ga0268265_12231541 | Ga0268265_122315412 | 125 |
| 189 | 3300028381 | Ga0268264_10236965 | Ga0268264_102369651 | 125 |
| 190 | 3300031456 | Ga0307513_11063533 | Ga0307513_110635332 | 125 |
| 191 | 3300031548 | Ga0307408_100700099 | Ga0307408_1007000992 | 125 |
| 192 | 3300031730 | Ga0307516_10368767 | Ga0307516_103687672 | 125 |
| 193 | 3300031995 | Ga0307409_102742989 | Ga0307409_1027429891 | 125 |
| 194 | 3300032005 | Ga0307411_12138135 | Ga0307411_121381351 | 125 |
| 195 | 3300032126 | Ga0307415_101342483 | Ga0307415_1013424832 | 125 |
| 196 | 3300041459 | Ga0451800_1534946 | Ga0451800_1534946_1263_1649 | 125 |
| 197 | 3300041463 | Ga0451804_0788977 | Ga0451804_0788977_486_872 | 125 |
| 198 | 3300041507 | Ga0451851_1010984 | Ga0451851_1010984_103_483 | 125 |
| 199 | 3300041512 | Ga0451853_1577816 | Ga0451853_1577816_710_1096 | 125 |
| 200 | 3300041512 | Ga0451853_2545082 | Ga0451853_2545082_120_500 | 125 |
| 201 | 3300042001 | Ga0439441_084094 | Ga0439441_084094_121_501 | 125 |
| 202 | 3300042125 | Ga0450923_162377 | Ga0450923_162377_67_447 | 125 |
| 203 | 3300044712 | Ga0453684_2523482 | Ga0453684_2523482_103_480 | 125 |
| 204 | 3300046459 | Ga0495629_0960488 | Ga0495629_0960488_44_424 | 125 |
| 205 | 3300046499 | Ga0495594_0034689 | Ga0495594_0034689_1048_1428 | 125 |
| 206 | 3300046537 | Ga0495598_0032877 | Ga0495598_0032877_607_987 | 125 |
| 207 | 3300046539 | Ga0495621_0106672 | Ga0495621_0106672_448_828 | 125 |
| 208 | 3300046615 | Ga0495656_0193085 | Ga0495656_0193085_580_960 | 125 |
| 209 | 3300046691 | Ga0495670_0379402 | Ga0495670_0379402_246_626 | 125 |
| 210 | 3300047321 | Ga0495676_0305635 | Ga0495676_0305635_186_566 | 125 |
| 211 | 3300047471 | Ga0495684_0711238 | Ga0495684_0711238_194_574 | 125 |
| 212 | 3300048090 | Ga0495615_0059635 | Ga0495615_0059635_462_842 | 125 |
| 213 | 3300049568 | Ga0501031_0008041 | Ga0501031_0008041_1042_1419 | 125 |
| 214 | 3300049569 | Ga0501032_0201920 | Ga0501032_0201920_255_632 | 125 |
| 215 | 3300049571 | Ga0501034_0119357 | Ga0501034_0119357_423_800 | 125 |
| 216 | 3300049572 | Ga0501036_0030055 | Ga0501036_0030055_1784_2161 | 125 |
| 217 | 3300049573 | Ga0501037_0208357 | Ga0501037_0208357_556_933 | 125 |
| 218 | 3300049574 | Ga0501038_0011536 | Ga0501038_0011536_2778_3155 | 125 |
| 219 | 3300049575 | Ga0501039_0116502 | Ga0501039_0116502_1587_1964 | 125 |
| 220 | 3300049579 | Ga0501043_0008513 | Ga0501043_0008513_5234_5611 | 125 |
| 221 | 3300049580 | Ga0501046_0191848 | Ga0501046_0191848_1076_1453 | 125 |
| 222 | 3300049581 | Ga0501047_0620885 | Ga0501047_0620885_40_417 | 125 |
| 223 | 3300049588 | Ga0501072_0387387 | Ga0501072_0387387_706_1083 | 125 |
| 224 | 3300049705 | Ga0501225_0073536 | Ga0501225_0073536_258_635 | 125 |
| 225 | 3300049742 | Ga0501080_0104269 | Ga0501080_0104269_408_785 | 125 |
| 226 | 3300049823 | Ga0501044_0018314 | Ga0501044_0018314_3996_4373 | 125 |
| 227 | 3300050507 | nmdc:mga05p37_242686_c1 | nmdc:mga05p37_242686_c1_1144_1521 | 125 |
| 228 | 3300050508 | nmdc:mga09592_10511_c1 | nmdc:mga09592_10511_c1_4914_5294 | 125 |
| 229 | 3300050508 | nmdc:mga09592_961456_c1 | nmdc:mga09592_961456_c1_238_618 | 125 |
| 230 | 3300050509 | nmdc:mga0qj67_15755_c1 | nmdc:mga0qj67_15755_c1_2770_3147 | 125 |
| 231 | 3300050509 | nmdc:mga0qj67_337731_c1 | nmdc:mga0qj67_337731_c1_83_463 | 125 |
| 232 | 3300050510 | nmdc:mga06r32_243882_c1 | nmdc:mga06r32_243882_c1_177_557 | 125 |
| 233 | 3300050510 | nmdc:mga06r32_38982_c1 | nmdc:mga06r32_38982_c1_268_645 | 125 |
| 234 | 3300050511 | nmdc:mga08y16_124164_c1 | nmdc:mga08y16_124164_c1_646_1026 | 125 |
| 235 | 3300001979 | JGI24740J21852_10029653 | JGI24740J21852_100296532 | 126 |
| 236 | 3300001991 | JGI24743J22301_10079672 | JGI24743J22301_100796721 | 126 |
| 237 | 3300001991 | JGI24743J22301_10097633 | JGI24743J22301_100976331 | 126 |
| 238 | 3300003203 | JGI25406J46586_10001126 | JGI25406J46586_100011261 | 126 |
| 239 | 3300003316 | rootH1_10067506 | rootH1_100675062 | 126 |
| 240 | 3300003322 | rootL2_10116707 | rootL2_101167071 | 126 |
| 241 | 3300003322 | rootL2_10146122 | rootL2_101461222 | 126 |
| 242 | 3300003323 | rootH1_10143165 | rootH1_101431655 | 126 |
| 243 | 3300003354 | JGI25160J50197_1002483 | JGI25160J50197_10024837 | 126 |
| 244 | 3300004803 | Ga0058862_11132398 | Ga0058862_111323981 | 126 |
| 245 | 3300005327 | Ga0070658_10028772 | Ga0070658_100287724 | 126 |
| 246 | 3300005327 | Ga0070658_10171993 | Ga0070658_101719932 | 126 |
| 247 | 3300005329 | Ga0070683_100005997 | Ga0070683_10000599715 | 126 |
| 248 | 3300005329 | Ga0070683_100654742 | Ga0070683_1006547421 | 126 |
| 249 | 3300005330 | Ga0070690_100115733 | Ga0070690_1001157333 | 126 |
| 250 | 3300005331 | Ga0070670_100085915 | Ga0070670_1000859153 | 126 |
| 251 | 3300005331 | Ga0070670_100137214 | Ga0070670_1001372142 | 126 |
| 252 | 3300005331 | Ga0070670_100507342 | Ga0070670_1005073421 | 126 |
| 253 | 3300005331 | Ga0070670_101784477 | Ga0070670_1017844772 | 126 |
| 254 | 3300005335 | Ga0070666_10006755 | Ga0070666_100067554 | 126 |
| 255 | 3300005336 | Ga0070680_100028343 | Ga0070680_1000283431 | 126 |
| 256 | 3300005336 | Ga0070680_100114416 | Ga0070680_1001144163 | 126 |
| 257 | 3300005337 | Ga0070682_100002896 | Ga0070682_1000028965 | 126 |
| 258 | 3300005338 | Ga0068868_100007430 | Ga0068868_1000074303 | 126 |
| 259 | 3300005338 | Ga0068868_100016254 | Ga0068868_1000162541 | 126 |
| 260 | 3300005338 | Ga0068868_100221482 | Ga0068868_1002214822 | 126 |
| 261 | 3300005338 | Ga0068868_100244957 | Ga0068868_1002449572 | 126 |
| 262 | 3300005338 | Ga0068868_100421982 | Ga0068868_1004219822 | 126 |
| 263 | 3300005339 | Ga0070660_100002586 | Ga0070660_1000025865 | 126 |
| 264 | 3300005339 | Ga0070660_100165849 | Ga0070660_1001658492 | 126 |
| 265 | 3300005344 | Ga0070661_100002631 | Ga0070661_10000263115 | 126 |
| 266 | 3300005344 | Ga0070661_100557090 | Ga0070661_1005570902 | 126 |
| 267 | 3300005344 | Ga0070661_100578262 | Ga0070661_1005782622 | 126 |
| 268 | 3300005347 | Ga0070668_100620860 | Ga0070668_1006208602 | 126 |
| 269 | 3300005353 | Ga0070669_100433280 | Ga0070669_1004332802 | 126 |
| 270 | 3300005354 | Ga0070675_100221708 | Ga0070675_1002217082 | 126 |
| 271 | 3300005354 | Ga0070675_100272287 | Ga0070675_1002722873 | 126 |
| 272 | 3300005355 | Ga0070671_100008104 | Ga0070671_1000081043 | 126 |
| 273 | 3300005355 | Ga0070671_100060942 | Ga0070671_1000609423 | 126 |
| 274 | 3300005364 | Ga0070673_100052455 | Ga0070673_1000524552 | 126 |
| 275 | 3300005364 | Ga0070673_100150339 | Ga0070673_1001503392 | 126 |
| 276 | 3300005364 | Ga0070673_102219752 | Ga0070673_1022197521 | 126 |
| 277 | 3300005365 | Ga0070688_100561878 | Ga0070688_1005618782 | 126 |
| 278 | 3300005366 | Ga0070659_100002110 | Ga0070659_1000021106 | 126 |
| 279 | 3300005367 | Ga0070667_100002640 | Ga0070667_1000026407 | 126 |
| 280 | 3300005367 | Ga0070667_100068354 | Ga0070667_1000683541 | 126 |
| 281 | 3300005367 | Ga0070667_100257326 | Ga0070667_1002573263 | 126 |
| 282 | 3300005367 | Ga0070667_100431782 | Ga0070667_1004317822 | 126 |
| 283 | 3300005434 | Ga0070709_10973324 | Ga0070709_109733241 | 126 |
| 284 | 3300005437 | Ga0070710_10444206 | Ga0070710_104442061 | 126 |
| 285 | 3300005439 | Ga0070711_101565931 | Ga0070711_1015659311 | 126 |
| 286 | 3300005455 | Ga0070663_100804190 | Ga0070663_1008041902 | 126 |
| 287 | 3300005455 | Ga0070663_101213739 | Ga0070663_1012137391 | 126 |
| 288 | 3300005455 | Ga0070663_101561803 | Ga0070663_1015618032 | 126 |
| 289 | 3300005456 | Ga0070678_100018048 | Ga0070678_1000180483 | 126 |
| 290 | 3300005457 | Ga0070662_100005618 | Ga0070662_1000056186 | 126 |
| 291 | 3300005457 | Ga0070662_100114020 | Ga0070662_1001140203 | 126 |
| 292 | 3300005457 | Ga0070662_100305695 | Ga0070662_1003056952 | 126 |
| 293 | 3300005458 | Ga0070681_10137758 | Ga0070681_101377584 | 126 |
| 294 | 3300005458 | Ga0070681_10448110 | Ga0070681_104481101 | 126 |
| 295 | 3300005459 | Ga0068867_100302590 | Ga0068867_1003025902 | 126 |
| 296 | 3300005459 | Ga0068867_100333660 | Ga0068867_1003336603 | 126 |
| 297 | 3300005459 | Ga0068867_100340013 | Ga0068867_1003400131 | 126 |
| 298 | 3300005466 | Ga0070685_10942243 | Ga0070685_109422431 | 126 |
| 299 | 3300005471 | Ga0070698_100056165 | Ga0070698_1000561655 | 126 |
| 300 | 3300005530 | Ga0070679_100027317 | Ga0070679_1000273174 | 126 |
| 301 | 3300005530 | Ga0070679_100085573 | Ga0070679_1000855732 | 126 |
| 302 | 3300005530 | Ga0070679_101310501 | Ga0070679_1013105011 | 126 |
| 303 | 3300005530 | Ga0070679_102021057 | Ga0070679_1020210571 | 126 |
| 304 | 3300005535 | Ga0070684_100001215 | Ga0070684_1000012155 | 126 |
| 305 | 3300005535 | Ga0070684_100259073 | Ga0070684_1002590732 | 126 |
| 306 | 3300005535 | Ga0070684_100390540 | Ga0070684_1003905402 | 126 |
| 307 | 3300005535 | Ga0070684_100577728 | Ga0070684_1005777281 | 126 |
| 308 | 3300005539 | Ga0068853_100013898 | Ga0068853_1000138985 | 126 |
| 309 | 3300005539 | Ga0068853_100326092 | Ga0068853_1003260922 | 126 |
| 310 | 3300005539 | Ga0068853_100339403 | Ga0068853_1003394031 | 126 |
| 311 | 3300005539 | Ga0068853_100345483 | Ga0068853_1003454833 | 126 |
| 312 | 3300005539 | Ga0068853_100374970 | Ga0068853_1003749701 | 126 |
| 313 | 3300005539 | Ga0068853_100780451 | Ga0068853_1007804512 | 126 |
| 314 | 3300005539 | Ga0068853_101253964 | Ga0068853_1012539642 | 126 |
| 315 | 3300005543 | Ga0070672_100519840 | Ga0070672_1005198402 | 126 |
| 316 | 3300005543 | Ga0070672_100896556 | Ga0070672_1008965561 | 126 |
| 317 | 3300005543 | Ga0070672_101711054 | Ga0070672_1017110541 | 126 |
| 318 | 3300005544 | Ga0070686_100594516 | Ga0070686_1005945163 | 126 |
| 319 | 3300005547 | Ga0070693_100431633 | Ga0070693_1004316332 | 126 |
| 320 | 3300005547 | Ga0070693_100568503 | Ga0070693_1005685032 | 126 |
| 321 | 3300005548 | Ga0070665_100237515 | Ga0070665_1002375153 | 126 |
| 322 | 3300005563 | Ga0068855_100023607 | Ga0068855_1000236071 | 126 |
| 323 | 3300005563 | Ga0068855_101655718 | Ga0068855_1016557182 | 126 |
| 324 | 3300005564 | Ga0070664_100004754 | Ga0070664_1000047544 | 126 |
| 325 | 3300005564 | Ga0070664_100948704 | Ga0070664_1009487042 | 126 |
| 326 | 3300005564 | Ga0070664_100965497 | Ga0070664_1009654971 | 126 |
| 327 | 3300005577 | Ga0068857_100021834 | Ga0068857_1000218343 | 126 |
| 328 | 3300005577 | Ga0068857_100090163 | Ga0068857_1000901632 | 126 |
| 329 | 3300005577 | Ga0068857_100321883 | Ga0068857_1003218832 | 126 |
| 330 | 3300005578 | Ga0068854_100014594 | Ga0068854_1000145946 | 126 |
| 331 | 3300005578 | Ga0068854_101628915 | Ga0068854_1016289151 | 126 |
| 332 | 3300005614 | Ga0068856_100016680 | Ga0068856_1000166801 | 126 |
| 333 | 3300005614 | Ga0068856_100046347 | Ga0068856_1000463474 | 126 |
| 334 | 3300005614 | Ga0068856_100775841 | Ga0068856_1007758411 | 126 |
| 335 | 3300005614 | Ga0068856_101734754 | Ga0068856_1017347542 | 126 |
| 336 | 3300005616 | Ga0068852_100001659 | Ga0068852_10000165911 | 126 |
| 337 | 3300005616 | Ga0068852_100014178 | Ga0068852_1000141783 | 126 |
| 338 | 3300005616 | Ga0068852_100070866 | Ga0068852_1000708663 | 126 |
| 339 | 3300005616 | Ga0068852_100093543 | Ga0068852_1000935432 | 126 |
| 340 | 3300005616 | Ga0068852_100134320 | Ga0068852_1001343203 | 126 |
| 341 | 3300005616 | Ga0068852_100253146 | Ga0068852_1002531463 | 126 |
| 342 | 3300005616 | Ga0068852_100664554 | Ga0068852_1006645542 | 126 |
| 343 | 3300005616 | Ga0068852_100818284 | Ga0068852_1008182842 | 126 |
| 344 | 3300005617 | Ga0068859_100031009 | Ga0068859_1000310092 | 126 |
| 345 | 3300005617 | Ga0068859_100611453 | Ga0068859_1006114532 | 126 |
| 346 | 3300005617 | Ga0068859_100818637 | Ga0068859_1008186372 | 126 |
| 347 | 3300005617 | Ga0068859_101418885 | Ga0068859_1014188851 | 126 |
| 348 | 3300005618 | Ga0068864_100105344 | Ga0068864_1001053441 | 126 |
| 349 | 3300005618 | Ga0068864_100270365 | Ga0068864_1002703652 | 126 |
| 350 | 3300005618 | Ga0068864_100316414 | Ga0068864_1003164143 | 126 |
| 351 | 3300005718 | Ga0068866_10261797 | Ga0068866_102617971 | 126 |
| 352 | 3300005719 | Ga0068861_101212787 | Ga0068861_1012127872 | 126 |
| 353 | 3300005834 | Ga0068851_10011250 | Ga0068851_100112502 | 126 |
| 354 | 3300005834 | Ga0068851_10400198 | Ga0068851_104001981 | 126 |
| 355 | 3300005840 | Ga0068870_10186074 | Ga0068870_101860743 | 126 |
| 356 | 3300005841 | Ga0068863_100323810 | Ga0068863_1003238101 | 126 |
| 357 | 3300005842 | Ga0068858_101244194 | Ga0068858_1012441941 | 126 |
| 358 | 3300005842 | Ga0068858_101971556 | Ga0068858_1019715561 | 126 |
| 359 | 3300005843 | Ga0068860_100000052 | Ga0068860_10000005254 | 126 |
| 360 | 3300005843 | Ga0068860_100001511 | Ga0068860_10000151121 | 126 |
| 361 | 3300005843 | Ga0068860_100003681 | Ga0068860_1000036815 | 126 |
| 362 | 3300005844 | Ga0068862_101370150 | Ga0068862_1013701502 | 126 |
| 363 | 3300005985 | Ga0081539_10000885 | Ga0081539_1000088559 | 126 |
| 364 | 3300006195 | Ga0075366_10114174 | Ga0075366_101141741 | 126 |
| 365 | 3300006195 | Ga0075366_10693690 | Ga0075366_106936902 | 126 |
| 366 | 3300006237 | Ga0097621_100000118 | Ga0097621_1000001188 | 126 |
| 367 | 3300006237 | Ga0097621_100014934 | Ga0097621_1000149345 | 126 |
| 368 | 3300006237 | Ga0097621_100059277 | Ga0097621_1000592772 | 126 |
| 369 | 3300006237 | Ga0097621_100145640 | Ga0097621_1001456403 | 126 |
| 370 | 3300006237 | Ga0097621_100405122 | Ga0097621_1004051222 | 126 |
| 371 | 3300006237 | Ga0097621_101774726 | Ga0097621_1017747262 | 126 |
| 372 | 3300006358 | Ga0068871_100006528 | Ga0068871_1000065286 | 126 |
| 373 | 3300006358 | Ga0068871_100019364 | Ga0068871_1000193645 | 126 |
| 374 | 3300006358 | Ga0068871_100030647 | Ga0068871_1000306473 | 126 |
| 375 | 3300006358 | Ga0068871_100476567 | Ga0068871_1004765672 | 126 |
| 376 | 3300006358 | Ga0068871_100975384 | Ga0068871_1009753842 | 126 |
| 377 | 3300006844 | Ga0075428_101572528 | Ga0075428_1015725282 | 126 |
| 378 | 3300006881 | Ga0068865_100167098 | Ga0068865_1001670982 | 126 |
| 379 | 3300006881 | Ga0068865_100442243 | Ga0068865_1004422432 | 126 |
| 380 | 3300006931 | Ga0097620_100031009 | Ga0097620_1000310092 | 126 |
| 381 | 3300006931 | Ga0097620_100611429 | Ga0097620_1006114291 | 126 |
| 382 | 3300006931 | Ga0097620_100818740 | Ga0097620_1008187402 | 126 |
| 383 | 3300006931 | Ga0097620_101418714 | Ga0097620_1014187141 | 126 |
| 384 | 3300009093 | Ga0105240_10022086 | Ga0105240_100220865 | 126 |
| 385 | 3300009093 | Ga0105240_11331757 | Ga0105240_113317572 | 126 |
| 386 | 3300009094 | Ga0111539_10419252 | Ga0111539_104192521 | 126 |
| 387 | 3300009094 | Ga0111539_12689174 | Ga0111539_126891741 | 126 |
| 388 | 3300009094 | Ga0111539_13274333 | Ga0111539_132743331 | 126 |
| 389 | 3300009098 | Ga0105245_11022539 | Ga0105245_110225391 | 126 |
| 390 | 3300009174 | Ga0105241_10018266 | Ga0105241_100182664 | 126 |
| 391 | 3300009174 | Ga0105241_10309763 | Ga0105241_103097633 | 126 |
| 392 | 3300009174 | Ga0105241_10428110 | Ga0105241_104281102 | 126 |
| 393 | 3300009174 | Ga0105241_11122849 | Ga0105241_111228491 | 126 |
| 394 | 3300009174 | Ga0105241_11180567 | Ga0105241_111805672 | 126 |
| 395 | 3300009174 | Ga0105241_11419537 | Ga0105241_114195371 | 126 |
| 396 | 3300009174 | Ga0105241_11462805 | Ga0105241_114628052 | 126 |
| 397 | 3300009174 | Ga0105241_12347541 | Ga0105241_123475411 | 126 |
| 398 | 3300009176 | Ga0105242_10134758 | Ga0105242_101347583 | 126 |
| 399 | 3300009176 | Ga0105242_11104499 | Ga0105242_111044991 | 126 |
| 400 | 3300009177 | Ga0105248_10014430 | Ga0105248_100144303 | 126 |
| 401 | 3300009545 | Ga0105237_10016806 | Ga0105237_100168062 | 126 |
| 402 | 3300009545 | Ga0105237_10398104 | Ga0105237_103981042 | 126 |
| 403 | 3300009545 | Ga0105237_10629792 | Ga0105237_106297922 | 126 |
| 404 | 3300009545 | Ga0105237_10884182 | Ga0105237_108841821 | 126 |
| 405 | 3300009545 | Ga0105237_12173159 | Ga0105237_121731591 | 126 |
| 406 | 3300009551 | Ga0105238_10079918 | Ga0105238_100799183 | 126 |
| 407 | 3300009551 | Ga0105238_10102620 | Ga0105238_101026202 | 126 |
| 408 | 3300009551 | Ga0105238_11414675 | Ga0105238_114146751 | 126 |
| 409 | 3300009553 | Ga0105249_10025456 | Ga0105249_100254565 | 126 |
| 410 | 3300009553 | Ga0105249_10087032 | Ga0105249_100870323 | 126 |
| 411 | 3300009553 | Ga0105249_10934961 | Ga0105249_109349611 | 126 |
| 412 | 3300010375 | Ga0105239_10001888 | Ga0105239_1000188815 | 126 |
| 413 | 3300010375 | Ga0105239_10038490 | Ga0105239_100384902 | 126 |
| 414 | 3300010375 | Ga0105239_10218000 | Ga0105239_102180002 | 126 |
| 415 | 3300010375 | Ga0105239_10717644 | Ga0105239_107176442 | 126 |
| 416 | 3300010375 | Ga0105239_10750457 | Ga0105239_107504573 | 126 |
| 417 | 3300010375 | Ga0105239_12728323 | Ga0105239_127283231 | 126 |
| 418 | 3300010375 | Ga0105239_12838920 | Ga0105239_128389201 | 126 |
| 419 | 3300010375 | Ga0105239_13019986 | Ga0105239_130199862 | 126 |
| 420 | 3300011119 | Ga0105246_10107348 | Ga0105246_101073483 | 126 |
| 421 | 3300011119 | Ga0105246_10825886 | Ga0105246_108258862 | 126 |
| 422 | 3300011119 | Ga0105246_10903590 | Ga0105246_109035901 | 126 |
| 423 | 3300011119 | Ga0105246_12397709 | Ga0105246_123977091 | 126 |
| 424 | 3300013100 | Ga0157373_10003884 | Ga0157373_100038848 | 126 |
| 425 | 3300013100 | Ga0157373_10300863 | Ga0157373_103008632 | 126 |
| 426 | 3300013100 | Ga0157373_10340442 | Ga0157373_103404422 | 126 |
| 427 | 3300013100 | Ga0157373_10992428 | Ga0157373_109924282 | 126 |
| 428 | 3300013102 | Ga0157371_10066429 | Ga0157371_100664294 | 126 |
| 429 | 3300013102 | Ga0157371_10576598 | Ga0157371_105765981 | 126 |
| 430 | 3300013102 | Ga0157371_10847500 | Ga0157371_108475002 | 126 |
| 431 | 3300013104 | Ga0157370_10003253 | Ga0157370_1000325316 | 126 |
| 432 | 3300013104 | Ga0157370_10149775 | Ga0157370_101497753 | 126 |
| 433 | 3300013104 | Ga0157370_10301326 | Ga0157370_103013262 | 126 |
| 434 | 3300013104 | Ga0157370_10513005 | Ga0157370_105130052 | 126 |
| 435 | 3300013105 | Ga0157369_10004961 | Ga0157369_1000496111 | 126 |
| 436 | 3300013105 | Ga0157369_10022438 | Ga0157369_100224385 | 126 |
| 437 | 3300013105 | Ga0157369_10282780 | Ga0157369_102827802 | 126 |
| 438 | 3300013105 | Ga0157369_10321308 | Ga0157369_103213082 | 126 |
| 439 | 3300013105 | Ga0157369_11383196 | Ga0157369_113831962 | 126 |
| 440 | 3300013296 | Ga0157374_10005011 | Ga0157374_100050118 | 126 |
| 441 | 3300013296 | Ga0157374_10057986 | Ga0157374_100579863 | 126 |
| 442 | 3300013296 | Ga0157374_10861294 | Ga0157374_108612942 | 126 |
| 443 | 3300013296 | Ga0157374_12049466 | Ga0157374_120494662 | 126 |
| 444 | 3300013297 | Ga0157378_10005153 | Ga0157378_1000515311 | 126 |
| 445 | 3300013297 | Ga0157378_10011525 | Ga0157378_100115253 | 126 |
| 446 | 3300013297 | Ga0157378_10012883 | Ga0157378_100128838 | 126 |
| 447 | 3300013297 | Ga0157378_10019286 | Ga0157378_100192863 | 126 |
| 448 | 3300013297 | Ga0157378_10120808 | Ga0157378_101208082 | 126 |
| 449 | 3300013297 | Ga0157378_10365328 | Ga0157378_103653282 | 126 |
| 450 | 3300013297 | Ga0157378_10591958 | Ga0157378_105919581 | 126 |
| 451 | 3300013297 | Ga0157378_12012442 | Ga0157378_120124421 | 126 |
| 452 | 3300013306 | Ga0163162_10000086 | Ga0163162_1000008663 | 126 |
| 453 | 3300013306 | Ga0163162_10000464 | Ga0163162_1000046432 | 126 |
| 454 | 3300013306 | Ga0163162_10004156 | Ga0163162_100041567 | 126 |
| 455 | 3300013306 | Ga0163162_10013496 | Ga0163162_100134968 | 126 |
| 456 | 3300013306 | Ga0163162_10242378 | Ga0163162_102423782 | 126 |
| 457 | 3300013306 | Ga0163162_10272042 | Ga0163162_102720422 | 126 |
| 458 | 3300013306 | Ga0163162_10968537 | Ga0163162_109685371 | 126 |
| 459 | 3300013307 | Ga0157372_10020933 | Ga0157372_100209332 | 126 |
| 460 | 3300013307 | Ga0157372_10024792 | Ga0157372_100247925 | 126 |
| 461 | 3300013307 | Ga0157372_10033647 | Ga0157372_100336471 | 126 |
| 462 | 3300013307 | Ga0157372_10048401 | Ga0157372_100484013 | 126 |
| 463 | 3300013307 | Ga0157372_10054590 | Ga0157372_100545904 | 126 |
| 464 | 3300013307 | Ga0157372_10054606 | Ga0157372_100546063 | 126 |
| 465 | 3300013307 | Ga0157372_10658413 | Ga0157372_106584131 | 126 |
| 466 | 3300013307 | Ga0157372_10755660 | Ga0157372_107556601 | 126 |
| 467 | 3300013307 | Ga0157372_11569796 | Ga0157372_115697961 | 126 |
| 468 | 3300013307 | Ga0157372_13031117 | Ga0157372_130311171 | 126 |
| 469 | 3300013308 | Ga0157375_10000115 | Ga0157375_1000011515 | 126 |
| 470 | 3300013308 | Ga0157375_10027854 | Ga0157375_100278548 | 126 |
| 471 | 3300013308 | Ga0157375_10132456 | Ga0157375_101324562 | 126 |
| 472 | 3300013308 | Ga0157375_10281410 | Ga0157375_102814103 | 126 |
| 473 | 3300013308 | Ga0157375_10447738 | Ga0157375_104477382 | 126 |
| 474 | 3300013308 | Ga0157375_10529799 | Ga0157375_105297992 | 126 |
| 475 | 3300013308 | Ga0157375_10561012 | Ga0157375_105610122 | 126 |
| 476 | 3300013308 | Ga0157375_10800290 | Ga0157375_108002902 | 126 |
| 477 | 3300014325 | Ga0163163_11003109 | Ga0163163_110031091 | 126 |
| 478 | 3300014325 | Ga0163163_11007566 | Ga0163163_110075662 | 126 |
| 479 | 3300014325 | Ga0163163_12095391 | Ga0163163_120953911 | 126 |
| 480 | 3300014745 | Ga0157377_10006202 | Ga0157377_100062026 | 126 |
| 481 | 3300014745 | Ga0157377_10098365 | Ga0157377_100983653 | 126 |
| 482 | 3300014968 | Ga0157379_10033649 | Ga0157379_100336492 | 126 |
| 483 | 3300014968 | Ga0157379_10590918 | Ga0157379_105909182 | 126 |
| 484 | 3300014968 | Ga0157379_10784602 | Ga0157379_107846021 | 126 |
| 485 | 3300014969 | Ga0157376_10001060 | Ga0157376_1000106015 | 126 |
| 486 | 3300014969 | Ga0157376_10243590 | Ga0157376_102435902 | 126 |
| 487 | 3300014969 | Ga0157376_10972044 | Ga0157376_109720442 | 126 |
| 488 | 3300014969 | Ga0157376_11132678 | Ga0157376_111326781 | 126 |
| 489 | 3300015265 | Ga0182005_1198308 | Ga0182005_11983081 | 126 |
| 490 | 3300017792 | Ga0163161_10006573 | Ga0163161_100065737 | 126 |
| 491 | 3300017792 | Ga0163161_10010591 | Ga0163161_100105913 | 126 |
| 492 | 3300017792 | Ga0163161_10065108 | Ga0163161_100651082 | 126 |
| 493 | 3300017792 | Ga0163161_11998025 | Ga0163161_119980251 | 126 |
| 494 | 3300021384 | Ga0213876_10002683 | Ga0213876_100026836 | 126 |
| 495 | 3300021384 | Ga0213876_10042901 | Ga0213876_100429012 | 126 |
| 496 | 3300021384 | Ga0213876_10580682 | Ga0213876_105806821 | 126 |
| 497 | 3300025302 | Ga0207426_1000170 | Ga0207426_100017068 | 126 |
| 498 | 3300025321 | Ga0207656_10037489 | Ga0207656_100374893 | 126 |
| 499 | 3300025321 | Ga0207656_10439569 | Ga0207656_104395691 | 126 |
| 500 | 3300025321 | Ga0207656_10493150 | Ga0207656_104931501 | 126 |
| 501 | 3300025898 | Ga0207692_10098521 | Ga0207692_100985212 | 126 |
| 502 | 3300025899 | Ga0207642_10266579 | Ga0207642_102665792 | 126 |
| 503 | 3300025903 | Ga0207680_10104366 | Ga0207680_101043663 | 126 |
| 504 | 3300025903 | Ga0207680_10696142 | Ga0207680_106961422 | 126 |
| 505 | 3300025903 | Ga0207680_10780871 | Ga0207680_107808712 | 126 |
| 506 | 3300025904 | Ga0207647_10014937 | Ga0207647_100149375 | 126 |
| 507 | 3300025904 | Ga0207647_10179952 | Ga0207647_101799522 | 126 |
| 508 | 3300025904 | Ga0207647_10211054 | Ga0207647_102110542 | 126 |
| 509 | 3300025908 | Ga0207643_10242777 | Ga0207643_102427772 | 126 |
| 510 | 3300025909 | Ga0207705_10098526 | Ga0207705_100985263 | 126 |
| 511 | 3300025909 | Ga0207705_10994000 | Ga0207705_109940001 | 126 |
| 512 | 3300025911 | Ga0207654_10819695 | Ga0207654_108196951 | 126 |
| 513 | 3300025911 | Ga0207654_11019422 | Ga0207654_110194221 | 126 |
| 514 | 3300025912 | Ga0207707_10148968 | Ga0207707_101489682 | 126 |
| 515 | 3300025912 | Ga0207707_10688136 | Ga0207707_106881362 | 126 |
| 516 | 3300025913 | Ga0207695_10791457 | Ga0207695_107914571 | 126 |
| 517 | 3300025914 | Ga0207671_10024059 | Ga0207671_100240595 | 126 |
| 518 | 3300025914 | Ga0207671_10583542 | Ga0207671_105835421 | 126 |
| 519 | 3300025916 | Ga0207663_10682873 | Ga0207663_106828731 | 126 |
| 520 | 3300025917 | Ga0207660_10341093 | Ga0207660_103410932 | 126 |
| 521 | 3300025917 | Ga0207660_10808190 | Ga0207660_108081902 | 126 |
| 522 | 3300025919 | Ga0207657_10010494 | Ga0207657_100104945 | 126 |
| 523 | 3300025919 | Ga0207657_10316532 | Ga0207657_103165322 | 126 |
| 524 | 3300025920 | Ga0207649_10427298 | Ga0207649_104272982 | 126 |
| 525 | 3300025920 | Ga0207649_10624932 | Ga0207649_106249322 | 126 |
| 526 | 3300025920 | Ga0207649_10745036 | Ga0207649_107450362 | 126 |
| 527 | 3300025920 | Ga0207649_10848645 | Ga0207649_108486451 | 126 |
| 528 | 3300025921 | Ga0207652_10131694 | Ga0207652_101316942 | 126 |
| 529 | 3300025921 | Ga0207652_10165910 | Ga0207652_101659104 | 126 |
| 530 | 3300025921 | Ga0207652_11806204 | Ga0207652_118062041 | 126 |
| 531 | 3300025923 | Ga0207681_10696015 | Ga0207681_106960151 | 126 |
| 532 | 3300025923 | Ga0207681_11073802 | Ga0207681_110738021 | 126 |
| 533 | 3300025923 | Ga0207681_11844561 | Ga0207681_118445611 | 126 |
| 534 | 3300025924 | Ga0207694_10320601 | Ga0207694_103206012 | 126 |
| 535 | 3300025925 | Ga0207650_10135502 | Ga0207650_101355022 | 126 |
| 536 | 3300025925 | Ga0207650_10793840 | Ga0207650_107938401 | 126 |
| 537 | 3300025925 | Ga0207650_10884667 | Ga0207650_108846672 | 126 |
| 538 | 3300025926 | Ga0207659_10487047 | Ga0207659_104870471 | 126 |
| 539 | 3300025926 | Ga0207659_11061442 | Ga0207659_110614422 | 126 |
| 540 | 3300025931 | Ga0207644_10013035 | Ga0207644_100130353 | 126 |
| 541 | 3300025931 | Ga0207644_10914854 | Ga0207644_109148541 | 126 |
| 542 | 3300025932 | Ga0207690_10016741 | Ga0207690_100167415 | 126 |
| 543 | 3300025932 | Ga0207690_11453891 | Ga0207690_114538911 | 126 |
| 544 | 3300025933 | Ga0207706_10009158 | Ga0207706_100091586 | 126 |
| 545 | 3300025934 | Ga0207686_10076175 | Ga0207686_100761753 | 126 |
| 546 | 3300025934 | Ga0207686_10868051 | Ga0207686_108680512 | 126 |
| 547 | 3300025937 | Ga0207669_10963429 | Ga0207669_109634292 | 126 |
| 548 | 3300025938 | Ga0207704_10125735 | Ga0207704_101257352 | 126 |
| 549 | 3300025938 | Ga0207704_10517668 | Ga0207704_105176681 | 126 |
| 550 | 3300025938 | Ga0207704_11495476 | Ga0207704_114954761 | 126 |
| 551 | 3300025940 | Ga0207691_10504339 | Ga0207691_105043392 | 126 |
| 552 | 3300025941 | Ga0207711_10070479 | Ga0207711_100704792 | 126 |
| 553 | 3300025944 | Ga0207661_10021161 | Ga0207661_100211616 | 126 |
| 554 | 3300025944 | Ga0207661_10372998 | Ga0207661_103729983 | 126 |
| 555 | 3300025944 | Ga0207661_11911373 | Ga0207661_119113731 | 126 |
| 556 | 3300025945 | Ga0207679_10032071 | Ga0207679_100320714 | 126 |
| 557 | 3300025945 | Ga0207679_10188840 | Ga0207679_101888402 | 126 |
| 558 | 3300025949 | Ga0207667_10001711 | Ga0207667_100017118 | 126 |
| 559 | 3300025949 | Ga0207667_10140405 | Ga0207667_101404054 | 126 |
| 560 | 3300025960 | Ga0207651_10264589 | Ga0207651_102645891 | 126 |
| 561 | 3300025960 | Ga0207651_11159372 | Ga0207651_111593722 | 126 |
| 562 | 3300025961 | Ga0207712_10003042 | Ga0207712_100030422 | 126 |
| 563 | 3300025961 | Ga0207712_10034955 | Ga0207712_100349554 | 126 |
| 564 | 3300025972 | Ga0207668_10274404 | Ga0207668_102744042 | 126 |
| 565 | 3300025981 | Ga0207640_10027834 | Ga0207640_100278344 | 126 |
| 566 | 3300025981 | Ga0207640_10147515 | Ga0207640_101475151 | 126 |
| 567 | 3300025981 | Ga0207640_10231370 | Ga0207640_102313702 | 126 |
| 568 | 3300025986 | Ga0207658_10021523 | Ga0207658_100215234 | 126 |
| 569 | 3300025986 | Ga0207658_10134482 | Ga0207658_101344822 | 126 |
| 570 | 3300025986 | Ga0207658_10444914 | Ga0207658_104449142 | 126 |
| 571 | 3300026023 | Ga0207677_10003558 | Ga0207677_100035588 | 126 |
| 572 | 3300026023 | Ga0207677_10019166 | Ga0207677_100191662 | 126 |
| 573 | 3300026023 | Ga0207677_10352614 | Ga0207677_103526142 | 126 |
| 574 | 3300026023 | Ga0207677_10727162 | Ga0207677_107271622 | 126 |
| 575 | 3300026035 | Ga0207703_11450971 | Ga0207703_114509711 | 126 |
| 576 | 3300026041 | Ga0207639_10051722 | Ga0207639_100517224 | 126 |
| 577 | 3300026041 | Ga0207639_10315207 | Ga0207639_103152072 | 126 |
| 578 | 3300026041 | Ga0207639_10400178 | Ga0207639_104001782 | 126 |
| 579 | 3300026041 | Ga0207639_10653689 | Ga0207639_106536892 | 126 |
| 580 | 3300026041 | Ga0207639_11136072 | Ga0207639_111360722 | 126 |
| 581 | 3300026041 | Ga0207639_11177477 | Ga0207639_111774772 | 126 |
| 582 | 3300026067 | Ga0207678_10358172 | Ga0207678_103581722 | 126 |
| 583 | 3300026067 | Ga0207678_10656454 | Ga0207678_106564541 | 126 |
| 584 | 3300026078 | Ga0207702_10128680 | Ga0207702_101286802 | 126 |
| 585 | 3300026078 | Ga0207702_10737277 | Ga0207702_107372772 | 126 |
| 586 | 3300026088 | Ga0207641_10181821 | Ga0207641_101818211 | 126 |
| 587 | 3300026088 | Ga0207641_10222608 | Ga0207641_102226082 | 126 |
| 588 | 3300026089 | Ga0207648_10146511 | Ga0207648_101465112 | 126 |
| 589 | 3300026089 | Ga0207648_10384590 | Ga0207648_103845902 | 126 |
| 590 | 3300026089 | Ga0207648_11126018 | Ga0207648_111260182 | 126 |
| 591 | 3300026089 | Ga0207648_11213489 | Ga0207648_112134892 | 126 |
| 592 | 3300026095 | Ga0207676_10064837 | Ga0207676_100648373 | 126 |
| 593 | 3300026095 | Ga0207676_10081633 | Ga0207676_100816333 | 126 |
| 594 | 3300026095 | Ga0207676_10355968 | Ga0207676_103559681 | 126 |
| 595 | 3300026095 | Ga0207676_12142943 | Ga0207676_121429431 | 126 |
| 596 | 3300026116 | Ga0207674_10197620 | Ga0207674_101976203 | 126 |
| 597 | 3300026116 | Ga0207674_10242487 | Ga0207674_102424872 | 126 |
| 598 | 3300026116 | Ga0207674_10593369 | Ga0207674_105933693 | 126 |
| 599 | 3300026118 | Ga0207675_101942683 | Ga0207675_1019426832 | 126 |
| 600 | 3300026121 | Ga0207683_10031651 | Ga0207683_100316513 | 126 |
| 601 | 3300026142 | Ga0207698_10003137 | Ga0207698_100031376 | 126 |
| 602 | 3300026142 | Ga0207698_10036585 | Ga0207698_100365853 | 126 |
| 603 | 3300026142 | Ga0207698_10096703 | Ga0207698_100967033 | 126 |
| 604 | 3300026142 | Ga0207698_10733129 | Ga0207698_107331292 | 126 |
| 605 | 3300026142 | Ga0207698_11607100 | Ga0207698_116071002 | 126 |
| 606 | 3300027907 | Ga0207428_10730359 | Ga0207428_107303592 | 126 |
| 607 | 3300027907 | Ga0207428_11134351 | Ga0207428_111343511 | 126 |
| 608 | 3300028379 | Ga0268266_10000071 | Ga0268266_1000007141 | 126 |
| 609 | 3300028379 | Ga0268266_10347496 | Ga0268266_103474963 | 126 |
| 610 | 3300028381 | Ga0268264_10001196 | Ga0268264_1000119619 | 126 |
| 611 | 3300028381 | Ga0268264_11890866 | Ga0268264_118908661 | 126 |
| 612 | 3300028794 | Ga0307515_10000078 | Ga0307515_1000007848 | 126 |
| 613 | 3300028800 | Ga0265338_10125422 | Ga0265338_101254223 | 126 |
| 614 | 3300029957 | Ga0265324_10115654 | Ga0265324_101156542 | 126 |
| 615 | 3300030521 | Ga0307511_10002930 | Ga0307511_1000293014 | 126 |
| 616 | 3300031251 | Ga0265327_10025126 | Ga0265327_100251262 | 126 |
| 617 | 3300031344 | Ga0265316_10315997 | Ga0265316_103159972 | 126 |
| 618 | 3300031456 | Ga0307513_10170590 | Ga0307513_101705903 | 126 |
| 619 | 3300031456 | Ga0307513_10319197 | Ga0307513_103191971 | 126 |
| 620 | 3300031507 | Ga0307509_10679272 | Ga0307509_106792721 | 126 |
| 621 | 3300031507 | Ga0307509_10712124 | Ga0307509_107121242 | 126 |
| 622 | 3300031548 | Ga0307408_102490317 | Ga0307408_1024903172 | 126 |
| 623 | 3300031824 | Ga0307413_10386864 | Ga0307413_103868641 | 126 |
| 624 | 3300036401 | Ga0373937_0454279 | Ga0373937_0454279_13_396 | 126 |
| 625 | 3300037418 | Ga0395900_0529223 | Ga0395900_0529223_614_994 | 126 |
| 626 | 3300037418 | Ga0395900_1283570 | Ga0395900_1283570_99_479 | 126 |
| 627 | 3300037471 | Ga0395905_0422485 | Ga0395905_0422485_221_601 | 126 |
| 628 | 3300037471 | Ga0395905_1186790 | Ga0395905_1186790_71_451 | 126 |
| 629 | 3300038443 | Ga0395901_0821317 | Ga0395901_0821317_157_537 | 126 |
| 630 | 3300039437 | Ga0436365_0014802 | Ga0436365_0014802_331_711 | 126 |
| 631 | 3300039437 | Ga0436365_0038916 | Ga0436365_0038916_4459_4842 | 126 |
| 632 | 3300039437 | Ga0436365_0852964 | Ga0436365_0852964_697_1080 | 126 |
| 633 | 3300039437 | Ga0436365_1788000 | Ga0436365_1788000_654_1034 | 126 |
| 634 | 3300039437 | Ga0436365_1814713 | Ga0436365_1814713_7510_7890 | 126 |
| 635 | 3300041406 | Ga0439439_0137581 | Ga0439439_0137581_137_517 | 126 |
| 636 | 3300041486 | Ga0451807_1622340 | Ga0451807_1622340_64_444 | 126 |
| 637 | 3300041496 | Ga0451839_1103437 | Ga0451839_1103437_15_395 | 126 |
| 638 | 3300041512 | Ga0451853_1587238 | Ga0451853_1587238_146_529 | 126 |
| 639 | 3300042001 | Ga0439441_001071 | Ga0439441_001071_390_770 | 126 |
| 640 | 3300042007 | Ga0439449_0001249 | Ga0439449_0001249_1681_2061 | 126 |
| 641 | 3300042014 | Ga0439457_005901 | Ga0439457_005901_2546_2926 | 126 |
| 642 | 3300042014 | Ga0439457_147102 | Ga0439457_147102_100_480 | 126 |
| 643 | 3300042015 | Ga0439462_0076497 | Ga0439462_0076497_174_554 | 126 |
| 644 | 3300042437 | Ga0439444_0020005 | Ga0439444_0020005_355_735 | 126 |
| 645 | 3300045976 | Ga0466967_0362708 | Ga0466967_0362708_713_1093 | 126 |
| 646 | 3300046524 | Ga0495648_0006665 | Ga0495648_0006665_2001_2381 | 126 |
| 647 | 3300046559 | Ga0495667_0188037 | Ga0495667_0188037_662_1045 | 126 |
| 648 | 3300046642 | Ga0495634_0438545 | Ga0495634_0438545_166_549 | 126 |
| 649 | 3300046663 | Ga0495635_0346618 | Ga0495635_0346618_146_529 | 126 |
| 650 | 3300047319 | Ga0495674_0207326 | Ga0495674_0207326_1218_1601 | 126 |
| 651 | 3300048903 | Ga0496100_0424305 | Ga0496100_0424305_132_512 | 126 |
| 652 | 3300048904 | Ga0496101_0322326 | Ga0496101_0322326_493_873 | 126 |
| 653 | 3300048907 | Ga0496104_0865350 | Ga0496104_0865350_367_747 | 126 |
| 654 | 3300048909 | Ga0496106_1455033 | Ga0496106_1455033_69_449 | 126 |
| 655 | 3300048917 | Ga0496114_0006425 | Ga0496114_0006425_386_766 | 126 |
| 656 | 3300048917 | Ga0496114_1395005 | Ga0496114_1395005_105_485 | 126 |
| 657 | 3300048923 | Ga0496120_0349754 | Ga0496120_0349754_217_597 | 126 |
| 658 | 3300049523 | Ga0501300_059896 | Ga0501300_059896_19_402 | 126 |
| 659 | 3300049569 | Ga0501032_0070165 | Ga0501032_0070165_577_957 | 126 |
| 660 | 3300049570 | Ga0501033_0092551 | Ga0501033_0092551_1278_1658 | 126 |
| 661 | 3300049571 | Ga0501034_0008845 | Ga0501034_0008845_8062_8445 | 126 |
| 662 | 3300049571 | Ga0501034_0028381 | Ga0501034_0028381_4646_5029 | 126 |
| 663 | 3300049571 | Ga0501034_0098974 | Ga0501034_0098974_931_1311 | 126 |
| 664 | 3300049573 | Ga0501037_0072787 | Ga0501037_0072787_929_1309 | 126 |
| 665 | 3300049574 | Ga0501038_0073780 | Ga0501038_0073780_1306_1686 | 126 |
| 666 | 3300049575 | Ga0501039_0057892 | Ga0501039_0057892_1637_2017 | 126 |
| 667 | 3300049579 | Ga0501043_0074448 | Ga0501043_0074448_1002_1382 | 126 |
| 668 | 3300049581 | Ga0501047_0137884 | Ga0501047_0137884_880_1260 | 126 |
| 669 | 3300049589 | Ga0501073_1059625 | Ga0501073_1059625_19_399 | 126 |
| 670 | 3300049703 | Ga0501219_000734 | Ga0501219_000734_430_810 | 126 |
| 671 | 3300049705 | Ga0501225_0066205 | Ga0501225_0066205_160_540 | 126 |
| 672 | 3300049742 | Ga0501080_0186850 | Ga0501080_0186850_659_1039 | 126 |
| 673 | 3300049822 | Ga0501035_0208234 | Ga0501035_0208234_578_958 | 126 |
| 674 | 3300049823 | Ga0501044_0124634 | Ga0501044_0124634_1507_1890 | 126 |
| 675 | 3300049823 | Ga0501044_0192163 | Ga0501044_0192163_906_1286 | 126 |
| 676 | 3300049823 | Ga0501044_0270035 | Ga0501044_0270035_438_818 | 126 |
| 677 | 3300050005 | Ga0501284_00005 | Ga0501284_00005_107648_108028 | 126 |
| 678 | 3300050493 | nmdc:mga0k408_390250_c1 | nmdc:mga0k408_390250_c1_261_641 | 126 |
| 679 | 3300050511 | nmdc:mga08y16_1859433_c1 | nmdc:mga08y16_1859433_c1_80_460 | 126 |
| 680 | 3300050511 | nmdc:mga08y16_250255_c1 | nmdc:mga08y16_250255_c1_702_1085 | 126 |
| 681 | 3300053088 | Ga0500644_0106368 | Ga0500644_0106368_421_801 | 126 |
| 682 | 3300053090 | Ga0500646_0026750 | Ga0500646_0026750_323_703 | 126 |
| 683 | 3300053090 | Ga0500646_0028265 | Ga0500646_0028265_940_1320 | 126 |
| 684 | 3300053090 | Ga0500646_0058421 | Ga0500646_0058421_696_1079 | 126 |
| 685 | 3300053092 | Ga0500583_0022499 | Ga0500583_0022499_1107_1487 | 126 |
| 686 | 3300053108 | Ga0500562_000035 | Ga0500562_000035_11212_11595 | 126 |
| 687 | 3300053136 | Ga0500559_0154224 | Ga0500559_0154224_40_423 | 126 |
| 688 | 3300053156 | Ga0500622_0000298 | Ga0500622_0000298_47928_48311 | 126 |
| 689 | 3300053156 | Ga0500622_0004063 | Ga0500622_0004063_6846_7226 | 126 |
| 690 | 3300055283 | Ga0500661_016655 | Ga0500661_016655_333_716 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2m89-assembly1.cif.gz_B | solution structure of the aha1 dimer from colwellia psychrerythraea | 0.777 | 5 | 121 |
| 3cnw-assembly1.cif.gz_A | three-dimensional structure of the protein xoxi (q81ay6) from bacillus cereus. northeast structural genomics consortium target bcr196. | 0.7698 | 6 | 123 |
| 3f08-assembly1.cif.gz_A | crystal structure of the putative uncharacterized protein q6hg14 from bacilllus thuringiensis. northeast structural genomics consortium target bur153. | 0.7673 | 5 | 123 |
| 5ur6-assembly1.cif.gz_A-2 | pyr1 bound to the rationally designed agonist cyanabactin | 0.7576 | 3 | 122 |
| 4n0g-assembly1.cif.gz_C | crystal structure of pyl13-pp2ca complex | 0.7555 | 3 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2S2_126_378_3.90.1690.10 | Alpha Beta;Alpha-Beta Complex;phage-related protein like fold;phage-related protein like domain | 0.7894 | 80 | 102 | 3.90.1690.10 |
| 2m89B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.777 | 5 | 121 | 3.30.530.20 |
| af_Q8T2R4_3_145_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7674 | 5 | 122 | 3.30.530.20 |
| af_O53773_104_241_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7543 | 7 | 121 | 3.30.530.20 |
| af_Q9C7I3_1_151_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7491 | 4 | 124 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3RXA8-F1-model_v4 | ATPase | 0.906 | 1 | 126 |
|
| AF-A0A2E4J8N8-F1-model_v4 | START-like domain-containing protein | 0.9034 | 5 | 126 |
|
| AF-A0A6I7QZK0-F1-model_v4 | ATPase | 0.9013 | 1 | 126 |
|
| AF-A0A6I5I4F3-F1-model_v4 | SRPBCC domain-containing protein | 0.9007 | 4 | 125 |
|
| AF-A0A7Y3KJP8-F1-model_v4 | START-like domain-containing protein | 0.8996 | 4 | 125 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar