F475449

General Info

Members Datasets Scaffolds Average Seq Length
690 271 689 126

Family's Representative Sequence

Representative Sequence 3300015265|Ga0182005_1198308|Ga0182005_11983081
Length 144
Sequence LQAANNKICTREAVKSPLMAKKQMFTLEYPVRCSPPILYGFLSTPAGLQEWFADKVDERDNVFMFSWNGSVEKAEVVDSEIDKFIRFRWLTSAKDEYFEFRIEKTEITNQTILVIRDFAEKAEIKDQSQLWETQVKDLFHRLGN

Samples

Sample ID Description Type Environment
1 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
186 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
207 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
214 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
252 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
264 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
265 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.14
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.46
Nodule 0
Rhizoplane 1.3
Rhizosphere 92.32
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10029653 3300001979 Bacteria 1794
2 JGI24743J22301_10079672 3300001991 Bacteria 690
3 JGI24743J22301_10097633 3300001991 Bacteria 631
4 JGI25406J46586_10001126 3300003203 Bacteria 12525
5 rootH1_10067506 3300003316 Bacteria 1737
6 rootL2_10116707 3300003322 Bacteria 1542
7 rootL2_10146122 3300003322 Bacteria 1943
8 rootH1_10143165 3300003323 Bacteria 5013
9 JGI25160J50197_1002483 3300003354 Bacteria 8564
10 Ga0058862_11132398 3300004803 Unclassified 572
11 Ga0065714_10343038 3300005288 Unclassified 643
12 Ga0065714_10403580 3300005288 Unclassified 588
13 Ga0065704_10375605 3300005289 Bacteria 780
14 Ga0065712_10001725 3300005290 Bacteria 5366
15 Ga0065712_10003696 3300005290 Bacteria 5348
16 Ga0065715_10002173 3300005293 Bacteria 5596
17 Ga0065707_10127439 3300005295 Unclassified 1984
18 Ga0065707_10171062 3300005295 Bacteria 1484
19 Ga0070658_10028772 3300005327 Bacteria 4462
20 Ga0070658_10171993 3300005327 Bacteria 1820
21 Ga0070683_100005997 3300005329 Bacteria 10180
22 Ga0070683_100654742 3300005329 Unclassified 1006
23 Ga0070690_100115733 3300005330 Bacteria 1794
24 Ga0070670_100085915 3300005331 Bacteria 2703
25 Ga0070670_100137214 3300005331 Bacteria 2114
26 Ga0070670_100188277 3300005331 Bacteria 1792
27 Ga0070670_100507342 3300005331 Bacteria 1073
28 Ga0070670_100728859 3300005331 Bacteria 892
29 Ga0070670_101076922 3300005331 Bacteria 732
30 Ga0070670_101784477 3300005331 Unclassified 566
31 Ga0070677_10030389 3300005333 Bacteria 2056
32 Ga0070677_10417757 3300005333 Unclassified 710
33 Ga0068869_100108348 3300005334 Bacteria 2110
34 Ga0068869_100134207 3300005334 Unclassified 1905
35 Ga0068869_100328471 3300005334 Unclassified 1242
36 Ga0070666_10006755 3300005335 Bacteria 7066
37 Ga0070680_100028343 3300005336 Bacteria 4491
38 Ga0070680_100114416 3300005336 Bacteria 2248
39 Ga0070682_100002896 3300005337 Bacteria 9517
40 Ga0070682_100235899 3300005337 Bacteria 1310
41 Ga0068868_100007430 3300005338 Bacteria 7801
42 Ga0068868_100016254 3300005338 Bacteria 5521
43 Ga0068868_100221482 3300005338 Bacteria 1584
44 Ga0068868_100244957 3300005338 Bacteria 1507
45 Ga0068868_100421982 3300005338 Bacteria 1155
46 Ga0070660_100002586 3300005339 Bacteria 12419
47 Ga0070660_100165849 3300005339 Bacteria 1782
48 Ga0070689_100054741 3300005340 Bacteria 3089
49 Ga0070689_100753677 3300005340 Bacteria 853
50 Ga0070689_101182814 3300005340 Unclassified 686
51 Ga0070689_101199668 3300005340 Bacteria 681
52 Ga0070691_10089528 3300005341 Bacteria 1516
53 Ga0070687_100155599 3300005343 Bacteria 1346
54 Ga0070687_100996376 3300005343 Bacteria 607
55 Ga0070687_101106574 3300005343 Bacteria 580
56 Ga0070661_100002631 3300005344 Bacteria 12276
57 Ga0070661_100557090 3300005344 Bacteria 923
58 Ga0070661_100578262 3300005344 Bacteria 906
59 Ga0070668_100356185 3300005347 Bacteria 1240
60 Ga0070668_100620860 3300005347 Bacteria 947
61 Ga0070669_100433280 3300005353 Unclassified 1081
62 Ga0070669_100600415 3300005353 Bacteria 922
63 Ga0070669_100627282 3300005353 Bacteria 902
64 Ga0070669_101010914 3300005353 Unclassified 714
65 Ga0070669_101614860 3300005353 Bacteria 564
66 Ga0070669_101746479 3300005353 Bacteria 543
67 Ga0070675_100048920 3300005354 Bacteria 3468
68 Ga0070675_100221708 3300005354 Bacteria 1647
69 Ga0070675_100272287 3300005354 Bacteria 1486
70 Ga0070675_100816683 3300005354 Bacteria 853
71 Ga0070671_100008104 3300005355 Bacteria 8414
72 Ga0070671_100060942 3300005355 Bacteria 3142
73 Ga0070671_101413896 3300005355 Unclassified 615
74 Ga0070674_100221708 3300005356 Bacteria 1471
75 Ga0070674_100505232 3300005356 Bacteria 1007
76 Ga0070673_100023983 3300005364 Bacteria 4465
77 Ga0070673_100052455 3300005364 Bacteria 3200
78 Ga0070673_100110151 3300005364 Bacteria 2282
79 Ga0070673_100150339 3300005364 Bacteria 1972
80 Ga0070673_102219752 3300005364 Bacteria 522
81 Ga0070688_100012568 3300005365 Bacteria 4746
82 Ga0070688_100561878 3300005365 Bacteria 869
83 Ga0070659_100002110 3300005366 Bacteria 14167
84 Ga0070667_100002640 3300005367 Bacteria 15524
85 Ga0070667_100068354 3300005367 Bacteria 3023
86 Ga0070667_100257326 3300005367 Bacteria 1562
87 Ga0070667_100431782 3300005367 Bacteria 1202
88 Ga0070709_10973324 3300005434 Bacteria 674
89 Ga0070710_10444206 3300005437 Unclassified 878
90 Ga0070701_10078103 3300005438 Bacteria 1785
91 Ga0070701_10081869 3300005438 Bacteria 1749
92 Ga0070711_101565931 3300005439 Bacteria 576
93 Ga0070700_100116326 3300005441 Bacteria 1785
94 Ga0070694_100467393 3300005444 Bacteria 999
95 Ga0070663_100804190 3300005455 Bacteria 806
96 Ga0070663_101213739 3300005455 Unclassified 663
97 Ga0070663_101561803 3300005455 Bacteria 588
98 Ga0070678_100018048 3300005456 Bacteria 4563
99 Ga0070662_100005618 3300005457 Bacteria 8020
100 Ga0070662_100114020 3300005457 Bacteria 2063
101 Ga0070662_100305695 3300005457 Bacteria 1293
102 Ga0070681_10137758 3300005458 Bacteria 2371
103 Ga0070681_10448110 3300005458 Bacteria 1203
104 Ga0068867_100302590 3300005459 Unclassified 1319
105 Ga0068867_100333660 3300005459 Bacteria 1260
106 Ga0068867_100340013 3300005459 Bacteria 1249
107 Ga0068867_101197224 3300005459 Bacteria 697
108 Ga0070685_10270614 3300005466 Bacteria 1133
109 Ga0070685_10338963 3300005466 Bacteria 1024
110 Ga0070685_10942243 3300005466 Bacteria 645
111 Ga0070707_100143289 3300005468 Bacteria 2326
112 Ga0070698_100000267 3300005471 Bacteria 52849
113 Ga0070698_100056165 3300005471 Bacteria 3990
114 Ga0070679_100027317 3300005530 Bacteria 5616
115 Ga0070679_100085573 3300005530 Bacteria 3140
116 Ga0070679_101310501 3300005530 Unclassified 670
117 Ga0070679_102021057 3300005530 Bacteria 525
118 Ga0070684_100001215 3300005535 Bacteria 18504
119 Ga0070684_100259073 3300005535 Bacteria 1591
120 Ga0070684_100390540 3300005535 Unclassified 1282
121 Ga0070684_100577728 3300005535 Bacteria 1044
122 Ga0070697_100330333 3300005536 Bacteria 1314
123 Ga0068853_100013898 3300005539 Bacteria 6581
124 Ga0068853_100326092 3300005539 Bacteria 1424
125 Ga0068853_100339403 3300005539 Bacteria 1396
126 Ga0068853_100345483 3300005539 Bacteria 1383
127 Ga0068853_100374970 3300005539 Unclassified 1328
128 Ga0068853_100780451 3300005539 Unclassified 914
129 Ga0068853_100802234 3300005539 Bacteria 902
130 Ga0068853_101253964 3300005539 Bacteria 716
131 Ga0070672_100311963 3300005543 Bacteria 1335
132 Ga0070672_100519840 3300005543 Bacteria 1031
133 Ga0070672_100896556 3300005543 Bacteria 783
134 Ga0070672_101261771 3300005543 Unclassified 659
135 Ga0070672_101279245 3300005543 Unclassified 654
136 Ga0070672_101711054 3300005543 Bacteria 565
137 Ga0070686_100594516 3300005544 Unclassified 871
138 Ga0070686_100756874 3300005544 Bacteria 779
139 Ga0070693_100431633 3300005547 Bacteria 920
140 Ga0070693_100568503 3300005547 Bacteria 814
141 Ga0070665_100237515 3300005548 Bacteria 1823
142 Ga0070704_100048379 3300005549 Bacteria 2976
143 Ga0070704_100382258 3300005549 Bacteria 1197
144 Ga0068855_100023607 3300005563 Bacteria 7366
145 Ga0068855_101655718 3300005563 Bacteria 653
146 Ga0070664_100004754 3300005564 Bacteria 10890
147 Ga0070664_100948704 3300005564 Unclassified 807
148 Ga0070664_100965497 3300005564 Unclassified 800
149 Ga0068857_100014523 3300005577 Bacteria 6869
150 Ga0068857_100021834 3300005577 Bacteria 5633
151 Ga0068857_100090163 3300005577 Bacteria 2744
152 Ga0068857_100321883 3300005577 Bacteria 1428
153 Ga0068854_100014594 3300005578 Bacteria 5182
154 Ga0068854_100982093 3300005578 Bacteria 747
155 Ga0068854_101628915 3300005578 Bacteria 589
156 Ga0068856_100016680 3300005614 Bacteria 7114
157 Ga0068856_100046347 3300005614 Bacteria 4282
158 Ga0068856_100775841 3300005614 Unclassified 978
159 Ga0068856_101734754 3300005614 Bacteria 636
160 Ga0070702_101007560 3300005615 Bacteria 660
161 Ga0068852_100001659 3300005616 Bacteria 15178
162 Ga0068852_100014178 3300005616 Bacteria 6123
163 Ga0068852_100070866 3300005616 Bacteria 3059
164 Ga0068852_100093543 3300005616 Bacteria 2695
165 Ga0068852_100134320 3300005616 Bacteria 2283
166 Ga0068852_100170673 3300005616 Bacteria 2038
167 Ga0068852_100253146 3300005616 Bacteria 1688
168 Ga0068852_100664554 3300005616 Bacteria 1050
169 Ga0068852_100818284 3300005616 Unclassified 946
170 Ga0068859_100031009 3300005617 Bacteria 5366
171 Ga0068859_100076094 3300005617 Bacteria 3397
172 Ga0068859_100514566 3300005617 Bacteria 1292
173 Ga0068859_100590054 3300005617 Bacteria 1204
174 Ga0068859_100611453 3300005617 Bacteria 1183
175 Ga0068859_100774946 3300005617 Bacteria 1047
176 Ga0068859_100818637 3300005617 Bacteria 1018
177 Ga0068859_100820479 3300005617 Bacteria 1017
178 Ga0068859_101418885 3300005617 Bacteria 766
179 Ga0068859_101670103 3300005617 Bacteria 703
180 Ga0068859_102806984 3300005617 Unclassified 534
181 Ga0068864_100105344 3300005618 Bacteria 2506
182 Ga0068864_100270365 3300005618 Bacteria 1583
183 Ga0068864_100316414 3300005618 Bacteria 1465
184 Ga0068864_100632865 3300005618 Bacteria 1040
185 Ga0068864_101149251 3300005618 Bacteria 774
186 Ga0068864_102048744 3300005618 Unclassified 578
187 Ga0068866_10261797 3300005718 Bacteria 1063
188 Ga0068861_100019358 3300005719 Bacteria 4862
189 Ga0068861_100126207 3300005719 Bacteria 2070
190 Ga0068861_101212787 3300005719 Bacteria 730
191 Ga0068851_10011250 3300005834 Bacteria 4194
192 Ga0068851_10400198 3300005834 Bacteria 808
193 Ga0068870_10186074 3300005840 Bacteria 1250
194 Ga0068863_100039165 3300005841 Bacteria 4510
195 Ga0068863_100323810 3300005841 Bacteria 1497
196 Ga0068863_100778736 3300005841 Bacteria 953
197 Ga0068858_101002155 3300005842 Bacteria 818
198 Ga0068858_101244194 3300005842 Bacteria 732
199 Ga0068858_101971556 3300005842 Unclassified 577
200 Ga0068860_100000052 3300005843 Bacteria 207351
201 Ga0068860_100001511 3300005843 Bacteria 25059
202 Ga0068860_100003681 3300005843 Bacteria 15776
203 Ga0068860_100431557 3300005843 Unclassified 1307
204 Ga0068862_100189755 3300005844 Bacteria 1849
205 Ga0068862_100865500 3300005844 Bacteria 886
206 Ga0068862_101370150 3300005844 Bacteria 710
207 Ga0081539_10000885 3300005985 Bacteria 57257
208 Ga0075366_10114174 3300006195 Bacteria 1626
209 Ga0075366_10693690 3300006195 Bacteria 632
210 Ga0097621_100000118 3300006237 Bacteria 45384
211 Ga0097621_100014934 3300006237 Bacteria 5828
212 Ga0097621_100059277 3300006237 Bacteria 3133
213 Ga0097621_100145640 3300006237 Bacteria 2028
214 Ga0097621_100363638 3300006237 Bacteria 1289
215 Ga0097621_100405122 3300006237 Bacteria 1222
216 Ga0097621_101328429 3300006237 Bacteria 679
217 Ga0097621_101774726 3300006237 Bacteria 588
218 Ga0068871_100006528 3300006358 Bacteria 8261
219 Ga0068871_100019364 3300006358 Bacteria 5196
220 Ga0068871_100030647 3300006358 Bacteria 4238
221 Ga0068871_100476567 3300006358 Bacteria 1122
222 Ga0068871_100567068 3300006358 Bacteria 1030
223 Ga0068871_100975384 3300006358 Bacteria 788
224 Ga0075428_100003257 3300006844 Bacteria 17776
225 Ga0075428_100019714 3300006844 Bacteria 7463
226 Ga0075428_100068646 3300006844 Bacteria 3877
227 Ga0075428_100568495 3300006844 Bacteria 1212
228 Ga0075428_101572528 3300006844 Bacteria 688
229 Ga0075430_100018363 3300006846 Bacteria 5952
230 Ga0075430_100199083 3300006846 Bacteria 1664
231 Ga0075430_100425018 3300006846 Bacteria 1097
232 Ga0075431_100092318 3300006847 Bacteria 3124
233 Ga0075431_100118915 3300006847 Bacteria 2726
234 Ga0075429_100054367 3300006880 Bacteria 3482
235 Ga0075429_101567893 3300006880 Bacteria 573
236 Ga0068865_100167098 3300006881 Bacteria 1683
237 Ga0068865_100303956 3300006881 Bacteria 1278
238 Ga0068865_100442243 3300006881 Bacteria 1073
239 Ga0097620_100031009 3300006931 Bacteria 5366
240 Ga0097620_100076089 3300006931 Bacteria 3397
241 Ga0097620_100514482 3300006931 Bacteria 1292
242 Ga0097620_100590027 3300006931 Bacteria 1204
243 Ga0097620_100611429 3300006931 Bacteria 1183
244 Ga0097620_100774986 3300006931 Bacteria 1047
245 Ga0097620_100818740 3300006931 Bacteria 1018
246 Ga0097620_100820439 3300006931 Bacteria 1017
247 Ga0097620_101418714 3300006931 Bacteria 766
248 Ga0097620_101670067 3300006931 Bacteria 703
249 Ga0097620_102807037 3300006931 Unclassified 534
250 Ga0105251_10167846 3300009011 Bacteria 989
251 Ga0105240_10022086 3300009093 Bacteria 8445
252 Ga0105240_11331757 3300009093 Bacteria 756
253 Ga0111539_10419252 3300009094 Bacteria 1559
254 Ga0111539_11027871 3300009094 Bacteria 958
255 Ga0111539_12689174 3300009094 Bacteria 577
256 Ga0111539_13274333 3300009094 Bacteria 522
257 Ga0105245_11022539 3300009098 Bacteria 871
258 Ga0114129_10270014 3300009147 Bacteria 2276
259 Ga0114129_11243441 3300009147 Bacteria 925
260 Ga0105241_10018266 3300009174 Bacteria 5157
261 Ga0105241_10309763 3300009174 Bacteria 1358
262 Ga0105241_10428110 3300009174 Bacteria 1166
263 Ga0105241_10616681 3300009174 Bacteria 982
264 Ga0105241_11122849 3300009174 Bacteria 741
265 Ga0105241_11180567 3300009174 Bacteria 724
266 Ga0105241_11419537 3300009174 Bacteria 665
267 Ga0105241_11462805 3300009174 Bacteria 656
268 Ga0105241_12347541 3300009174 Bacteria 531
269 Ga0105242_10134758 3300009176 Bacteria 2136
270 Ga0105242_10598981 3300009176 Bacteria 1064
271 Ga0105242_11104499 3300009176 Bacteria 807
272 Ga0105242_11846343 3300009176 Unclassified 644
273 Ga0105248_10014430 3300009177 Bacteria 8696
274 Ga0105237_10016806 3300009545 Bacteria 7595
275 Ga0105237_10398104 3300009545 Bacteria 1382
276 Ga0105237_10629792 3300009545 Bacteria 1079
277 Ga0105237_10884182 3300009545 Unclassified 900
278 Ga0105237_12173159 3300009545 Bacteria 564
279 Ga0105238_10079918 3300009551 Bacteria 3259
280 Ga0105238_10102620 3300009551 Bacteria 2841
281 Ga0105238_11414675 3300009551 Bacteria 723
282 Ga0105249_10025456 3300009553 Bacteria 5328
283 Ga0105249_10027907 3300009553 Bacteria 5095
284 Ga0105249_10087032 3300009553 Bacteria 2915
285 Ga0105249_10247388 3300009553 Bacteria 1766
286 Ga0105249_10432361 3300009553 Bacteria 1352
287 Ga0105249_10934961 3300009553 Bacteria 935
288 Ga0105249_12040307 3300009553 Bacteria 646
289 Ga0105239_10001888 3300010375 Bacteria 27395
290 Ga0105239_10038490 3300010375 Bacteria 5241
291 Ga0105239_10218000 3300010375 Bacteria 2140
292 Ga0105239_10717644 3300010375 Bacteria 1143
293 Ga0105239_10750457 3300010375 Bacteria 1117
294 Ga0105239_12728323 3300010375 Bacteria 576
295 Ga0105239_12838920 3300010375 Bacteria 565
296 Ga0105239_13019986 3300010375 Bacteria 548
297 Ga0105246_10107348 3300011119 Bacteria 2044
298 Ga0105246_10825886 3300011119 Unclassified 825
299 Ga0105246_10903590 3300011119 Bacteria 792
300 Ga0105246_12397709 3300011119 Bacteria 517
301 Ga0157373_10003884 3300013100 Bacteria 11294
302 Ga0157373_10300863 3300013100 Bacteria 1138
303 Ga0157373_10340442 3300013100 Bacteria 1069
304 Ga0157373_10992428 3300013100 Bacteria 626
305 Ga0157371_10066429 3300013102 Bacteria 2553
306 Ga0157371_10576598 3300013102 Bacteria 835
307 Ga0157371_10847500 3300013102 Bacteria 691
308 Ga0157370_10003253 3300013104 Bacteria 19143
309 Ga0157370_10149775 3300013104 Bacteria 2172
310 Ga0157370_10301326 3300013104 Bacteria 1479
311 Ga0157370_10513005 3300013104 Unclassified 1101
312 Ga0157369_10004961 3300013105 Bacteria 15592
313 Ga0157369_10022438 3300013105 Bacteria 7043
314 Ga0157369_10282780 3300013105 Bacteria 1728
315 Ga0157369_10321308 3300013105 Bacteria 1609
316 Ga0157369_11383196 3300013105 Bacteria 717
317 Ga0157374_10005011 3300013296 Bacteria 11112
318 Ga0157374_10057986 3300013296 Bacteria 3618
319 Ga0157374_10233985 3300013296 Bacteria 1805
320 Ga0157374_10861294 3300013296 Bacteria 923
321 Ga0157374_12049466 3300013296 Unclassified 599
322 Ga0157378_10005153 3300013297 Bacteria 11475
323 Ga0157378_10011525 3300013297 Bacteria 7740
324 Ga0157378_10012883 3300013297 Bacteria 7323
325 Ga0157378_10019286 3300013297 Bacteria 5995
326 Ga0157378_10120808 3300013297 Bacteria 2415
327 Ga0157378_10365328 3300013297 Bacteria 1413
328 Ga0157378_10591958 3300013297 Unclassified 1119
329 Ga0157378_10731502 3300013297 Unclassified 1011
330 Ga0157378_12012442 3300013297 Unclassified 628
331 Ga0163162_10000086 3300013306 Bacteria 85949
332 Ga0163162_10000464 3300013306 Bacteria 37564
333 Ga0163162_10004156 3300013306 Bacteria 13900
334 Ga0163162_10013496 3300013306 Bacteria 7975
335 Ga0163162_10242378 3300013306 Bacteria 1934
336 Ga0163162_10272042 3300013306 Bacteria 1826
337 Ga0163162_10621079 3300013306 Bacteria 1206
338 Ga0163162_10730753 3300013306 Bacteria 1110
339 Ga0163162_10968537 3300013306 Bacteria 961
340 Ga0157372_10020933 3300013307 Bacteria 7060
341 Ga0157372_10024792 3300013307 Bacteria 6518
342 Ga0157372_10033647 3300013307 Bacteria 5632
343 Ga0157372_10048401 3300013307 Bacteria 4726
344 Ga0157372_10054590 3300013307 Bacteria 4458
345 Ga0157372_10054606 3300013307 Bacteria 4457
346 Ga0157372_10658413 3300013307 Bacteria 1219
347 Ga0157372_10755660 3300013307 Bacteria 1130
348 Ga0157372_11569796 3300013307 Bacteria 758
349 Ga0157372_13031117 3300013307 Bacteria 537
350 Ga0157375_10000115 3300013308 Bacteria 77964
351 Ga0157375_10027854 3300013308 Bacteria 5287
352 Ga0157375_10132456 3300013308 Unclassified 2613
353 Ga0157375_10281410 3300013308 Bacteria 1826
354 Ga0157375_10447738 3300013308 Bacteria 1457
355 Ga0157375_10529799 3300013308 Bacteria 1341
356 Ga0157375_10561012 3300013308 Bacteria 1303
357 Ga0157375_10751224 3300013308 Bacteria 1127
358 Ga0157375_10789743 3300013308 Bacteria 1099
359 Ga0157375_10800290 3300013308 Unclassified 1091
360 Ga0157375_10866269 3300013308 Bacteria 1049
361 Ga0157375_10902366 3300013308 Bacteria 1028
362 Ga0163163_10396031 3300014325 Bacteria 1439
363 Ga0163163_10433688 3300014325 Bacteria 1373
364 Ga0163163_11003109 3300014325 Unclassified 898
365 Ga0163163_11007566 3300014325 Bacteria 896
366 Ga0163163_12095391 3300014325 Unclassified 625
367 Ga0157380_10008681 3300014326 Bacteria 7263
368 Ga0157380_10189007 3300014326 Unclassified 1816
369 Ga0157380_10781112 3300014326 Bacteria 970
370 Ga0157380_11730613 3300014326 Bacteria 683
371 Ga0157377_10006202 3300014745 Bacteria 5686
372 Ga0157377_10098365 3300014745 Unclassified 1739
373 Ga0157377_10376927 3300014745 Bacteria 959
374 Ga0157377_10716034 3300014745 Bacteria 728
375 Ga0157379_10033649 3300014968 Bacteria 4571
376 Ga0157379_10590918 3300014968 Bacteria 1036
377 Ga0157379_10784602 3300014968 Bacteria 898
378 Ga0157376_10001060 3300014969 Bacteria 18012
379 Ga0157376_10243590 3300014969 Bacteria 1676
380 Ga0157376_10972044 3300014969 Bacteria 870
381 Ga0157376_11132678 3300014969 Bacteria 809
382 Ga0182005_1198308 3300015265 Bacteria 603
383 Ga0163161_10006573 3300017792 Bacteria 8049
384 Ga0163161_10010591 3300017792 Bacteria 6383
385 Ga0163161_10065108 3300017792 Bacteria 2660
386 Ga0163161_11998025 3300017792 Bacteria 516
387 Ga0213876_10002683 3300021384 Bacteria 10387
388 Ga0213876_10042901 3300021384 Bacteria 2390
389 Ga0213876_10580682 3300021384 Bacteria 596
390 Ga0207666_1007296 3300025271 Bacteria 1453
391 Ga0207426_1000170 3300025302 Bacteria 164216
392 Ga0207697_10051902 3300025315 Bacteria 1695
393 Ga0207656_10037489 3300025321 Bacteria 2040
394 Ga0207656_10439569 3300025321 Bacteria 658
395 Ga0207656_10493150 3300025321 Bacteria 621
396 Ga0207682_10015346 3300025893 Bacteria 2982
397 Ga0207682_10457084 3300025893 Unclassified 605
398 Ga0207692_10098521 3300025898 Bacteria 1600
399 Ga0207642_10266579 3300025899 Bacteria 979
400 Ga0207642_10401491 3300025899 Bacteria 820
401 Ga0207688_10282020 3300025901 Bacteria 1012
402 Ga0207680_10104366 3300025903 Bacteria 1827
403 Ga0207680_10696142 3300025903 Bacteria 728
404 Ga0207680_10780871 3300025903 Bacteria 685
405 Ga0207647_10014937 3300025904 Bacteria 5336
406 Ga0207647_10179952 3300025904 Bacteria 1228
407 Ga0207647_10211054 3300025904 Bacteria 1121
408 Ga0207685_10352099 3300025905 Bacteria 743
409 Ga0207645_10074490 3300025907 Bacteria 2173
410 Ga0207643_10041304 3300025908 Bacteria 2599
411 Ga0207643_10242777 3300025908 Bacteria 1108
412 Ga0207643_10459958 3300025908 Bacteria 810
413 Ga0207705_10098526 3300025909 Bacteria 2148
414 Ga0207705_10994000 3300025909 Unclassified 648
415 Ga0207654_10819695 3300025911 Bacteria 673
416 Ga0207654_11019422 3300025911 Bacteria 602
417 Ga0207707_10148968 3300025912 Bacteria 2046
418 Ga0207707_10688136 3300025912 Bacteria 859
419 Ga0207695_10791457 3300025913 Bacteria 828
420 Ga0207671_10024059 3300025914 Bacteria 4584
421 Ga0207671_10583542 3300025914 Unclassified 891
422 Ga0207663_10682873 3300025916 Bacteria 812
423 Ga0207660_10341093 3300025917 Bacteria 1199
424 Ga0207660_10808190 3300025917 Bacteria 765
425 Ga0207662_10039442 3300025918 Bacteria 2771
426 Ga0207662_10110915 3300025918 Bacteria 1710
427 Ga0207657_10010494 3300025919 Bacteria 9240
428 Ga0207657_10316532 3300025919 Bacteria 1234
429 Ga0207649_10427298 3300025920 Bacteria 996
430 Ga0207649_10624932 3300025920 Bacteria 830
431 Ga0207649_10745036 3300025920 Bacteria 762
432 Ga0207649_10848645 3300025920 Unclassified 714
433 Ga0207652_10131694 3300025921 Bacteria 2230
434 Ga0207652_10165910 3300025921 Bacteria 1980
435 Ga0207652_11806204 3300025921 Bacteria 516
436 Ga0207646_10228377 3300025922 Bacteria 1682
437 Ga0207681_10288536 3300025923 Bacteria 1294
438 Ga0207681_10545827 3300025923 Bacteria 953
439 Ga0207681_10696015 3300025923 Unclassified 845
440 Ga0207681_11073802 3300025923 Bacteria 676
441 Ga0207681_11203718 3300025923 Bacteria 636
442 Ga0207681_11844561 3300025923 Bacteria 504
443 Ga0207694_10320601 3300025924 Bacteria 1279
444 Ga0207650_10032059 3300025925 Bacteria 3800
445 Ga0207650_10135502 3300025925 Bacteria 1931
446 Ga0207650_10793840 3300025925 Unclassified 802
447 Ga0207650_10884667 3300025925 Bacteria 758
448 Ga0207659_10487047 3300025926 Bacteria 1042
449 Ga0207659_11061442 3300025926 Bacteria 697
450 Ga0207644_10013035 3300025931 Bacteria 5533
451 Ga0207644_10914854 3300025931 Bacteria 735
452 Ga0207690_10016741 3300025932 Bacteria 4467
453 Ga0207690_11453891 3300025932 Bacteria 573
454 Ga0207706_10009158 3300025933 Bacteria 9104
455 Ga0207686_10000429 3300025934 Bacteria 28636
456 Ga0207686_10076175 3300025934 Bacteria 2174
457 Ga0207686_10446922 3300025934 Bacteria 994
458 Ga0207686_10868051 3300025934 Bacteria 727
459 Ga0207686_11689175 3300025934 Unclassified 523
460 Ga0207670_10364557 3300025936 Bacteria 1147
461 Ga0207670_11726164 3300025936 Unclassified 532
462 Ga0207669_10782733 3300025937 Bacteria 790
463 Ga0207669_10963429 3300025937 Bacteria 715
464 Ga0207704_10115657 3300025938 Bacteria 1823
465 Ga0207704_10125735 3300025938 Bacteria 1765
466 Ga0207704_10517668 3300025938 Bacteria 964
467 Ga0207704_11495476 3300025938 Bacteria 579
468 Ga0207691_10504339 3300025940 Bacteria 1027
469 Ga0207691_10863763 3300025940 Unclassified 758
470 Ga0207711_10070479 3300025941 Bacteria 3032
471 Ga0207689_10019898 3300025942 Bacteria 5653
472 Ga0207689_10341002 3300025942 Unclassified 1245
473 Ga0207661_10021161 3300025944 Unclassified 4874
474 Ga0207661_10372998 3300025944 Bacteria 1290
475 Ga0207661_11911373 3300025944 Unclassified 539
476 Ga0207679_10032071 3300025945 Bacteria 3684
477 Ga0207679_10182779 3300025945 Bacteria 1736
478 Ga0207679_10188840 3300025945 Bacteria 1711
479 Ga0207679_10899560 3300025945 Bacteria 810
480 Ga0207667_10001711 3300025949 Bacteria 27600
481 Ga0207667_10140405 3300025949 Bacteria 2487
482 Ga0207651_10150943 3300025960 Bacteria 1808
483 Ga0207651_10152963 3300025960 Bacteria 1798
484 Ga0207651_10264589 3300025960 Bacteria 1413
485 Ga0207651_11159372 3300025960 Bacteria 693
486 Ga0207712_10003042 3300025961 Bacteria 10707
487 Ga0207712_10011848 3300025961 Bacteria 5559
488 Ga0207712_10034955 3300025961 Bacteria 3410
489 Ga0207712_10087178 3300025961 Bacteria 2288
490 Ga0207712_10551514 3300025961 Bacteria 991
491 Ga0207712_10866905 3300025961 Bacteria 796
492 Ga0207712_11881378 3300025961 Unclassified 536
493 Ga0207668_10274404 3300025972 Bacteria 1380
494 Ga0207640_10027834 3300025981 Bacteria 3449
495 Ga0207640_10147515 3300025981 Bacteria 1723
496 Ga0207640_10231370 3300025981 Bacteria 1422
497 Ga0207658_10021523 3300025986 Bacteria 4479
498 Ga0207658_10134482 3300025986 Bacteria 1991
499 Ga0207658_10444914 3300025986 Bacteria 1146
500 Ga0207677_10003558 3300026023 Bacteria 8257
501 Ga0207677_10019166 3300026023 Bacteria 4125
502 Ga0207677_10352614 3300026023 Bacteria 1233
503 Ga0207677_10727162 3300026023 Bacteria 883
504 Ga0207677_10757576 3300026023 Bacteria 866
505 Ga0207703_10199518 3300026035 Bacteria 1777
506 Ga0207703_11450971 3300026035 Bacteria 660
507 Ga0207703_12286230 3300026035 Unclassified 516
508 Ga0207639_10051722 3300026041 Bacteria 3126
509 Ga0207639_10315207 3300026041 Bacteria 1387
510 Ga0207639_10400178 3300026041 Bacteria 1237
511 Ga0207639_10653689 3300026041 Unclassified 973
512 Ga0207639_10975943 3300026041 Bacteria 793
513 Ga0207639_11136072 3300026041 Bacteria 733
514 Ga0207639_11177477 3300026041 Unclassified 719
515 Ga0207678_10358172 3300026067 Bacteria 1259
516 Ga0207678_10656454 3300026067 Unclassified 922
517 Ga0207708_10218247 3300026075 Bacteria 1527
518 Ga0207702_10128680 3300026078 Bacteria 2276
519 Ga0207702_10737277 3300026078 Bacteria 972
520 Ga0207641_10011426 3300026088 Bacteria 7288
521 Ga0207641_10091145 3300026088 Bacteria 2667
522 Ga0207641_10181821 3300026088 Bacteria 1926
523 Ga0207641_10222608 3300026088 Bacteria 1750
524 Ga0207648_10094936 3300026089 Bacteria 2608
525 Ga0207648_10146511 3300026089 Bacteria 2083
526 Ga0207648_10384590 3300026089 Unclassified 1269
527 Ga0207648_10463611 3300026089 Bacteria 1155
528 Ga0207648_11126018 3300026089 Bacteria 736
529 Ga0207648_11213489 3300026089 Unclassified 708
530 Ga0207648_11346704 3300026089 Bacteria 671
531 Ga0207676_10064837 3300026095 Bacteria 2907
532 Ga0207676_10081633 3300026095 Bacteria 2627
533 Ga0207676_10281340 3300026095 Bacteria 1510
534 Ga0207676_10355968 3300026095 Bacteria 1355
535 Ga0207676_12142943 3300026095 Bacteria 557
536 Ga0207674_10197620 3300026116 Bacteria 1960
537 Ga0207674_10242487 3300026116 Bacteria 1749
538 Ga0207674_10527578 3300026116 Bacteria 1140
539 Ga0207674_10593369 3300026116 Bacteria 1070
540 Ga0207675_100007383 3300026118 Bacteria 10388
541 Ga0207675_100398640 3300026118 Bacteria 1356
542 Ga0207675_101942683 3300026118 Bacteria 606
543 Ga0207683_10031651 3300026121 Bacteria 4591
544 Ga0207683_10954669 3300026121 Bacteria 796
545 Ga0207698_10003137 3300026142 Bacteria 9906
546 Ga0207698_10036585 3300026142 Bacteria 3605
547 Ga0207698_10042824 3300026142 Bacteria 3387
548 Ga0207698_10096703 3300026142 Bacteria 2434
549 Ga0207698_10733129 3300026142 Bacteria 986
550 Ga0207698_11607100 3300026142 Bacteria 665
551 Ga0207428_10085361 3300027907 Bacteria 2458
552 Ga0207428_10730359 3300027907 Bacteria 707
553 Ga0207428_11134351 3300027907 Bacteria 545
554 Ga0268266_10000071 3300028379 Bacteria 232887
555 Ga0268266_10347496 3300028379 Bacteria 1393
556 Ga0268265_10052843 3300028380 Bacteria 3075
557 Ga0268265_10302748 3300028380 Bacteria 1440
558 Ga0268265_11264157 3300028380 Unclassified 737
559 Ga0268265_12231541 3300028380 Bacteria 554
560 Ga0268264_10001196 3300028381 Bacteria 25064
561 Ga0268264_10236965 3300028381 Bacteria 1688
562 Ga0268264_11890866 3300028381 Bacteria 607
563 Ga0307515_10000078 3300028794 Bacteria 227988
564 Ga0265338_10125422 3300028800 Bacteria 2038
565 Ga0265324_10115654 3300029957 Bacteria 911
566 Ga0307511_10002930 3300030521 Bacteria 17674
567 Ga0265327_10025126 3300031251 Bacteria 3481
568 Ga0265316_10315997 3300031344 Bacteria 1135
569 Ga0307513_10170590 3300031456 Bacteria 2054
570 Ga0307513_10319197 3300031456 Bacteria 1312
571 Ga0307513_11063533 3300031456 Bacteria 520
572 Ga0307509_10679272 3300031507 Bacteria 697
573 Ga0307509_10712124 3300031507 Bacteria 670
574 Ga0307408_100700099 3300031548 Bacteria 911
575 Ga0307408_102490317 3300031548 Bacteria 503
576 Ga0307516_10368767 3300031730 Bacteria 1099
577 Ga0307413_10386864 3300031824 Bacteria 1092
578 Ga0307409_102742989 3300031995 Bacteria 521
579 Ga0307411_12138135 3300032005 Bacteria 524
580 Ga0307415_101342483 3300032126 Bacteria 679
581 Ga0373937_0454279 3300036401 Bacteria 1217
582 Ga0395900_0529223 3300037418 Unclassified 1126
583 Ga0395900_1283570 3300037418 Unclassified 646
584 Ga0395905_0422485 3300037471 Bacteria 1229
585 Ga0395905_1186790 3300037471 Unclassified 667
586 Ga0395901_0821317 3300038443 Bacteria 917
587 Ga0436365_0014802 3300039437 Bacteria 848
588 Ga0436365_0038916 3300039437 Bacteria 17419
589 Ga0436365_0852964 3300039437 Bacteria 1240
590 Ga0436365_1788000 3300039437 Bacteria 1547
591 Ga0436365_1814713 3300039437 Bacteria 12344
592 Ga0439439_0137581 3300041406 Bacteria 688
593 Ga0451800_1534946 3300041459 Bacteria 1689
594 Ga0451804_0788977 3300041463 Bacteria 1063
595 Ga0451807_1622340 3300041486 Unclassified 577
596 Ga0451839_1103437 3300041496 Bacteria 502
597 Ga0451851_1010984 3300041507 Bacteria 693
598 Ga0451853_1577816 3300041512 Bacteria 1417
599 Ga0451853_1587238 3300041512 Bacteria 586
600 Ga0451853_2545082 3300041512 Bacteria 1431
601 Ga0439441_001071 3300042001 Bacteria 3399
602 Ga0439441_084094 3300042001 Bacteria 697
603 Ga0439449_0001249 3300042007 Bacteria 9967
604 Ga0439457_005901 3300042014 Bacteria 3036
605 Ga0439457_147102 3300042014 Bacteria 566
606 Ga0439462_0076497 3300042015 Bacteria 912
607 Ga0450923_162377 3300042125 Unclassified 544
608 Ga0439444_0020005 3300042437 Bacteria 1174
609 Ga0453684_2523482 3300044712 Bacteria 507
610 Ga0466967_0362708 3300045976 Bacteria 1404
611 Ga0495629_0960488 3300046459 Unclassified 558
612 Ga0495594_0034689 3300046499 Bacteria 2746
613 Ga0495648_0006665 3300046524 Bacteria 9353
614 Ga0495598_0032877 3300046537 Bacteria 1469
615 Ga0495621_0106672 3300046539 Bacteria 1071
616 Ga0495667_0188037 3300046559 Bacteria 1324
617 Ga0495656_0193085 3300046615 Bacteria 1007
618 Ga0495634_0438545 3300046642 Bacteria 772
619 Ga0495635_0346618 3300046663 Bacteria 991
620 Ga0495670_0379402 3300046691 Bacteria 763
621 Ga0495674_0207326 3300047319 Bacteria 1625
622 Ga0495676_0305635 3300047321 Bacteria 1072
623 Ga0495684_0711238 3300047471 Bacteria 665
624 Ga0495615_0059635 3300048090 Bacteria 1004
625 Ga0496100_0424305 3300048903 Bacteria 1016
626 Ga0496101_0322326 3300048904 Bacteria 1212
627 Ga0496104_0865350 3300048907 Bacteria 809
628 Ga0496106_1455033 3300048909 Bacteria 528
629 Ga0496114_0006425 3300048917 Bacteria 9254
630 Ga0496114_1395005 3300048917 Bacteria 588
631 Ga0496120_0349754 3300048923 Bacteria 664
632 Ga0501300_059896 3300049523 Unclassified 601
633 Ga0501031_0008041 3300049568 Bacteria 6868
634 Ga0501032_0070165 3300049569 Bacteria 2337
635 Ga0501032_0201920 3300049569 Bacteria 1297
636 Ga0501033_0092551 3300049570 Bacteria 2211
637 Ga0501034_0008845 3300049571 Bacteria 10590
638 Ga0501034_0028381 3300049571 Bacteria 5694
639 Ga0501034_0098974 3300049571 Bacteria 2911
640 Ga0501034_0119357 3300049571 Unclassified 2623
641 Ga0501036_0030055 3300049572 Bacteria 4589
642 Ga0501037_0072787 3300049573 Bacteria 2499
643 Ga0501037_0208357 3300049573 Unclassified 1379
644 Ga0501038_0011536 3300049574 Bacteria 8063
645 Ga0501038_0073780 3300049574 Bacteria 2888
646 Ga0501039_0057892 3300049575 Bacteria 3001
647 Ga0501039_0116502 3300049575 Bacteria 2091
648 Ga0501043_0008513 3300049579 Bacteria 8078
649 Ga0501043_0074448 3300049579 Bacteria 2667
650 Ga0501046_0191848 3300049580 Unclassified 1523
651 Ga0501047_0137884 3300049581 Bacteria 2319
652 Ga0501047_0620885 3300049581 Bacteria 902
653 Ga0501072_0387387 3300049588 Bacteria 1109
654 Ga0501073_1059625 3300049589 Bacteria 557
655 Ga0501219_000734 3300049703 Bacteria 4447
656 Ga0501225_0066205 3300049705 Bacteria 1021
657 Ga0501225_0073536 3300049705 Unclassified 974
658 Ga0501080_0104269 3300049742 Unclassified 2630
659 Ga0501080_0186850 3300049742 Bacteria 1905
660 Ga0501035_0208234 3300049822 Bacteria 1674
661 Ga0501044_0018314 3300049823 Bacteria 7505
662 Ga0501044_0124634 3300049823 Bacteria 2574
663 Ga0501044_0192163 3300049823 Bacteria 2003
664 Ga0501044_0270035 3300049823 Bacteria 1637
665 Ga0501284_00005 3300050005 Bacteria 164758
666 nmdc:mga0k408_390250_c1 3300050493 Bacteria 829
667 nmdc:mga05p37_242686_c1 3300050507 Bacteria 2165
668 nmdc:mga09592_10511_c1 3300050508 Bacteria 7532
669 nmdc:mga09592_961456_c1 3300050508 Unclassified 715
670 nmdc:mga0qj67_15755_c1 3300050509 Bacteria 5726
671 nmdc:mga0qj67_337731_c1 3300050509 Bacteria 1219
672 nmdc:mga06r32_243882_c1 3300050510 Bacteria 1784
673 nmdc:mga06r32_38982_c1 3300050510 Bacteria 4505
674 nmdc:mga08y16_124164_c1 3300050511 Bacteria 2686
675 nmdc:mga08y16_1580117_c1 3300050511 Bacteria 614
676 nmdc:mga08y16_1859433_c1 3300050511 Bacteria 554
677 nmdc:mga08y16_250255_c1 3300050511 Bacteria 1831
678 Ga0500644_0106368 3300053088 Bacteria 1074
679 Ga0500646_0026750 3300053090 Bacteria 1566
680 Ga0500646_0028265 3300053090 Bacteria 1530
681 Ga0500646_0058421 3300053090 Bacteria 1129
682 Ga0500583_0022499 3300053092 Bacteria 2642
683 Ga0500562_000035 3300053108 Bacteria 81116
684 Ga0500559_0154224 3300053136 Bacteria 1078
685 Ga0500616_0080369 3300053153 Bacteria 1639
686 Ga0500622_0000298 3300053156 Bacteria 50798
687 Ga0500622_0004063 3300053156 Bacteria 9401
688 Ga0500645_064797 3300053730 Bacteria 1053
689 Ga0500661_016655 3300055283 Bacteria 1314

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_1580117_c1 nmdc:mga08y16_1580117_c1_54_377 107
2 3300053153 Ga0500616_0080369 Ga0500616_0080369_1283_1609 107
3 3300053730 Ga0500645_064797 Ga0500645_064797_33_359 107
4 3300025961 Ga0207712_11881378 Ga0207712_118813781 110
5 3300005438 Ga0070701_10081869 Ga0070701_100818692 113
6 3300013296 Ga0157374_10233985 Ga0157374_102339853 115
7 3300013308 Ga0157375_10866269 Ga0157375_108662691 118
8 3300014326 Ga0157380_11730613 Ga0157380_117306131 118
9 3300005340 Ga0070689_101182814 Ga0070689_1011828141 119
10 3300005353 Ga0070669_100600415 Ga0070669_1006004152 119
11 3300005543 Ga0070672_101261771 Ga0070672_1012617712 119
12 3300005618 Ga0068864_101149251 Ga0068864_1011492512 119
13 3300025918 Ga0207662_10110915 Ga0207662_101109152 119
14 3300025923 Ga0207681_11203718 Ga0207681_112037182 119
15 3300025934 Ga0207686_11689175 Ga0207686_116891751 119
16 3300025936 Ga0207670_11726164 Ga0207670_117261641 119
17 3300025945 Ga0207679_10182779 Ga0207679_101827793 119
18 3300026089 Ga0207648_11346704 Ga0207648_113467041 119
19 iso_pu_bacteria 2929154850 2929160073 122
20 3300027907 Ga0207428_10085361 Ga0207428_100853613 124
21 3300005288 Ga0065714_10343038 Ga0065714_103430381 125
22 3300005288 Ga0065714_10403580 Ga0065714_104035801 125
23 3300005289 Ga0065704_10375605 Ga0065704_103756052 125
24 3300005290 Ga0065712_10001725 Ga0065712_100017258 125
25 3300005290 Ga0065712_10003696 Ga0065712_100036962 125
26 3300005293 Ga0065715_10002173 Ga0065715_100021733 125
27 3300005295 Ga0065707_10127439 Ga0065707_101274392 125
28 3300005295 Ga0065707_10171062 Ga0065707_101710622 125
29 3300005331 Ga0070670_100188277 Ga0070670_1001882773 125
30 3300005331 Ga0070670_100728859 Ga0070670_1007288592 125
31 3300005331 Ga0070670_101076922 Ga0070670_1010769222 125
32 3300005333 Ga0070677_10030389 Ga0070677_100303893 125
33 3300005333 Ga0070677_10417757 Ga0070677_104177572 125
34 3300005334 Ga0068869_100108348 Ga0068869_1001083482 125
35 3300005334 Ga0068869_100134207 Ga0068869_1001342073 125
36 3300005334 Ga0068869_100328471 Ga0068869_1003284712 125
37 3300005337 Ga0070682_100235899 Ga0070682_1002358992 125
38 3300005340 Ga0070689_100054741 Ga0070689_1000547412 125
39 3300005340 Ga0070689_100753677 Ga0070689_1007536772 125
40 3300005340 Ga0070689_101199668 Ga0070689_1011996682 125
41 3300005341 Ga0070691_10089528 Ga0070691_100895282 125
42 3300005343 Ga0070687_100155599 Ga0070687_1001555993 125
43 3300005343 Ga0070687_100996376 Ga0070687_1009963762 125
44 3300005343 Ga0070687_101106574 Ga0070687_1011065742 125
45 3300005347 Ga0070668_100356185 Ga0070668_1003561852 125
46 3300005353 Ga0070669_100627282 Ga0070669_1006272822 125
47 3300005353 Ga0070669_101010914 Ga0070669_1010109141 125
48 3300005353 Ga0070669_101614860 Ga0070669_1016148602 125
49 3300005353 Ga0070669_101746479 Ga0070669_1017464791 125
50 3300005354 Ga0070675_100048920 Ga0070675_1000489203 125
51 3300005354 Ga0070675_100816683 Ga0070675_1008166832 125
52 3300005355 Ga0070671_101413896 Ga0070671_1014138961 125
53 3300005356 Ga0070674_100221708 Ga0070674_1002217081 125
54 3300005356 Ga0070674_100505232 Ga0070674_1005052322 125
55 3300005364 Ga0070673_100023983 Ga0070673_1000239833 125
56 3300005364 Ga0070673_100110151 Ga0070673_1001101513 125
57 3300005365 Ga0070688_100012568 Ga0070688_1000125681 125
58 3300005438 Ga0070701_10078103 Ga0070701_100781032 125
59 3300005441 Ga0070700_100116326 Ga0070700_1001163262 125
60 3300005444 Ga0070694_100467393 Ga0070694_1004673931 125
61 3300005459 Ga0068867_101197224 Ga0068867_1011972242 125
62 3300005466 Ga0070685_10270614 Ga0070685_102706141 125
63 3300005466 Ga0070685_10338963 Ga0070685_103389632 125
64 3300005468 Ga0070707_100143289 Ga0070707_1001432893 125
65 3300005471 Ga0070698_100000267 Ga0070698_1000002673 125
66 3300005536 Ga0070697_100330333 Ga0070697_1003303332 125
67 3300005539 Ga0068853_100802234 Ga0068853_1008022341 125
68 3300005543 Ga0070672_100311963 Ga0070672_1003119632 125
69 3300005543 Ga0070672_101279245 Ga0070672_1012792452 125
70 3300005544 Ga0070686_100756874 Ga0070686_1007568742 125
71 3300005549 Ga0070704_100048379 Ga0070704_1000483794 125
72 3300005549 Ga0070704_100382258 Ga0070704_1003822582 125
73 3300005577 Ga0068857_100014523 Ga0068857_1000145235 125
74 3300005578 Ga0068854_100982093 Ga0068854_1009820932 125
75 3300005615 Ga0070702_101007560 Ga0070702_1010075602 125
76 3300005616 Ga0068852_100170673 Ga0068852_1001706732 125
77 3300005617 Ga0068859_100076094 Ga0068859_1000760942 125
78 3300005617 Ga0068859_100514566 Ga0068859_1005145662 125
79 3300005617 Ga0068859_100590054 Ga0068859_1005900542 125
80 3300005617 Ga0068859_100774946 Ga0068859_1007749462 125
81 3300005617 Ga0068859_100820479 Ga0068859_1008204793 125
82 3300005617 Ga0068859_101670103 Ga0068859_1016701032 125
83 3300005617 Ga0068859_102806984 Ga0068859_1028069842 125
84 3300005618 Ga0068864_100632865 Ga0068864_1006328651 125
85 3300005618 Ga0068864_102048744 Ga0068864_1020487441 125
86 3300005719 Ga0068861_100019358 Ga0068861_1000193586 125
87 3300005719 Ga0068861_100126207 Ga0068861_1001262073 125
88 3300005841 Ga0068863_100039165 Ga0068863_1000391652 125
89 3300005841 Ga0068863_100778736 Ga0068863_1007787361 125
90 3300005842 Ga0068858_101002155 Ga0068858_1010021552 125
91 3300005843 Ga0068860_100431557 Ga0068860_1004315572 125
92 3300005844 Ga0068862_100189755 Ga0068862_1001897553 125
93 3300005844 Ga0068862_100865500 Ga0068862_1008655001 125
94 3300006237 Ga0097621_100363638 Ga0097621_1003636381 125
95 3300006237 Ga0097621_101328429 Ga0097621_1013284292 125
96 3300006358 Ga0068871_100567068 Ga0068871_1005670682 125
97 3300006844 Ga0075428_100003257 Ga0075428_10000325716 125
98 3300006844 Ga0075428_100019714 Ga0075428_1000197147 125
99 3300006844 Ga0075428_100068646 Ga0075428_1000686464 125
100 3300006844 Ga0075428_100568495 Ga0075428_1005684952 125
101 3300006846 Ga0075430_100018363 Ga0075430_1000183633 125
102 3300006846 Ga0075430_100199083 Ga0075430_1001990832 125
103 3300006846 Ga0075430_100425018 Ga0075430_1004250182 125
104 3300006847 Ga0075431_100092318 Ga0075431_1000923183 125
105 3300006847 Ga0075431_100118915 Ga0075431_1001189153 125
106 3300006880 Ga0075429_100054367 Ga0075429_1000543674 125
107 3300006880 Ga0075429_101567893 Ga0075429_1015678932 125
108 3300006881 Ga0068865_100303956 Ga0068865_1003039562 125
109 3300006931 Ga0097620_100076089 Ga0097620_1000760892 125
110 3300006931 Ga0097620_100514482 Ga0097620_1005144822 125
111 3300006931 Ga0097620_100590027 Ga0097620_1005900272 125
112 3300006931 Ga0097620_100774986 Ga0097620_1007749862 125
113 3300006931 Ga0097620_100820439 Ga0097620_1008204392 125
114 3300006931 Ga0097620_101670067 Ga0097620_1016700671 125
115 3300006931 Ga0097620_102807037 Ga0097620_1028070372 125
116 3300009011 Ga0105251_10167846 Ga0105251_101678462 125
117 3300009094 Ga0111539_11027871 Ga0111539_110278712 125
118 3300009147 Ga0114129_10270014 Ga0114129_102700143 125
119 3300009147 Ga0114129_11243441 Ga0114129_112434412 125
120 3300009174 Ga0105241_10616681 Ga0105241_106166811 125
121 3300009176 Ga0105242_10598981 Ga0105242_105989812 125
122 3300009176 Ga0105242_11846343 Ga0105242_118463432 125
123 3300009553 Ga0105249_10027907 Ga0105249_100279076 125
124 3300009553 Ga0105249_10247388 Ga0105249_102473882 125
125 3300009553 Ga0105249_10432361 Ga0105249_104323611 125
126 3300009553 Ga0105249_12040307 Ga0105249_120403072 125
127 3300013297 Ga0157378_10731502 Ga0157378_107315021 125
128 3300013306 Ga0163162_10621079 Ga0163162_106210791 125
129 3300013306 Ga0163162_10730753 Ga0163162_107307532 125
130 3300013308 Ga0157375_10751224 Ga0157375_107512241 125
131 3300013308 Ga0157375_10789743 Ga0157375_107897432 125
132 3300013308 Ga0157375_10902366 Ga0157375_109023661 125
133 3300014325 Ga0163163_10396031 Ga0163163_103960312 125
134 3300014325 Ga0163163_10433688 Ga0163163_104336883 125
135 3300014326 Ga0157380_10008681 Ga0157380_100086812 125
136 3300014326 Ga0157380_10189007 Ga0157380_101890071 125
137 3300014326 Ga0157380_10781112 Ga0157380_107811122 125
138 3300014745 Ga0157377_10376927 Ga0157377_103769272 125
139 3300014745 Ga0157377_10716034 Ga0157377_107160342 125
140 3300025271 Ga0207666_1007296 Ga0207666_10072962 125
141 3300025315 Ga0207697_10051902 Ga0207697_100519022 125
142 3300025893 Ga0207682_10015346 Ga0207682_100153462 125
143 3300025893 Ga0207682_10457084 Ga0207682_104570841 125
144 3300025899 Ga0207642_10401491 Ga0207642_104014911 125
145 3300025901 Ga0207688_10282020 Ga0207688_102820202 125
146 3300025905 Ga0207685_10352099 Ga0207685_103520991 125
147 3300025907 Ga0207645_10074490 Ga0207645_100744902 125
148 3300025908 Ga0207643_10041304 Ga0207643_100413042 125
149 3300025908 Ga0207643_10459958 Ga0207643_104599581 125
150 3300025918 Ga0207662_10039442 Ga0207662_100394422 125
151 3300025922 Ga0207646_10228377 Ga0207646_102283772 125
152 3300025923 Ga0207681_10288536 Ga0207681_102885362 125
153 3300025923 Ga0207681_10545827 Ga0207681_105458271 125
154 3300025925 Ga0207650_10032059 Ga0207650_100320594 125
155 3300025934 Ga0207686_10000429 Ga0207686_1000042921 125
156 3300025934 Ga0207686_10446922 Ga0207686_104469222 125
157 3300025936 Ga0207670_10364557 Ga0207670_103645571 125
158 3300025937 Ga0207669_10782733 Ga0207669_107827332 125
159 3300025938 Ga0207704_10115657 Ga0207704_101156572 125
160 3300025940 Ga0207691_10863763 Ga0207691_108637631 125
161 3300025942 Ga0207689_10019898 Ga0207689_100198983 125
162 3300025942 Ga0207689_10341002 Ga0207689_103410022 125
163 3300025945 Ga0207679_10899560 Ga0207679_108995601 125
164 3300025960 Ga0207651_10150943 Ga0207651_101509433 125
165 3300025960 Ga0207651_10152963 Ga0207651_101529632 125
166 3300025961 Ga0207712_10011848 Ga0207712_100118484 125
167 3300025961 Ga0207712_10087178 Ga0207712_100871783 125
168 3300025961 Ga0207712_10551514 Ga0207712_105515142 125
169 3300025961 Ga0207712_10866905 Ga0207712_108669052 125
170 3300026023 Ga0207677_10757576 Ga0207677_107575761 125
171 3300026035 Ga0207703_10199518 Ga0207703_101995182 125
172 3300026035 Ga0207703_12286230 Ga0207703_122862301 125
173 3300026041 Ga0207639_10975943 Ga0207639_109759431 125
174 3300026075 Ga0207708_10218247 Ga0207708_102182471 125
175 3300026088 Ga0207641_10011426 Ga0207641_100114267 125
176 3300026088 Ga0207641_10091145 Ga0207641_100911453 125
177 3300026089 Ga0207648_10094936 Ga0207648_100949361 125
178 3300026089 Ga0207648_10463611 Ga0207648_104636112 125
179 3300026095 Ga0207676_10281340 Ga0207676_102813402 125
180 3300026116 Ga0207674_10527578 Ga0207674_105275782 125
181 3300026118 Ga0207675_100007383 Ga0207675_10000738310 125
182 3300026118 Ga0207675_100398640 Ga0207675_1003986402 125
183 3300026121 Ga0207683_10954669 Ga0207683_109546691 125
184 3300026142 Ga0207698_10042824 Ga0207698_100428242 125
185 3300028380 Ga0268265_10052843 Ga0268265_100528433 125
186 3300028380 Ga0268265_10302748 Ga0268265_103027482 125
187 3300028380 Ga0268265_11264157 Ga0268265_112641572 125
188 3300028380 Ga0268265_12231541 Ga0268265_122315412 125
189 3300028381 Ga0268264_10236965 Ga0268264_102369651 125
190 3300031456 Ga0307513_11063533 Ga0307513_110635332 125
191 3300031548 Ga0307408_100700099 Ga0307408_1007000992 125
192 3300031730 Ga0307516_10368767 Ga0307516_103687672 125
193 3300031995 Ga0307409_102742989 Ga0307409_1027429891 125
194 3300032005 Ga0307411_12138135 Ga0307411_121381351 125
195 3300032126 Ga0307415_101342483 Ga0307415_1013424832 125
196 3300041459 Ga0451800_1534946 Ga0451800_1534946_1263_1649 125
197 3300041463 Ga0451804_0788977 Ga0451804_0788977_486_872 125
198 3300041507 Ga0451851_1010984 Ga0451851_1010984_103_483 125
199 3300041512 Ga0451853_1577816 Ga0451853_1577816_710_1096 125
200 3300041512 Ga0451853_2545082 Ga0451853_2545082_120_500 125
201 3300042001 Ga0439441_084094 Ga0439441_084094_121_501 125
202 3300042125 Ga0450923_162377 Ga0450923_162377_67_447 125
203 3300044712 Ga0453684_2523482 Ga0453684_2523482_103_480 125
204 3300046459 Ga0495629_0960488 Ga0495629_0960488_44_424 125
205 3300046499 Ga0495594_0034689 Ga0495594_0034689_1048_1428 125
206 3300046537 Ga0495598_0032877 Ga0495598_0032877_607_987 125
207 3300046539 Ga0495621_0106672 Ga0495621_0106672_448_828 125
208 3300046615 Ga0495656_0193085 Ga0495656_0193085_580_960 125
209 3300046691 Ga0495670_0379402 Ga0495670_0379402_246_626 125
210 3300047321 Ga0495676_0305635 Ga0495676_0305635_186_566 125
211 3300047471 Ga0495684_0711238 Ga0495684_0711238_194_574 125
212 3300048090 Ga0495615_0059635 Ga0495615_0059635_462_842 125
213 3300049568 Ga0501031_0008041 Ga0501031_0008041_1042_1419 125
214 3300049569 Ga0501032_0201920 Ga0501032_0201920_255_632 125
215 3300049571 Ga0501034_0119357 Ga0501034_0119357_423_800 125
216 3300049572 Ga0501036_0030055 Ga0501036_0030055_1784_2161 125
217 3300049573 Ga0501037_0208357 Ga0501037_0208357_556_933 125
218 3300049574 Ga0501038_0011536 Ga0501038_0011536_2778_3155 125
219 3300049575 Ga0501039_0116502 Ga0501039_0116502_1587_1964 125
220 3300049579 Ga0501043_0008513 Ga0501043_0008513_5234_5611 125
221 3300049580 Ga0501046_0191848 Ga0501046_0191848_1076_1453 125
222 3300049581 Ga0501047_0620885 Ga0501047_0620885_40_417 125
223 3300049588 Ga0501072_0387387 Ga0501072_0387387_706_1083 125
224 3300049705 Ga0501225_0073536 Ga0501225_0073536_258_635 125
225 3300049742 Ga0501080_0104269 Ga0501080_0104269_408_785 125
226 3300049823 Ga0501044_0018314 Ga0501044_0018314_3996_4373 125
227 3300050507 nmdc:mga05p37_242686_c1 nmdc:mga05p37_242686_c1_1144_1521 125
228 3300050508 nmdc:mga09592_10511_c1 nmdc:mga09592_10511_c1_4914_5294 125
229 3300050508 nmdc:mga09592_961456_c1 nmdc:mga09592_961456_c1_238_618 125
230 3300050509 nmdc:mga0qj67_15755_c1 nmdc:mga0qj67_15755_c1_2770_3147 125
231 3300050509 nmdc:mga0qj67_337731_c1 nmdc:mga0qj67_337731_c1_83_463 125
232 3300050510 nmdc:mga06r32_243882_c1 nmdc:mga06r32_243882_c1_177_557 125
233 3300050510 nmdc:mga06r32_38982_c1 nmdc:mga06r32_38982_c1_268_645 125
234 3300050511 nmdc:mga08y16_124164_c1 nmdc:mga08y16_124164_c1_646_1026 125
235 3300001979 JGI24740J21852_10029653 JGI24740J21852_100296532 126
236 3300001991 JGI24743J22301_10079672 JGI24743J22301_100796721 126
237 3300001991 JGI24743J22301_10097633 JGI24743J22301_100976331 126
238 3300003203 JGI25406J46586_10001126 JGI25406J46586_100011261 126
239 3300003316 rootH1_10067506 rootH1_100675062 126
240 3300003322 rootL2_10116707 rootL2_101167071 126
241 3300003322 rootL2_10146122 rootL2_101461222 126
242 3300003323 rootH1_10143165 rootH1_101431655 126
243 3300003354 JGI25160J50197_1002483 JGI25160J50197_10024837 126
244 3300004803 Ga0058862_11132398 Ga0058862_111323981 126
245 3300005327 Ga0070658_10028772 Ga0070658_100287724 126
246 3300005327 Ga0070658_10171993 Ga0070658_101719932 126
247 3300005329 Ga0070683_100005997 Ga0070683_10000599715 126
248 3300005329 Ga0070683_100654742 Ga0070683_1006547421 126
249 3300005330 Ga0070690_100115733 Ga0070690_1001157333 126
250 3300005331 Ga0070670_100085915 Ga0070670_1000859153 126
251 3300005331 Ga0070670_100137214 Ga0070670_1001372142 126
252 3300005331 Ga0070670_100507342 Ga0070670_1005073421 126
253 3300005331 Ga0070670_101784477 Ga0070670_1017844772 126
254 3300005335 Ga0070666_10006755 Ga0070666_100067554 126
255 3300005336 Ga0070680_100028343 Ga0070680_1000283431 126
256 3300005336 Ga0070680_100114416 Ga0070680_1001144163 126
257 3300005337 Ga0070682_100002896 Ga0070682_1000028965 126
258 3300005338 Ga0068868_100007430 Ga0068868_1000074303 126
259 3300005338 Ga0068868_100016254 Ga0068868_1000162541 126
260 3300005338 Ga0068868_100221482 Ga0068868_1002214822 126
261 3300005338 Ga0068868_100244957 Ga0068868_1002449572 126
262 3300005338 Ga0068868_100421982 Ga0068868_1004219822 126
263 3300005339 Ga0070660_100002586 Ga0070660_1000025865 126
264 3300005339 Ga0070660_100165849 Ga0070660_1001658492 126
265 3300005344 Ga0070661_100002631 Ga0070661_10000263115 126
266 3300005344 Ga0070661_100557090 Ga0070661_1005570902 126
267 3300005344 Ga0070661_100578262 Ga0070661_1005782622 126
268 3300005347 Ga0070668_100620860 Ga0070668_1006208602 126
269 3300005353 Ga0070669_100433280 Ga0070669_1004332802 126
270 3300005354 Ga0070675_100221708 Ga0070675_1002217082 126
271 3300005354 Ga0070675_100272287 Ga0070675_1002722873 126
272 3300005355 Ga0070671_100008104 Ga0070671_1000081043 126
273 3300005355 Ga0070671_100060942 Ga0070671_1000609423 126
274 3300005364 Ga0070673_100052455 Ga0070673_1000524552 126
275 3300005364 Ga0070673_100150339 Ga0070673_1001503392 126
276 3300005364 Ga0070673_102219752 Ga0070673_1022197521 126
277 3300005365 Ga0070688_100561878 Ga0070688_1005618782 126
278 3300005366 Ga0070659_100002110 Ga0070659_1000021106 126
279 3300005367 Ga0070667_100002640 Ga0070667_1000026407 126
280 3300005367 Ga0070667_100068354 Ga0070667_1000683541 126
281 3300005367 Ga0070667_100257326 Ga0070667_1002573263 126
282 3300005367 Ga0070667_100431782 Ga0070667_1004317822 126
283 3300005434 Ga0070709_10973324 Ga0070709_109733241 126
284 3300005437 Ga0070710_10444206 Ga0070710_104442061 126
285 3300005439 Ga0070711_101565931 Ga0070711_1015659311 126
286 3300005455 Ga0070663_100804190 Ga0070663_1008041902 126
287 3300005455 Ga0070663_101213739 Ga0070663_1012137391 126
288 3300005455 Ga0070663_101561803 Ga0070663_1015618032 126
289 3300005456 Ga0070678_100018048 Ga0070678_1000180483 126
290 3300005457 Ga0070662_100005618 Ga0070662_1000056186 126
291 3300005457 Ga0070662_100114020 Ga0070662_1001140203 126
292 3300005457 Ga0070662_100305695 Ga0070662_1003056952 126
293 3300005458 Ga0070681_10137758 Ga0070681_101377584 126
294 3300005458 Ga0070681_10448110 Ga0070681_104481101 126
295 3300005459 Ga0068867_100302590 Ga0068867_1003025902 126
296 3300005459 Ga0068867_100333660 Ga0068867_1003336603 126
297 3300005459 Ga0068867_100340013 Ga0068867_1003400131 126
298 3300005466 Ga0070685_10942243 Ga0070685_109422431 126
299 3300005471 Ga0070698_100056165 Ga0070698_1000561655 126
300 3300005530 Ga0070679_100027317 Ga0070679_1000273174 126
301 3300005530 Ga0070679_100085573 Ga0070679_1000855732 126
302 3300005530 Ga0070679_101310501 Ga0070679_1013105011 126
303 3300005530 Ga0070679_102021057 Ga0070679_1020210571 126
304 3300005535 Ga0070684_100001215 Ga0070684_1000012155 126
305 3300005535 Ga0070684_100259073 Ga0070684_1002590732 126
306 3300005535 Ga0070684_100390540 Ga0070684_1003905402 126
307 3300005535 Ga0070684_100577728 Ga0070684_1005777281 126
308 3300005539 Ga0068853_100013898 Ga0068853_1000138985 126
309 3300005539 Ga0068853_100326092 Ga0068853_1003260922 126
310 3300005539 Ga0068853_100339403 Ga0068853_1003394031 126
311 3300005539 Ga0068853_100345483 Ga0068853_1003454833 126
312 3300005539 Ga0068853_100374970 Ga0068853_1003749701 126
313 3300005539 Ga0068853_100780451 Ga0068853_1007804512 126
314 3300005539 Ga0068853_101253964 Ga0068853_1012539642 126
315 3300005543 Ga0070672_100519840 Ga0070672_1005198402 126
316 3300005543 Ga0070672_100896556 Ga0070672_1008965561 126
317 3300005543 Ga0070672_101711054 Ga0070672_1017110541 126
318 3300005544 Ga0070686_100594516 Ga0070686_1005945163 126
319 3300005547 Ga0070693_100431633 Ga0070693_1004316332 126
320 3300005547 Ga0070693_100568503 Ga0070693_1005685032 126
321 3300005548 Ga0070665_100237515 Ga0070665_1002375153 126
322 3300005563 Ga0068855_100023607 Ga0068855_1000236071 126
323 3300005563 Ga0068855_101655718 Ga0068855_1016557182 126
324 3300005564 Ga0070664_100004754 Ga0070664_1000047544 126
325 3300005564 Ga0070664_100948704 Ga0070664_1009487042 126
326 3300005564 Ga0070664_100965497 Ga0070664_1009654971 126
327 3300005577 Ga0068857_100021834 Ga0068857_1000218343 126
328 3300005577 Ga0068857_100090163 Ga0068857_1000901632 126
329 3300005577 Ga0068857_100321883 Ga0068857_1003218832 126
330 3300005578 Ga0068854_100014594 Ga0068854_1000145946 126
331 3300005578 Ga0068854_101628915 Ga0068854_1016289151 126
332 3300005614 Ga0068856_100016680 Ga0068856_1000166801 126
333 3300005614 Ga0068856_100046347 Ga0068856_1000463474 126
334 3300005614 Ga0068856_100775841 Ga0068856_1007758411 126
335 3300005614 Ga0068856_101734754 Ga0068856_1017347542 126
336 3300005616 Ga0068852_100001659 Ga0068852_10000165911 126
337 3300005616 Ga0068852_100014178 Ga0068852_1000141783 126
338 3300005616 Ga0068852_100070866 Ga0068852_1000708663 126
339 3300005616 Ga0068852_100093543 Ga0068852_1000935432 126
340 3300005616 Ga0068852_100134320 Ga0068852_1001343203 126
341 3300005616 Ga0068852_100253146 Ga0068852_1002531463 126
342 3300005616 Ga0068852_100664554 Ga0068852_1006645542 126
343 3300005616 Ga0068852_100818284 Ga0068852_1008182842 126
344 3300005617 Ga0068859_100031009 Ga0068859_1000310092 126
345 3300005617 Ga0068859_100611453 Ga0068859_1006114532 126
346 3300005617 Ga0068859_100818637 Ga0068859_1008186372 126
347 3300005617 Ga0068859_101418885 Ga0068859_1014188851 126
348 3300005618 Ga0068864_100105344 Ga0068864_1001053441 126
349 3300005618 Ga0068864_100270365 Ga0068864_1002703652 126
350 3300005618 Ga0068864_100316414 Ga0068864_1003164143 126
351 3300005718 Ga0068866_10261797 Ga0068866_102617971 126
352 3300005719 Ga0068861_101212787 Ga0068861_1012127872 126
353 3300005834 Ga0068851_10011250 Ga0068851_100112502 126
354 3300005834 Ga0068851_10400198 Ga0068851_104001981 126
355 3300005840 Ga0068870_10186074 Ga0068870_101860743 126
356 3300005841 Ga0068863_100323810 Ga0068863_1003238101 126
357 3300005842 Ga0068858_101244194 Ga0068858_1012441941 126
358 3300005842 Ga0068858_101971556 Ga0068858_1019715561 126
359 3300005843 Ga0068860_100000052 Ga0068860_10000005254 126
360 3300005843 Ga0068860_100001511 Ga0068860_10000151121 126
361 3300005843 Ga0068860_100003681 Ga0068860_1000036815 126
362 3300005844 Ga0068862_101370150 Ga0068862_1013701502 126
363 3300005985 Ga0081539_10000885 Ga0081539_1000088559 126
364 3300006195 Ga0075366_10114174 Ga0075366_101141741 126
365 3300006195 Ga0075366_10693690 Ga0075366_106936902 126
366 3300006237 Ga0097621_100000118 Ga0097621_1000001188 126
367 3300006237 Ga0097621_100014934 Ga0097621_1000149345 126
368 3300006237 Ga0097621_100059277 Ga0097621_1000592772 126
369 3300006237 Ga0097621_100145640 Ga0097621_1001456403 126
370 3300006237 Ga0097621_100405122 Ga0097621_1004051222 126
371 3300006237 Ga0097621_101774726 Ga0097621_1017747262 126
372 3300006358 Ga0068871_100006528 Ga0068871_1000065286 126
373 3300006358 Ga0068871_100019364 Ga0068871_1000193645 126
374 3300006358 Ga0068871_100030647 Ga0068871_1000306473 126
375 3300006358 Ga0068871_100476567 Ga0068871_1004765672 126
376 3300006358 Ga0068871_100975384 Ga0068871_1009753842 126
377 3300006844 Ga0075428_101572528 Ga0075428_1015725282 126
378 3300006881 Ga0068865_100167098 Ga0068865_1001670982 126
379 3300006881 Ga0068865_100442243 Ga0068865_1004422432 126
380 3300006931 Ga0097620_100031009 Ga0097620_1000310092 126
381 3300006931 Ga0097620_100611429 Ga0097620_1006114291 126
382 3300006931 Ga0097620_100818740 Ga0097620_1008187402 126
383 3300006931 Ga0097620_101418714 Ga0097620_1014187141 126
384 3300009093 Ga0105240_10022086 Ga0105240_100220865 126
385 3300009093 Ga0105240_11331757 Ga0105240_113317572 126
386 3300009094 Ga0111539_10419252 Ga0111539_104192521 126
387 3300009094 Ga0111539_12689174 Ga0111539_126891741 126
388 3300009094 Ga0111539_13274333 Ga0111539_132743331 126
389 3300009098 Ga0105245_11022539 Ga0105245_110225391 126
390 3300009174 Ga0105241_10018266 Ga0105241_100182664 126
391 3300009174 Ga0105241_10309763 Ga0105241_103097633 126
392 3300009174 Ga0105241_10428110 Ga0105241_104281102 126
393 3300009174 Ga0105241_11122849 Ga0105241_111228491 126
394 3300009174 Ga0105241_11180567 Ga0105241_111805672 126
395 3300009174 Ga0105241_11419537 Ga0105241_114195371 126
396 3300009174 Ga0105241_11462805 Ga0105241_114628052 126
397 3300009174 Ga0105241_12347541 Ga0105241_123475411 126
398 3300009176 Ga0105242_10134758 Ga0105242_101347583 126
399 3300009176 Ga0105242_11104499 Ga0105242_111044991 126
400 3300009177 Ga0105248_10014430 Ga0105248_100144303 126
401 3300009545 Ga0105237_10016806 Ga0105237_100168062 126
402 3300009545 Ga0105237_10398104 Ga0105237_103981042 126
403 3300009545 Ga0105237_10629792 Ga0105237_106297922 126
404 3300009545 Ga0105237_10884182 Ga0105237_108841821 126
405 3300009545 Ga0105237_12173159 Ga0105237_121731591 126
406 3300009551 Ga0105238_10079918 Ga0105238_100799183 126
407 3300009551 Ga0105238_10102620 Ga0105238_101026202 126
408 3300009551 Ga0105238_11414675 Ga0105238_114146751 126
409 3300009553 Ga0105249_10025456 Ga0105249_100254565 126
410 3300009553 Ga0105249_10087032 Ga0105249_100870323 126
411 3300009553 Ga0105249_10934961 Ga0105249_109349611 126
412 3300010375 Ga0105239_10001888 Ga0105239_1000188815 126
413 3300010375 Ga0105239_10038490 Ga0105239_100384902 126
414 3300010375 Ga0105239_10218000 Ga0105239_102180002 126
415 3300010375 Ga0105239_10717644 Ga0105239_107176442 126
416 3300010375 Ga0105239_10750457 Ga0105239_107504573 126
417 3300010375 Ga0105239_12728323 Ga0105239_127283231 126
418 3300010375 Ga0105239_12838920 Ga0105239_128389201 126
419 3300010375 Ga0105239_13019986 Ga0105239_130199862 126
420 3300011119 Ga0105246_10107348 Ga0105246_101073483 126
421 3300011119 Ga0105246_10825886 Ga0105246_108258862 126
422 3300011119 Ga0105246_10903590 Ga0105246_109035901 126
423 3300011119 Ga0105246_12397709 Ga0105246_123977091 126
424 3300013100 Ga0157373_10003884 Ga0157373_100038848 126
425 3300013100 Ga0157373_10300863 Ga0157373_103008632 126
426 3300013100 Ga0157373_10340442 Ga0157373_103404422 126
427 3300013100 Ga0157373_10992428 Ga0157373_109924282 126
428 3300013102 Ga0157371_10066429 Ga0157371_100664294 126
429 3300013102 Ga0157371_10576598 Ga0157371_105765981 126
430 3300013102 Ga0157371_10847500 Ga0157371_108475002 126
431 3300013104 Ga0157370_10003253 Ga0157370_1000325316 126
432 3300013104 Ga0157370_10149775 Ga0157370_101497753 126
433 3300013104 Ga0157370_10301326 Ga0157370_103013262 126
434 3300013104 Ga0157370_10513005 Ga0157370_105130052 126
435 3300013105 Ga0157369_10004961 Ga0157369_1000496111 126
436 3300013105 Ga0157369_10022438 Ga0157369_100224385 126
437 3300013105 Ga0157369_10282780 Ga0157369_102827802 126
438 3300013105 Ga0157369_10321308 Ga0157369_103213082 126
439 3300013105 Ga0157369_11383196 Ga0157369_113831962 126
440 3300013296 Ga0157374_10005011 Ga0157374_100050118 126
441 3300013296 Ga0157374_10057986 Ga0157374_100579863 126
442 3300013296 Ga0157374_10861294 Ga0157374_108612942 126
443 3300013296 Ga0157374_12049466 Ga0157374_120494662 126
444 3300013297 Ga0157378_10005153 Ga0157378_1000515311 126
445 3300013297 Ga0157378_10011525 Ga0157378_100115253 126
446 3300013297 Ga0157378_10012883 Ga0157378_100128838 126
447 3300013297 Ga0157378_10019286 Ga0157378_100192863 126
448 3300013297 Ga0157378_10120808 Ga0157378_101208082 126
449 3300013297 Ga0157378_10365328 Ga0157378_103653282 126
450 3300013297 Ga0157378_10591958 Ga0157378_105919581 126
451 3300013297 Ga0157378_12012442 Ga0157378_120124421 126
452 3300013306 Ga0163162_10000086 Ga0163162_1000008663 126
453 3300013306 Ga0163162_10000464 Ga0163162_1000046432 126
454 3300013306 Ga0163162_10004156 Ga0163162_100041567 126
455 3300013306 Ga0163162_10013496 Ga0163162_100134968 126
456 3300013306 Ga0163162_10242378 Ga0163162_102423782 126
457 3300013306 Ga0163162_10272042 Ga0163162_102720422 126
458 3300013306 Ga0163162_10968537 Ga0163162_109685371 126
459 3300013307 Ga0157372_10020933 Ga0157372_100209332 126
460 3300013307 Ga0157372_10024792 Ga0157372_100247925 126
461 3300013307 Ga0157372_10033647 Ga0157372_100336471 126
462 3300013307 Ga0157372_10048401 Ga0157372_100484013 126
463 3300013307 Ga0157372_10054590 Ga0157372_100545904 126
464 3300013307 Ga0157372_10054606 Ga0157372_100546063 126
465 3300013307 Ga0157372_10658413 Ga0157372_106584131 126
466 3300013307 Ga0157372_10755660 Ga0157372_107556601 126
467 3300013307 Ga0157372_11569796 Ga0157372_115697961 126
468 3300013307 Ga0157372_13031117 Ga0157372_130311171 126
469 3300013308 Ga0157375_10000115 Ga0157375_1000011515 126
470 3300013308 Ga0157375_10027854 Ga0157375_100278548 126
471 3300013308 Ga0157375_10132456 Ga0157375_101324562 126
472 3300013308 Ga0157375_10281410 Ga0157375_102814103 126
473 3300013308 Ga0157375_10447738 Ga0157375_104477382 126
474 3300013308 Ga0157375_10529799 Ga0157375_105297992 126
475 3300013308 Ga0157375_10561012 Ga0157375_105610122 126
476 3300013308 Ga0157375_10800290 Ga0157375_108002902 126
477 3300014325 Ga0163163_11003109 Ga0163163_110031091 126
478 3300014325 Ga0163163_11007566 Ga0163163_110075662 126
479 3300014325 Ga0163163_12095391 Ga0163163_120953911 126
480 3300014745 Ga0157377_10006202 Ga0157377_100062026 126
481 3300014745 Ga0157377_10098365 Ga0157377_100983653 126
482 3300014968 Ga0157379_10033649 Ga0157379_100336492 126
483 3300014968 Ga0157379_10590918 Ga0157379_105909182 126
484 3300014968 Ga0157379_10784602 Ga0157379_107846021 126
485 3300014969 Ga0157376_10001060 Ga0157376_1000106015 126
486 3300014969 Ga0157376_10243590 Ga0157376_102435902 126
487 3300014969 Ga0157376_10972044 Ga0157376_109720442 126
488 3300014969 Ga0157376_11132678 Ga0157376_111326781 126
489 3300015265 Ga0182005_1198308 Ga0182005_11983081 126
490 3300017792 Ga0163161_10006573 Ga0163161_100065737 126
491 3300017792 Ga0163161_10010591 Ga0163161_100105913 126
492 3300017792 Ga0163161_10065108 Ga0163161_100651082 126
493 3300017792 Ga0163161_11998025 Ga0163161_119980251 126
494 3300021384 Ga0213876_10002683 Ga0213876_100026836 126
495 3300021384 Ga0213876_10042901 Ga0213876_100429012 126
496 3300021384 Ga0213876_10580682 Ga0213876_105806821 126
497 3300025302 Ga0207426_1000170 Ga0207426_100017068 126
498 3300025321 Ga0207656_10037489 Ga0207656_100374893 126
499 3300025321 Ga0207656_10439569 Ga0207656_104395691 126
500 3300025321 Ga0207656_10493150 Ga0207656_104931501 126
501 3300025898 Ga0207692_10098521 Ga0207692_100985212 126
502 3300025899 Ga0207642_10266579 Ga0207642_102665792 126
503 3300025903 Ga0207680_10104366 Ga0207680_101043663 126
504 3300025903 Ga0207680_10696142 Ga0207680_106961422 126
505 3300025903 Ga0207680_10780871 Ga0207680_107808712 126
506 3300025904 Ga0207647_10014937 Ga0207647_100149375 126
507 3300025904 Ga0207647_10179952 Ga0207647_101799522 126
508 3300025904 Ga0207647_10211054 Ga0207647_102110542 126
509 3300025908 Ga0207643_10242777 Ga0207643_102427772 126
510 3300025909 Ga0207705_10098526 Ga0207705_100985263 126
511 3300025909 Ga0207705_10994000 Ga0207705_109940001 126
512 3300025911 Ga0207654_10819695 Ga0207654_108196951 126
513 3300025911 Ga0207654_11019422 Ga0207654_110194221 126
514 3300025912 Ga0207707_10148968 Ga0207707_101489682 126
515 3300025912 Ga0207707_10688136 Ga0207707_106881362 126
516 3300025913 Ga0207695_10791457 Ga0207695_107914571 126
517 3300025914 Ga0207671_10024059 Ga0207671_100240595 126
518 3300025914 Ga0207671_10583542 Ga0207671_105835421 126
519 3300025916 Ga0207663_10682873 Ga0207663_106828731 126
520 3300025917 Ga0207660_10341093 Ga0207660_103410932 126
521 3300025917 Ga0207660_10808190 Ga0207660_108081902 126
522 3300025919 Ga0207657_10010494 Ga0207657_100104945 126
523 3300025919 Ga0207657_10316532 Ga0207657_103165322 126
524 3300025920 Ga0207649_10427298 Ga0207649_104272982 126
525 3300025920 Ga0207649_10624932 Ga0207649_106249322 126
526 3300025920 Ga0207649_10745036 Ga0207649_107450362 126
527 3300025920 Ga0207649_10848645 Ga0207649_108486451 126
528 3300025921 Ga0207652_10131694 Ga0207652_101316942 126
529 3300025921 Ga0207652_10165910 Ga0207652_101659104 126
530 3300025921 Ga0207652_11806204 Ga0207652_118062041 126
531 3300025923 Ga0207681_10696015 Ga0207681_106960151 126
532 3300025923 Ga0207681_11073802 Ga0207681_110738021 126
533 3300025923 Ga0207681_11844561 Ga0207681_118445611 126
534 3300025924 Ga0207694_10320601 Ga0207694_103206012 126
535 3300025925 Ga0207650_10135502 Ga0207650_101355022 126
536 3300025925 Ga0207650_10793840 Ga0207650_107938401 126
537 3300025925 Ga0207650_10884667 Ga0207650_108846672 126
538 3300025926 Ga0207659_10487047 Ga0207659_104870471 126
539 3300025926 Ga0207659_11061442 Ga0207659_110614422 126
540 3300025931 Ga0207644_10013035 Ga0207644_100130353 126
541 3300025931 Ga0207644_10914854 Ga0207644_109148541 126
542 3300025932 Ga0207690_10016741 Ga0207690_100167415 126
543 3300025932 Ga0207690_11453891 Ga0207690_114538911 126
544 3300025933 Ga0207706_10009158 Ga0207706_100091586 126
545 3300025934 Ga0207686_10076175 Ga0207686_100761753 126
546 3300025934 Ga0207686_10868051 Ga0207686_108680512 126
547 3300025937 Ga0207669_10963429 Ga0207669_109634292 126
548 3300025938 Ga0207704_10125735 Ga0207704_101257352 126
549 3300025938 Ga0207704_10517668 Ga0207704_105176681 126
550 3300025938 Ga0207704_11495476 Ga0207704_114954761 126
551 3300025940 Ga0207691_10504339 Ga0207691_105043392 126
552 3300025941 Ga0207711_10070479 Ga0207711_100704792 126
553 3300025944 Ga0207661_10021161 Ga0207661_100211616 126
554 3300025944 Ga0207661_10372998 Ga0207661_103729983 126
555 3300025944 Ga0207661_11911373 Ga0207661_119113731 126
556 3300025945 Ga0207679_10032071 Ga0207679_100320714 126
557 3300025945 Ga0207679_10188840 Ga0207679_101888402 126
558 3300025949 Ga0207667_10001711 Ga0207667_100017118 126
559 3300025949 Ga0207667_10140405 Ga0207667_101404054 126
560 3300025960 Ga0207651_10264589 Ga0207651_102645891 126
561 3300025960 Ga0207651_11159372 Ga0207651_111593722 126
562 3300025961 Ga0207712_10003042 Ga0207712_100030422 126
563 3300025961 Ga0207712_10034955 Ga0207712_100349554 126
564 3300025972 Ga0207668_10274404 Ga0207668_102744042 126
565 3300025981 Ga0207640_10027834 Ga0207640_100278344 126
566 3300025981 Ga0207640_10147515 Ga0207640_101475151 126
567 3300025981 Ga0207640_10231370 Ga0207640_102313702 126
568 3300025986 Ga0207658_10021523 Ga0207658_100215234 126
569 3300025986 Ga0207658_10134482 Ga0207658_101344822 126
570 3300025986 Ga0207658_10444914 Ga0207658_104449142 126
571 3300026023 Ga0207677_10003558 Ga0207677_100035588 126
572 3300026023 Ga0207677_10019166 Ga0207677_100191662 126
573 3300026023 Ga0207677_10352614 Ga0207677_103526142 126
574 3300026023 Ga0207677_10727162 Ga0207677_107271622 126
575 3300026035 Ga0207703_11450971 Ga0207703_114509711 126
576 3300026041 Ga0207639_10051722 Ga0207639_100517224 126
577 3300026041 Ga0207639_10315207 Ga0207639_103152072 126
578 3300026041 Ga0207639_10400178 Ga0207639_104001782 126
579 3300026041 Ga0207639_10653689 Ga0207639_106536892 126
580 3300026041 Ga0207639_11136072 Ga0207639_111360722 126
581 3300026041 Ga0207639_11177477 Ga0207639_111774772 126
582 3300026067 Ga0207678_10358172 Ga0207678_103581722 126
583 3300026067 Ga0207678_10656454 Ga0207678_106564541 126
584 3300026078 Ga0207702_10128680 Ga0207702_101286802 126
585 3300026078 Ga0207702_10737277 Ga0207702_107372772 126
586 3300026088 Ga0207641_10181821 Ga0207641_101818211 126
587 3300026088 Ga0207641_10222608 Ga0207641_102226082 126
588 3300026089 Ga0207648_10146511 Ga0207648_101465112 126
589 3300026089 Ga0207648_10384590 Ga0207648_103845902 126
590 3300026089 Ga0207648_11126018 Ga0207648_111260182 126
591 3300026089 Ga0207648_11213489 Ga0207648_112134892 126
592 3300026095 Ga0207676_10064837 Ga0207676_100648373 126
593 3300026095 Ga0207676_10081633 Ga0207676_100816333 126
594 3300026095 Ga0207676_10355968 Ga0207676_103559681 126
595 3300026095 Ga0207676_12142943 Ga0207676_121429431 126
596 3300026116 Ga0207674_10197620 Ga0207674_101976203 126
597 3300026116 Ga0207674_10242487 Ga0207674_102424872 126
598 3300026116 Ga0207674_10593369 Ga0207674_105933693 126
599 3300026118 Ga0207675_101942683 Ga0207675_1019426832 126
600 3300026121 Ga0207683_10031651 Ga0207683_100316513 126
601 3300026142 Ga0207698_10003137 Ga0207698_100031376 126
602 3300026142 Ga0207698_10036585 Ga0207698_100365853 126
603 3300026142 Ga0207698_10096703 Ga0207698_100967033 126
604 3300026142 Ga0207698_10733129 Ga0207698_107331292 126
605 3300026142 Ga0207698_11607100 Ga0207698_116071002 126
606 3300027907 Ga0207428_10730359 Ga0207428_107303592 126
607 3300027907 Ga0207428_11134351 Ga0207428_111343511 126
608 3300028379 Ga0268266_10000071 Ga0268266_1000007141 126
609 3300028379 Ga0268266_10347496 Ga0268266_103474963 126
610 3300028381 Ga0268264_10001196 Ga0268264_1000119619 126
611 3300028381 Ga0268264_11890866 Ga0268264_118908661 126
612 3300028794 Ga0307515_10000078 Ga0307515_1000007848 126
613 3300028800 Ga0265338_10125422 Ga0265338_101254223 126
614 3300029957 Ga0265324_10115654 Ga0265324_101156542 126
615 3300030521 Ga0307511_10002930 Ga0307511_1000293014 126
616 3300031251 Ga0265327_10025126 Ga0265327_100251262 126
617 3300031344 Ga0265316_10315997 Ga0265316_103159972 126
618 3300031456 Ga0307513_10170590 Ga0307513_101705903 126
619 3300031456 Ga0307513_10319197 Ga0307513_103191971 126
620 3300031507 Ga0307509_10679272 Ga0307509_106792721 126
621 3300031507 Ga0307509_10712124 Ga0307509_107121242 126
622 3300031548 Ga0307408_102490317 Ga0307408_1024903172 126
623 3300031824 Ga0307413_10386864 Ga0307413_103868641 126
624 3300036401 Ga0373937_0454279 Ga0373937_0454279_13_396 126
625 3300037418 Ga0395900_0529223 Ga0395900_0529223_614_994 126
626 3300037418 Ga0395900_1283570 Ga0395900_1283570_99_479 126
627 3300037471 Ga0395905_0422485 Ga0395905_0422485_221_601 126
628 3300037471 Ga0395905_1186790 Ga0395905_1186790_71_451 126
629 3300038443 Ga0395901_0821317 Ga0395901_0821317_157_537 126
630 3300039437 Ga0436365_0014802 Ga0436365_0014802_331_711 126
631 3300039437 Ga0436365_0038916 Ga0436365_0038916_4459_4842 126
632 3300039437 Ga0436365_0852964 Ga0436365_0852964_697_1080 126
633 3300039437 Ga0436365_1788000 Ga0436365_1788000_654_1034 126
634 3300039437 Ga0436365_1814713 Ga0436365_1814713_7510_7890 126
635 3300041406 Ga0439439_0137581 Ga0439439_0137581_137_517 126
636 3300041486 Ga0451807_1622340 Ga0451807_1622340_64_444 126
637 3300041496 Ga0451839_1103437 Ga0451839_1103437_15_395 126
638 3300041512 Ga0451853_1587238 Ga0451853_1587238_146_529 126
639 3300042001 Ga0439441_001071 Ga0439441_001071_390_770 126
640 3300042007 Ga0439449_0001249 Ga0439449_0001249_1681_2061 126
641 3300042014 Ga0439457_005901 Ga0439457_005901_2546_2926 126
642 3300042014 Ga0439457_147102 Ga0439457_147102_100_480 126
643 3300042015 Ga0439462_0076497 Ga0439462_0076497_174_554 126
644 3300042437 Ga0439444_0020005 Ga0439444_0020005_355_735 126
645 3300045976 Ga0466967_0362708 Ga0466967_0362708_713_1093 126
646 3300046524 Ga0495648_0006665 Ga0495648_0006665_2001_2381 126
647 3300046559 Ga0495667_0188037 Ga0495667_0188037_662_1045 126
648 3300046642 Ga0495634_0438545 Ga0495634_0438545_166_549 126
649 3300046663 Ga0495635_0346618 Ga0495635_0346618_146_529 126
650 3300047319 Ga0495674_0207326 Ga0495674_0207326_1218_1601 126
651 3300048903 Ga0496100_0424305 Ga0496100_0424305_132_512 126
652 3300048904 Ga0496101_0322326 Ga0496101_0322326_493_873 126
653 3300048907 Ga0496104_0865350 Ga0496104_0865350_367_747 126
654 3300048909 Ga0496106_1455033 Ga0496106_1455033_69_449 126
655 3300048917 Ga0496114_0006425 Ga0496114_0006425_386_766 126
656 3300048917 Ga0496114_1395005 Ga0496114_1395005_105_485 126
657 3300048923 Ga0496120_0349754 Ga0496120_0349754_217_597 126
658 3300049523 Ga0501300_059896 Ga0501300_059896_19_402 126
659 3300049569 Ga0501032_0070165 Ga0501032_0070165_577_957 126
660 3300049570 Ga0501033_0092551 Ga0501033_0092551_1278_1658 126
661 3300049571 Ga0501034_0008845 Ga0501034_0008845_8062_8445 126
662 3300049571 Ga0501034_0028381 Ga0501034_0028381_4646_5029 126
663 3300049571 Ga0501034_0098974 Ga0501034_0098974_931_1311 126
664 3300049573 Ga0501037_0072787 Ga0501037_0072787_929_1309 126
665 3300049574 Ga0501038_0073780 Ga0501038_0073780_1306_1686 126
666 3300049575 Ga0501039_0057892 Ga0501039_0057892_1637_2017 126
667 3300049579 Ga0501043_0074448 Ga0501043_0074448_1002_1382 126
668 3300049581 Ga0501047_0137884 Ga0501047_0137884_880_1260 126
669 3300049589 Ga0501073_1059625 Ga0501073_1059625_19_399 126
670 3300049703 Ga0501219_000734 Ga0501219_000734_430_810 126
671 3300049705 Ga0501225_0066205 Ga0501225_0066205_160_540 126
672 3300049742 Ga0501080_0186850 Ga0501080_0186850_659_1039 126
673 3300049822 Ga0501035_0208234 Ga0501035_0208234_578_958 126
674 3300049823 Ga0501044_0124634 Ga0501044_0124634_1507_1890 126
675 3300049823 Ga0501044_0192163 Ga0501044_0192163_906_1286 126
676 3300049823 Ga0501044_0270035 Ga0501044_0270035_438_818 126
677 3300050005 Ga0501284_00005 Ga0501284_00005_107648_108028 126
678 3300050493 nmdc:mga0k408_390250_c1 nmdc:mga0k408_390250_c1_261_641 126
679 3300050511 nmdc:mga08y16_1859433_c1 nmdc:mga08y16_1859433_c1_80_460 126
680 3300050511 nmdc:mga08y16_250255_c1 nmdc:mga08y16_250255_c1_702_1085 126
681 3300053088 Ga0500644_0106368 Ga0500644_0106368_421_801 126
682 3300053090 Ga0500646_0026750 Ga0500646_0026750_323_703 126
683 3300053090 Ga0500646_0028265 Ga0500646_0028265_940_1320 126
684 3300053090 Ga0500646_0058421 Ga0500646_0058421_696_1079 126
685 3300053092 Ga0500583_0022499 Ga0500583_0022499_1107_1487 126
686 3300053108 Ga0500562_000035 Ga0500562_000035_11212_11595 126
687 3300053136 Ga0500559_0154224 Ga0500559_0154224_40_423 126
688 3300053156 Ga0500622_0000298 Ga0500622_0000298_47928_48311 126
689 3300053156 Ga0500622_0004063 Ga0500622_0004063_6846_7226 126
690 3300055283 Ga0500661_016655 Ga0500661_016655_333_716 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19569

START_2

START-like superfamily domain

19

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.777 5 121
3cnw-assembly1.cif.gz_A three-dimensional structure of the protein xoxi (q81ay6) from bacillus cereus. northeast structural genomics consortium target bcr196. 0.7698 6 123
3f08-assembly1.cif.gz_A crystal structure of the putative uncharacterized protein q6hg14 from bacilllus thuringiensis. northeast structural genomics consortium target bur153. 0.7673 5 123
5ur6-assembly1.cif.gz_A-2 pyr1 bound to the rationally designed agonist cyanabactin 0.7576 3 122
4n0g-assembly1.cif.gz_C crystal structure of pyl13-pp2ca complex 0.7555 3 122
ID Description Score Start End Superfamily
af_Q2G2S2_126_378_3.90.1690.10 Alpha Beta;Alpha-Beta Complex;phage-related protein like fold;phage-related protein like domain 0.7894 80 102 3.90.1690.10
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.777 5 121 3.30.530.20
af_Q8T2R4_3_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7674 5 122 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7543 7 121 3.30.530.20
af_Q9C7I3_1_151_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7491 4 124 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4Q3RXA8-F1-model_v4 ATPase 0.906 1 126
AF-A0A2E4J8N8-F1-model_v4 START-like domain-containing protein 0.9034 5 126
AF-A0A6I7QZK0-F1-model_v4 ATPase 0.9013 1 126
AF-A0A6I5I4F3-F1-model_v4 SRPBCC domain-containing protein 0.9007 4 125
AF-A0A7Y3KJP8-F1-model_v4 START-like domain-containing protein 0.8996 4 125

Feature Viewer

pLDDT pTM Quality
86.27 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map