F475450

General Info

Members Datasets Scaffolds Average Seq Length
690 312 690 82

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10132468|Ga0213876_101324681
Length 99
Sequence VHVTVRLFARLRELAGAAELRREVADGGTALDVWNGLSRDFPALGDYTTAISVAVNEEYARLAAPVRDGDEVAFLPPVSGGAAAASERSGIQRSPRASV

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
201 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
202 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
203 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
204 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
205 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
210 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
211 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
212 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
284 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0
Rhizoplane 4.49
Rhizosphere 89.28
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10115398 3300005293 Bacteria 2405
2 Ga0065707_10345748 3300005295 Bacteria 926
3 Ga0070676_10183531 3300005328 Bacteria 1362
4 Ga0070683_100132261 3300005329 Bacteria 2361
5 Ga0070690_100498254 3300005330 Bacteria 911
6 Ga0070670_100214536 3300005331 Archaea 1674
7 Ga0070670_100880975 3300005331 Bacteria 811
8 Ga0070677_10112358 3300005333 Bacteria 1218
9 Ga0070677_10386614 3300005333 Unclassified 734
10 Ga0068869_100858111 3300005334 Bacteria 783
11 Ga0068869_101848702 3300005334 Bacteria 541
12 Ga0070666_10503711 3300005335 Bacteria 878
13 Ga0070666_10942516 3300005335 Bacteria 639
14 Ga0070660_100995876 3300005339 Bacteria 708
15 Ga0070689_100034442 3300005340 Bacteria 3864
16 Ga0070689_100405790 3300005340 Bacteria 1153
17 Ga0070689_101384246 3300005340 Unclassified 635
18 Ga0070689_101969776 3300005340 Unclassified 534
19 Ga0070687_101169594 3300005343 Bacteria 566
20 Ga0070687_101500055 3300005343 Unclassified 507
21 Ga0070687_101535969 3300005343 Bacteria 502
22 Ga0070668_102202588 3300005347 Unclassified 509
23 Ga0070675_100106612 3300005354 Bacteria 2366
24 Ga0070675_100467327 3300005354 Bacteria 1133
25 Ga0070674_100786927 3300005356 Unclassified 820
26 Ga0070673_100386007 3300005364 Bacteria 1249
27 Ga0070673_100411074 3300005364 Bacteria 1211
28 Ga0070688_100479774 3300005365 Bacteria 935
29 Ga0070688_100566142 3300005365 Bacteria 866
30 Ga0070659_100286509 3300005366 Bacteria 1371
31 Ga0070667_101015964 3300005367 Unclassified 774
32 Ga0070703_10485987 3300005406 Unclassified 553
33 Ga0070713_100185118 3300005436 Bacteria 1874
34 Ga0070713_100568255 3300005436 Bacteria 1075
35 Ga0070705_100140488 3300005440 Bacteria 1589
36 Ga0070705_100331188 3300005440 Bacteria 1103
37 Ga0070705_101637185 3300005440 Unclassified 542
38 Ga0070700_100781347 3300005441 Bacteria 767
39 Ga0070700_101166394 3300005441 Unclassified 642
40 Ga0070694_100006003 3300005444 Bacteria 7367
41 Ga0070694_101654510 3300005444 Unclassified 544
42 Ga0070708_100007406 3300005445 Bacteria 8781
43 Ga0070663_100023261 3300005455 Bacteria 4151
44 Ga0070678_100366290 3300005456 Bacteria 1243
45 Ga0070678_100962685 3300005456 Unclassified 783
46 Ga0070681_10060434 3300005458 Bacteria 3766
47 Ga0068867_100146582 3300005459 Bacteria 1851
48 Ga0068867_100318868 3300005459 Bacteria 1287
49 Ga0068867_101471985 3300005459 Unclassified 633
50 Ga0070685_10304428 3300005466 Bacteria 1075
51 Ga0070685_10354076 3300005466 Bacteria 1004
52 Ga0070685_11095420 3300005466 Bacteria 602
53 Ga0070685_11289161 3300005466 Unclassified 558
54 Ga0070707_100044568 3300005468 Bacteria 4247
55 Ga0070707_100205433 3300005468 Bacteria 1920
56 Ga0070707_101171118 3300005468 Bacteria 735
57 Ga0070698_100017147 3300005471 Bacteria 7635
58 Ga0070698_100937734 3300005471 Bacteria 812
59 Ga0070698_101257738 3300005471 Bacteria 690
60 Ga0070699_100012833 3300005518 Bacteria 7223
61 Ga0070699_100023354 3300005518 Bacteria 5326
62 Ga0070679_100700874 3300005530 Bacteria 955
63 Ga0070684_101251054 3300005535 Bacteria 698
64 Ga0070697_100067371 3300005536 Bacteria 2928
65 Ga0070697_100243871 3300005536 Bacteria 1535
66 Ga0070672_100574245 3300005543 Unclassified 981
67 Ga0070672_100630168 3300005543 Bacteria 935
68 Ga0070672_101904922 3300005543 Unclassified 535
69 Ga0070686_100416381 3300005544 Bacteria 1025
70 Ga0070695_100228562 3300005545 Bacteria 1344
71 Ga0070696_100018491 3300005546 Bacteria 4710
72 Ga0070696_100059451 3300005546 Bacteria 2671
73 Ga0070665_100380561 3300005548 Bacteria 1419
74 Ga0070665_100612308 3300005548 Bacteria 1102
75 Ga0070665_101562564 3300005548 Unclassified 668
76 Ga0070665_101622290 3300005548 Bacteria 654
77 Ga0070704_100004236 3300005549 Bacteria 8286
78 Ga0070704_100110821 3300005549 Bacteria 2088
79 Ga0070704_102232893 3300005549 Bacteria 509
80 Ga0068855_101124613 3300005563 Bacteria 820
81 Ga0070664_100473636 3300005564 Bacteria 1152
82 Ga0070664_100603901 3300005564 Unclassified 1018
83 Ga0070664_101232474 3300005564 Bacteria 706
84 Ga0068857_100876570 3300005577 Bacteria 860
85 Ga0068854_100154641 3300005578 Bacteria 1771
86 Ga0068854_100268688 3300005578 Bacteria 1368
87 Ga0068854_101915000 3300005578 Unclassified 545
88 Ga0068856_100743086 3300005614 Bacteria 1001
89 Ga0070702_100125864 3300005615 Bacteria 1611
90 Ga0068852_100133733 3300005616 Bacteria 2287
91 Ga0068859_100275861 3300005617 Bacteria 1774
92 Ga0068864_100016021 3300005618 Bacteria 6236
93 Ga0068864_101326415 3300005618 Unclassified 720
94 Ga0068866_10708405 3300005718 Unclassified 691
95 Ga0068861_100532297 3300005719 Bacteria 1067
96 Ga0068861_100648166 3300005719 Bacteria 975
97 Ga0068861_100720400 3300005719 Bacteria 929
98 Ga0068851_10229131 3300005834 Bacteria 1047
99 Ga0068870_10107884 3300005840 Unclassified 1585
100 Ga0068863_100206299 3300005841 Bacteria 1891
101 Ga0068863_100649164 3300005841 Bacteria 1046
102 Ga0068858_100019359 3300005842 Bacteria 6365
103 Ga0068858_100024433 3300005842 Bacteria 5630
104 Ga0068858_100236670 3300005842 Bacteria 1732
105 Ga0068862_100523016 3300005844 Bacteria 1129
106 Ga0068862_100844700 3300005844 Unclassified 897
107 Ga0068862_101861126 3300005844 Unclassified 611
108 Ga0081539_10050084 3300005985 Bacteria 2365
109 Ga0070717_10359416 3300006028 Bacteria 1303
110 Ga0075368_10012191 3300006042 Bacteria 3139
111 Ga0075368_10130153 3300006042 Bacteria 1046
112 Ga0075368_10229476 3300006042 Bacteria 790
113 Ga0075363_100037537 3300006048 Bacteria 2545
114 Ga0075364_10001941 3300006051 Bacteria 11521
115 Ga0075364_10061965 3300006051 Bacteria 2454
116 Ga0075364_10111111 3300006051 Bacteria 1829
117 Ga0075432_10434900 3300006058 Bacteria 573
118 Ga0070716_101270408 3300006173 Bacteria 594
119 Ga0075362_10001991 3300006177 Bacteria 6723
120 Ga0075367_10010746 3300006178 Bacteria 4820
121 Ga0075367_10080211 3300006178 Bacteria 1973
122 Ga0075367_10235060 3300006178 Bacteria 1148
123 Ga0075367_10324959 3300006178 Unclassified 970
124 Ga0075369_10181022 3300006186 Bacteria 970
125 Ga0075369_10259159 3300006186 Bacteria 808
126 Ga0075366_10047206 3300006195 Bacteria 2553
127 Ga0075366_10093145 3300006195 Bacteria 1806
128 Ga0097621_100879523 3300006237 Bacteria 833
129 Ga0068871_100173558 3300006358 Bacteria 1849
130 Ga0068871_101466996 3300006358 Bacteria 644
131 Ga0068871_101671544 3300006358 Bacteria 603
132 Ga0075428_100031002 3300006844 Bacteria 5913
133 Ga0075428_102235573 3300006844 Archaea 564
134 Ga0075431_100098315 3300006847 Bacteria 3022
135 Ga0075433_10076711 3300006852 Unclassified 2943
136 Ga0075433_10801791 3300006852 Bacteria 823
137 Ga0075434_100026639 3300006871 Bacteria 5666
138 Ga0075434_100108884 3300006871 Bacteria 2781
139 Ga0075434_100872466 3300006871 Bacteria 915
140 Ga0075434_101013817 3300006871 Bacteria 844
141 Ga0075429_100006683 3300006880 Bacteria 9999
142 Ga0075429_101298911 3300006880 Bacteria 634
143 Ga0068865_100076034 3300006881 Bacteria 2396
144 Ga0068865_100247638 3300006881 Unclassified 1405
145 Ga0068865_100811075 3300006881 Bacteria 808
146 Ga0068865_101022531 3300006881 Bacteria 724
147 Ga0075436_100271197 3300006914 Bacteria 1212
148 Ga0097620_100275868 3300006931 Bacteria 1774
149 Ga0075435_100028860 3300007076 Bacteria 4353
150 Ga0075435_100848491 3300007076 Bacteria 796
151 Ga0105251_10069657 3300009011 Unclassified 1639
152 Ga0105251_10408681 3300009011 Bacteria 625
153 Ga0111539_10002954 3300009094 Bacteria 22570
154 Ga0111539_10135559 3300009094 Bacteria 2883
155 Ga0111539_10280228 3300009094 Bacteria 1940
156 Ga0111539_10528669 3300009094 Bacteria 1374
157 Ga0111539_10734924 3300009094 Bacteria 1149
158 Ga0105245_10370508 3300009098 Bacteria 1424
159 Ga0105245_10775425 3300009098 Bacteria 996
160 Ga0105245_12018998 3300009098 Unclassified 630
161 Ga0105247_10013971 3300009101 Bacteria 4814
162 Ga0105247_10069428 3300009101 Bacteria 2199
163 Ga0105247_10365430 3300009101 Unclassified 1019
164 Ga0105247_10931958 3300009101 Unclassified 673
165 Ga0105247_11439158 3300009101 Unclassified 559
166 Ga0114129_10008194 3300009147 Bacteria 14896
167 Ga0114129_10023525 3300009147 Bacteria 8732
168 Ga0114129_10027033 3300009147 Bacteria 8124
169 Ga0114129_10031591 3300009147 Bacteria 7484
170 Ga0105243_12009552 3300009148 Bacteria 612
171 Ga0105243_12128827 3300009148 Unclassified 597
172 Ga0105242_10631040 3300009176 Unclassified 1039
173 Ga0105242_12556391 3300009176 Unclassified 559
174 Ga0105248_10018478 3300009177 Bacteria 7705
175 Ga0105248_10245254 3300009177 Bacteria 2017
176 Ga0105248_10383986 3300009177 Bacteria 1581
177 Ga0105248_11075766 3300009177 Unclassified 909
178 Ga0105248_11510760 3300009177 Unclassified 760
179 Ga0105248_11904450 3300009177 Bacteria 675
180 Ga0105248_12249976 3300009177 Bacteria 620
181 Ga0105237_10054639 3300009545 Bacteria 4002
182 Ga0105237_10342864 3300009545 Bacteria 1498
183 Ga0105238_10074364 3300009551 Bacteria 3391
184 Ga0105238_11604062 3300009551 Unclassified 681
185 Ga0105238_11938747 3300009551 Bacteria 622
186 Ga0105249_10239261 3300009553 Bacteria 1794
187 Ga0105249_12595475 3300009553 Bacteria 579
188 Ga0105249_12989869 3300009553 Unclassified 543
189 Ga0105246_10018878 3300011119 Bacteria 4397
190 Ga0157374_11242550 3300013296 Bacteria 766
191 Ga0157378_10253219 3300013297 Bacteria 1686
192 Ga0163162_12330535 3300013306 Unclassified 615
193 Ga0157375_10219574 3300013308 Bacteria 2059
194 Ga0163163_10040143 3300014325 Bacteria 4569
195 Ga0163163_10354864 3300014325 Unclassified 1523
196 Ga0163163_11004280 3300014325 Unclassified 898
197 Ga0163163_11106059 3300014325 Bacteria 855
198 Ga0163163_11444702 3300014325 Unclassified 749
199 Ga0157380_10006444 3300014326 Bacteria 8268
200 Ga0157380_10135603 3300014326 Bacteria 2106
201 Ga0157380_12266901 3300014326 Unclassified 607
202 Ga0157379_10025954 3300014968 Bacteria 5210
203 Ga0157379_10392864 3300014968 Bacteria 1274
204 Ga0157379_12089554 3300014968 Bacteria 561
205 Ga0157376_12891149 3300014969 Unclassified 520
206 Ga0163161_10645174 3300017792 Bacteria 877
207 Ga0213876_10132468 3300021384 Bacteria 1325
208 Ga0207697_10000148 3300025315 Bacteria 34368
209 Ga0207697_10286851 3300025315 Unclassified 730
210 Ga0207697_10508098 3300025315 Bacteria 532
211 Ga0207656_10072298 3300025321 Bacteria 1535
212 Ga0207682_10067940 3300025893 Bacteria 1505
213 Ga0207642_10540639 3300025899 Unclassified 718
214 Ga0207710_10024652 3300025900 Bacteria 2592
215 Ga0207710_10036749 3300025900 Bacteria 2160
216 Ga0207688_10009342 3300025901 Bacteria 5346
217 Ga0207688_10147553 3300025901 Bacteria 1387
218 Ga0207688_10791568 3300025901 Unclassified 601
219 Ga0207680_10181481 3300025903 Unclassified 1423
220 Ga0207680_10422256 3300025903 Bacteria 944
221 Ga0207680_10951180 3300025903 Bacteria 616
222 Ga0207647_10454664 3300025904 Bacteria 717
223 Ga0207645_10000577 3300025907 Bacteria 30396
224 Ga0207645_10033216 3300025907 Bacteria 3317
225 Ga0207645_10077506 3300025907 Bacteria 2130
226 Ga0207645_10415030 3300025907 Bacteria 906
227 Ga0207645_11036199 3300025907 Unclassified 555
228 Ga0207643_10000648 3300025908 Bacteria 21726
229 Ga0207643_10059927 3300025908 Bacteria 2172
230 Ga0207643_10129251 3300025908 Bacteria 1502
231 Ga0207643_10233651 3300025908 Unclassified 1128
232 Ga0207684_10736513 3300025910 Unclassified 836
233 Ga0207707_10037755 3300025912 Bacteria 4220
234 Ga0207707_11437353 3300025912 Bacteria 549
235 Ga0207671_10474490 3300025914 Bacteria 997
236 Ga0207660_10270773 3300025917 Unclassified 1345
237 Ga0207662_10016135 3300025918 Bacteria 4211
238 Ga0207662_10039454 3300025918 Bacteria 2770
239 Ga0207662_10289561 3300025918 Unclassified 1086
240 Ga0207662_10513457 3300025918 Unclassified 826
241 Ga0207662_10679038 3300025918 Unclassified 721
242 Ga0207657_10054067 3300025919 Bacteria 3474
243 Ga0207649_11444977 3300025920 Unclassified 544
244 Ga0207652_11250928 3300025921 Unclassified 644
245 Ga0207646_10039052 3300025922 Bacteria 4272
246 Ga0207646_10277166 3300025922 Bacteria 1515
247 Ga0207646_10565182 3300025922 Bacteria 1022
248 Ga0207646_11845183 3300025922 Bacteria 516
249 Ga0207681_10021283 3300025923 Bacteria 4120
250 Ga0207694_10098919 3300025924 Bacteria 2310
251 Ga0207694_10135800 3300025924 Bacteria 1975
252 Ga0207650_10066421 3300025925 Bacteria 2704
253 Ga0207650_10366080 3300025925 Bacteria 1188
254 Ga0207650_10366660 3300025925 Bacteria 1187
255 Ga0207659_10000969 3300025926 Bacteria 17135
256 Ga0207659_10013177 3300025926 Bacteria 5290
257 Ga0207659_10020573 3300025926 Bacteria 4364
258 Ga0207659_10217004 3300025926 Bacteria 1536
259 Ga0207659_10445192 3300025926 Unclassified 1090
260 Ga0207687_10437261 3300025927 Unclassified 1083
261 Ga0207687_11145869 3300025927 Unclassified 668
262 Ga0207687_11797042 3300025927 Bacteria 525
263 Ga0207700_10147134 3300025928 Bacteria 1943
264 Ga0207644_10143347 3300025931 Bacteria 1842
265 Ga0207644_10594397 3300025931 Unclassified 918
266 Ga0207644_11070422 3300025931 Unclassified 677
267 Ga0207690_10295895 3300025932 Bacteria 1265
268 Ga0207690_10365520 3300025932 Bacteria 1144
269 Ga0207690_11243710 3300025932 Bacteria 622
270 Ga0207706_10009648 3300025933 Bacteria 8860
271 Ga0207706_10525295 3300025933 Unclassified 1020
272 Ga0207686_10335622 3300025934 Bacteria 1134
273 Ga0207686_11337405 3300025934 Unclassified 589
274 Ga0207709_10066821 3300025935 Bacteria 2266
275 Ga0207670_10081470 3300025936 Bacteria 2265
276 Ga0207670_10506912 3300025936 Bacteria 981
277 Ga0207669_10017605 3300025937 Bacteria 3671
278 Ga0207669_10343198 3300025937 Bacteria 1151
279 Ga0207704_10052747 3300025938 Bacteria 2467
280 Ga0207704_10399359 3300025938 Unclassified 1084
281 Ga0207704_10504614 3300025938 Unclassified 975
282 Ga0207704_10730925 3300025938 Bacteria 822
283 Ga0207665_11014783 3300025939 Bacteria 660
284 Ga0207691_10004463 3300025940 Bacteria 13556
285 Ga0207691_10524208 3300025940 Bacteria 1005
286 Ga0207691_10831513 3300025940 Unclassified 775
287 Ga0207711_10033505 3300025941 Bacteria 4346
288 Ga0207711_10629290 3300025941 Bacteria 1001
289 Ga0207711_10687433 3300025941 Bacteria 954
290 Ga0207711_10895376 3300025941 Bacteria 825
291 Ga0207711_10927530 3300025941 Bacteria 809
292 Ga0207689_10931492 3300025942 Bacteria 733
293 Ga0207689_11751753 3300025942 Unclassified 514
294 Ga0207661_10059988 3300025944 Bacteria 3067
295 Ga0207661_11826589 3300025944 Bacteria 553
296 Ga0207661_11861054 3300025944 Unclassified 547
297 Ga0207679_10014873 3300025945 Bacteria 5127
298 Ga0207679_10029985 3300025945 Bacteria 3794
299 Ga0207679_10218972 3300025945 Bacteria 1601
300 Ga0207679_11967363 3300025945 Bacteria 532
301 Ga0207667_11773724 3300025949 Unclassified 582
302 Ga0207651_10276934 3300025960 Bacteria 1384
303 Ga0207651_10393270 3300025960 Unclassified 1177
304 Ga0207712_10023764 3300025961 Bacteria 4050
305 Ga0207712_10265835 3300025961 Bacteria 1393
306 Ga0207668_10051544 3300025972 Bacteria 2843
307 Ga0207640_11035291 3300025981 Unclassified 724
308 Ga0207658_10386074 3300025986 Bacteria 1227
309 Ga0207658_10828339 3300025986 Bacteria 841
310 Ga0207658_11086802 3300025986 Unclassified 730
311 Ga0207677_10148956 3300026023 Bacteria 1803
312 Ga0207677_10945389 3300026023 Bacteria 779
313 Ga0207703_10071228 3300026035 Bacteria 2871
314 Ga0207703_10467702 3300026035 Bacteria 1180
315 Ga0207639_10958450 3300026041 Bacteria 801
316 Ga0207678_10044540 3300026067 Bacteria 3838
317 Ga0207708_10008793 3300026075 Bacteria 7474
318 Ga0207708_10012183 3300026075 Bacteria 6415
319 Ga0207708_10348233 3300026075 Bacteria 1215
320 Ga0207641_10017355 3300026088 Bacteria 5892
321 Ga0207641_10271397 3300026088 Bacteria 1592
322 Ga0207641_10556087 3300026088 Unclassified 1119
323 Ga0207641_10654874 3300026088 Bacteria 1032
324 Ga0207641_10902678 3300026088 Bacteria 877
325 Ga0207641_10911763 3300026088 Unclassified 873
326 Ga0207648_10054986 3300026089 Bacteria 3475
327 Ga0207648_10078893 3300026089 Bacteria 2873
328 Ga0207648_10205123 3300026089 Bacteria 1749
329 Ga0207648_10330619 3300026089 Bacteria 1371
330 Ga0207648_10607562 3300026089 Bacteria 1008
331 Ga0207676_10022493 3300026095 Bacteria 4637
332 Ga0207676_10042789 3300026095 Bacteria 3484
333 Ga0207676_10233286 3300026095 Unclassified 1646
334 Ga0207676_10901037 3300026095 Bacteria 867
335 Ga0207676_11074361 3300026095 Bacteria 795
336 Ga0207674_10083334 3300026116 Bacteria 3197
337 Ga0207674_10417021 3300026116 Bacteria 1297
338 Ga0207674_11078496 3300026116 Bacteria 772
339 Ga0207674_11492021 3300026116 Bacteria 645
340 Ga0207675_100002044 3300026118 Bacteria 20130
341 Ga0207675_100255612 3300026118 Bacteria 1697
342 Ga0207683_10407442 3300026121 Bacteria 1251
343 Ga0207698_10397913 3300026142 Bacteria 1315
344 Ga0207698_10645430 3300026142 Bacteria 1048
345 Ga0209971_1153740 3300027682 Bacteria 568
346 Ga0209813_10027373 3300027866 Bacteria 1655
347 Ga0207428_10007408 3300027907 Bacteria 10004
348 Ga0207428_10454617 3300027907 Unclassified 933
349 Ga0268266_10128322 3300028379 Bacteria 2266
350 Ga0268266_10266432 3300028379 Bacteria 1589
351 Ga0268266_10787131 3300028379 Bacteria 918
352 Ga0268266_11294709 3300028379 Bacteria 704
353 Ga0268265_10097703 3300028380 Bacteria 2363
354 Ga0268265_10234864 3300028380 Bacteria 1614
355 Ga0268265_10334847 3300028380 Bacteria 1376
356 Ga0268265_10437572 3300028380 Bacteria 1218
357 Ga0268265_10487426 3300028380 Bacteria 1159
358 Ga0268265_11682582 3300028380 Bacteria 640
359 Ga0268264_10467874 3300028381 Bacteria 1224
360 Ga0268264_10490633 3300028381 Bacteria 1196
361 Ga0268264_10886228 3300028381 Bacteria 895
362 Ga0268264_11186894 3300028381 Bacteria 772
363 Ga0268264_11772098 3300028381 Unclassified 628
364 Ga0268264_12659005 3300028381 Unclassified 505
365 Ga0307405_10040508 3300031731 Bacteria 2822
366 Ga0307405_10328688 3300031731 Bacteria 1171
367 Ga0307413_10312993 3300031824 Bacteria 1196
368 Ga0307413_10374377 3300031824 Bacteria 1107
369 Ga0307413_12123355 3300031824 Unclassified 508
370 Ga0307406_10704735 3300031901 Bacteria 843
371 Ga0307407_10014361 3300031903 Bacteria 3876
372 Ga0307407_10782095 3300031903 Bacteria 725
373 Ga0307407_11105397 3300031903 Unclassified 616
374 Ga0307412_10293359 3300031911 Bacteria 1282
375 Ga0307412_11154482 3300031911 Bacteria 692
376 Ga0307409_100283138 3300031995 Bacteria 1533
377 Ga0307409_101163208 3300031995 Bacteria 794
378 Ga0307416_100023618 3300032002 Bacteria 4466
379 Ga0307416_100764604 3300032002 Bacteria 1060
380 Ga0307416_100938285 3300032002 Bacteria 967
381 Ga0307416_102965719 3300032002 Unclassified 568
382 Ga0307416_103503215 3300032002 Unclassified 525
383 Ga0307414_10071933 3300032004 Bacteria 2497
384 Ga0307414_10552870 3300032004 Bacteria 1026
385 Ga0307414_11408706 3300032004 Bacteria 648
386 Ga0307411_10048909 3300032005 Bacteria 2744
387 Ga0373948_0077899 3300034817 Bacteria 753
388 Ga0373958_0012965 3300034819 Bacteria 1435
389 Ga0373929_0169242 3300035085 Bacteria 596
390 Ga0373934_0084503 3300035086 Bacteria 1277
391 Ga0373940_0296758 3300035088 Bacteria 555
392 Ga0373949_0085729 3300035090 Bacteria 845
393 Ga0373952_0082384 3300035092 Bacteria 823
394 Ga0373932_0034344 3300035112 Bacteria 1428
395 Ga0373939_0037499 3300035114 Bacteria 1440
396 Ga0373953_0089015 3300035117 Bacteria 1290
397 Ga0373960_0281323 3300035121 Bacteria 613
398 Ga0373960_0323829 3300035121 Bacteria 578
399 Ga0373943_0953318 3300035170 Unclassified 514
400 Ga0373955_0357664 3300035172 Unclassified 885
401 Ga0373955_0569201 3300035172 Unclassified 693
402 Ga0373942_0382880 3300035207 Bacteria 502
403 Ga0373962_0120075 3300035242 Bacteria 837
404 Ga0373924_0056817 3300035410 Bacteria 1631
405 Ga0373931_0938970 3300035691 Bacteria 583
406 Ga0373935_1141165 3300035692 Unclassified 580
407 Ga0373933_0418401 3300035724 Bacteria 875
408 Ga0373947_0195020 3300035725 Unclassified 1323
409 Ga0373937_0009015 3300036401 Bacteria 8660
410 Ga0373937_0138875 3300036401 Bacteria 2273
411 Ga0373937_0387114 3300036401 Bacteria 1326
412 Ga0373925_1597290 3300037068 Unclassified 533
413 Ga0395900_0200613 3300037418 Bacteria 2019
414 Ga0395901_0944907 3300038443 Bacteria 841
415 Ga0436365_1525786 3300039437 Bacteria 1296
416 Ga0436365_1546745 3300039437 Unclassified 624
417 Ga0439439_0148137 3300041406 Bacteria 665
418 Ga0439439_0276356 3300041406 Bacteria 502
419 Ga0439453_0042870 3300041408 Bacteria 893
420 Ga0439461_0183755 3300041410 Bacteria 555
421 Ga0451787_475156 3300041441 Bacteria 627
422 Ga0451798_0729637 3300041458 Bacteria 754
423 Ga0451849_0714227 3300041505 Bacteria 552
424 Ga0451853_0161368 3300041512 Bacteria 650
425 Ga0451853_0346861 3300041512 Unclassified 746
426 Ga0451853_0530934 3300041512 Bacteria 528
427 Ga0439431_0012921 3300041997 Bacteria 1923
428 Ga0439433_0019429 3300041999 Bacteria 1514
429 Ga0439433_0048069 3300041999 Bacteria 1002
430 Ga0439449_0021085 3300042007 Bacteria 2439
431 Ga0439457_051057 3300042014 Bacteria 929
432 Ga0450888_026221 3300042126 Bacteria 764
433 Ga0450898_088715 3300042134 Bacteria 636
434 Ga0450898_137686 3300042134 Unclassified 529
435 Ga0439446_0012405 3300042156 Bacteria 2327
436 Ga0439446_0275066 3300042156 Unclassified 586
437 Ga0439435_0074908 3300042436 Bacteria 1007
438 Ga0439464_0058306 3300042439 Bacteria 1127
439 Ga0439460_0027246 3300042461 Bacteria 1604
440 Ga0450916_094375 3300042530 Bacteria 524
441 Ga0451577_1017653 3300042876 Bacteria 744
442 Ga0466972_0526516 3300044658 Bacteria 557
443 Ga0453683_0325763 3300044673 Bacteria 985
444 Ga0451576_0245552 3300045051 Bacteria 1871
445 Ga0451576_0527542 3300045051 Bacteria 1240
446 Ga0451576_1570429 3300045051 Unclassified 683
447 Ga0495592_0036800 3300046454 Bacteria 3685
448 Ga0495629_0087337 3300046459 Bacteria 2176
449 Ga0495580_0021601 3300046472 Bacteria 4746
450 Ga0495582_0814597 3300046473 Bacteria 540
451 Ga0495594_0347838 3300046499 Bacteria 844
452 Ga0495608_0621883 3300046511 Bacteria 647
453 Ga0495628_0082641 3300046516 Bacteria 2495
454 Ga0495630_0396827 3300046517 Bacteria 1057
455 Ga0495652_0358876 3300046529 Bacteria 1042
456 Ga0495598_0051538 3300046537 Bacteria 1241
457 Ga0495645_0208714 3300046543 Bacteria 1320
458 Ga0495667_0298389 3300046559 Bacteria 1021
459 Ga0495659_0010010 3300046664 Bacteria 3035
460 Ga0495659_0012078 3300046664 Bacteria 2791
461 Ga0495588_0597731 3300046674 Unclassified 578
462 Ga0495657_0237651 3300046675 Unclassified 1100
463 Ga0495599_0016096 3300046678 Bacteria 4641
464 Ga0495623_0080316 3300046679 Bacteria 2019
465 Ga0495623_0399474 3300046679 Bacteria 740
466 Ga0495647_0008034 3300046681 Bacteria 3545
467 Ga0495658_0203869 3300046683 Bacteria 1234
468 Ga0495636_0619271 3300047318 Unclassified 530
469 Ga0495684_0053071 3300047471 Bacteria 3093
470 Ga0495684_0423050 3300047471 Bacteria 931
471 Ga0495602_0193269 3300048088 Unclassified 1558
472 Ga0495614_0425816 3300048089 Unclassified 626
473 Ga0496102_0283069 3300048905 Unclassified 1563
474 Ga0496104_0071451 3300048907 Bacteria 3300
475 Ga0496104_0090082 3300048907 Bacteria 2931
476 Ga0496105_0321925 3300048908 Bacteria 1239
477 Ga0496105_1105393 3300048908 Unclassified 588
478 Ga0496106_0313017 3300048909 Bacteria 1260
479 Ga0496106_1047169 3300048909 Bacteria 641
480 Ga0496107_0756616 3300048910 Unclassified 713
481 Ga0496108_0012146 3300048911 Bacteria 7003
482 Ga0496108_0126536 3300048911 Bacteria 2194
483 Ga0496108_0156640 3300048911 Bacteria 1967
484 Ga0496108_1424181 3300048911 Bacteria 579
485 Ga0496109_0228518 3300048912 Bacteria 1750
486 Ga0496109_0412776 3300048912 Bacteria 1276
487 Ga0496109_0912318 3300048912 Bacteria 816
488 Ga0496110_0065394 3300048913 Bacteria 3215
489 Ga0496110_0126111 3300048913 Bacteria 2310
490 Ga0496110_0213981 3300048913 Bacteria 1752
491 Ga0496112_0123167 3300048915 Bacteria 2563
492 Ga0496112_0173703 3300048915 Bacteria 2120
493 Ga0496113_0014422 3300048916 Bacteria 5391
494 Ga0496113_0583909 3300048916 Bacteria 895
495 Ga0496113_0688483 3300048916 Bacteria 816
496 Ga0496113_1468114 3300048916 Bacteria 527
497 Ga0496114_0287977 3300048917 Bacteria 1449
498 Ga0496114_0348063 3300048917 Bacteria 1310
499 Ga0496114_0713048 3300048917 Unclassified 879
500 Ga0496114_1107393 3300048917 Unclassified 677
501 Ga0496115_0561557 3300048918 Bacteria 911
502 Ga0501031_0010734 3300049568 Bacteria 5967
503 Ga0501031_0101150 3300049568 Bacteria 1881
504 Ga0501031_1068027 3300049568 Unclassified 515
505 Ga0501032_0006127 3300049569 Bacteria 8858
506 Ga0501032_0046755 3300049569 Bacteria 2924
507 Ga0501032_0127552 3300049569 Unclassified 1680
508 Ga0501033_0075147 3300049570 Bacteria 2480
509 Ga0501033_0090264 3300049570 Bacteria 2241
510 Ga0501034_0004095 3300049571 Bacteria 16360
511 Ga0501034_0053918 3300049571 Bacteria 4048
512 Ga0501034_0073863 3300049571 Bacteria 3418
513 Ga0501034_0240966 3300049571 Bacteria 1754
514 Ga0501036_0001297 3300049572 Bacteria 19150
515 Ga0501036_0021599 3300049572 Bacteria 5411
516 Ga0501036_0021831 3300049572 Bacteria 5383
517 Ga0501036_0025319 3300049572 Bacteria 5006
518 Ga0501036_1362232 3300049572 Bacteria 576
519 Ga0501037_0006772 3300049573 Bacteria 8375
520 Ga0501037_0120019 3300049573 Bacteria 1891
521 Ga0501038_0002744 3300049574 Bacteria 16406
522 Ga0501038_0007347 3300049574 Bacteria 10165
523 Ga0501038_0013119 3300049574 Bacteria 7557
524 Ga0501038_0394075 3300049574 Bacteria 1072
525 Ga0501038_0440230 3300049574 Bacteria 1003
526 Ga0501039_0009837 3300049575 Bacteria 7289
527 Ga0501039_0023300 3300049575 Bacteria 4753
528 Ga0501039_0031316 3300049575 Bacteria 4100
529 Ga0501039_0037521 3300049575 Bacteria 3740
530 Ga0501039_0089225 3300049575 Bacteria 2403
531 Ga0501039_0836030 3300049575 Bacteria 718
532 Ga0501040_0143342 3300049576 Bacteria 1683
533 Ga0501040_0361474 3300049576 Bacteria 1040
534 Ga0501041_0007208 3300049577 Bacteria 6526
535 Ga0501041_0143166 3300049577 Bacteria 1491
536 Ga0501041_0936965 3300049577 Bacteria 557
537 Ga0501042_0000551 3300049578 Bacteria 19742
538 Ga0501042_0007620 3300049578 Bacteria 7103
539 Ga0501042_0110386 3300049578 Bacteria 1981
540 Ga0501042_0409899 3300049578 Bacteria 982
541 Ga0501042_0574807 3300049578 Bacteria 819
542 Ga0501043_0004734 3300049579 Bacteria 11037
543 Ga0501043_0007098 3300049579 Bacteria 8914
544 Ga0501043_0015625 3300049579 Bacteria 5952
545 Ga0501043_0017348 3300049579 Bacteria 5646
546 Ga0501046_0003264 3300049580 Bacteria 14889
547 Ga0501046_0006325 3300049580 Bacteria 10496
548 Ga0501046_0009274 3300049580 Bacteria 8519
549 Ga0501047_0001697 3300049581 Bacteria 21408
550 Ga0501047_0062272 3300049581 Bacteria 3598
551 Ga0501047_0173064 3300049581 Bacteria 2028
552 Ga0501047_0194194 3300049581 Bacteria 1892
553 Ga0501047_0407709 3300049581 Unclassified 1192
554 Ga0501047_0620094 3300049581 Unclassified 902
555 Ga0501048_0002137 3300049582 Bacteria 15063
556 Ga0501048_0009187 3300049582 Bacteria 7430
557 Ga0501048_0013999 3300049582 Bacteria 5947
558 Ga0501048_0041817 3300049582 Bacteria 3283
559 Ga0501048_1144200 3300049582 Archaea 560
560 Ga0501067_0008841 3300049583 Bacteria 5580
561 Ga0501067_0075797 3300049583 Bacteria 1863
562 Ga0501068_0002325 3300049584 Bacteria 10131
563 Ga0501068_0014050 3300049584 Bacteria 4570
564 Ga0501068_0016131 3300049584 Bacteria 4302
565 Ga0501068_0693967 3300049584 Bacteria 666
566 Ga0501068_1089672 3300049584 Bacteria 528
567 Ga0501069_0001824 3300049585 Bacteria 10622
568 Ga0501069_0122538 3300049585 Bacteria 1485
569 Ga0501069_0522413 3300049585 Unclassified 709
570 Ga0501069_0839417 3300049585 Bacteria 558
571 Ga0501070_0008436 3300049586 Bacteria 8702
572 Ga0501070_0145492 3300049586 Bacteria 1956
573 Ga0501070_0815349 3300049586 Unclassified 732
574 Ga0501071_0004390 3300049587 Bacteria 8947
575 Ga0501071_0037994 3300049587 Bacteria 3439
576 Ga0501071_0077378 3300049587 Bacteria 2430
577 Ga0501072_0034947 3300049588 Bacteria 3939
578 Ga0501072_0122922 3300049588 Bacteria 2068
579 Ga0501072_0435929 3300049588 Bacteria 1038
580 Ga0501072_0740290 3300049588 Unclassified 772
581 Ga0501073_0000980 3300049589 Bacteria 20567
582 Ga0501073_0003336 3300049589 Bacteria 12066
583 Ga0501073_0064008 3300049589 Bacteria 2564
584 Ga0501073_0367563 3300049589 Unclassified 994
585 Ga0501074_0032568 3300049590 Bacteria 3775
586 Ga0501074_0057417 3300049590 Bacteria 2804
587 Ga0501074_0333303 3300049590 Bacteria 1077
588 Ga0501075_0000631 3300049591 Bacteria 21544
589 Ga0501075_0040428 3300049591 Bacteria 3492
590 Ga0501075_0187463 3300049591 Bacteria 1578
591 Ga0501075_0573496 3300049591 Bacteria 861
592 Ga0501075_1185766 3300049591 Bacteria 579
593 Ga0501076_0049061 3300049592 Bacteria 3337
594 Ga0501076_0077285 3300049592 Bacteria 2671
595 Ga0501076_0197595 3300049592 Bacteria 1642
596 Ga0501076_1752817 3300049592 Bacteria 509
597 Ga0501077_0120813 3300049593 Bacteria 1660
598 Ga0501202_109058 3300049652 Bacteria 683
599 Ga0501211_033779 3300049658 Bacteria 587
600 Ga0501079_0000894 3300049741 Bacteria 20415
601 Ga0501079_0032000 3300049741 Bacteria 4042
602 Ga0501079_0570131 3300049741 Bacteria 890
603 Ga0501080_0000066 3300049742 Bacteria 68980
604 Ga0501080_0017477 3300049742 Bacteria 6633
605 Ga0501080_0130279 3300049742 Bacteria 2328
606 Ga0501080_0237718 3300049742 Bacteria 1663
607 Ga0501080_0272207 3300049742 Bacteria 1541
608 Ga0501080_0456202 3300049742 Bacteria 1145
609 Ga0501080_1686522 3300049742 Unclassified 535
610 Ga0501080_1746188 3300049742 Bacteria 524
611 Ga0501081_0006698 3300049743 Bacteria 7488
612 Ga0501081_0170823 3300049743 Bacteria 1570
613 Ga0501081_0394786 3300049743 Bacteria 1024
614 Ga0501083_0016724 3300049744 Bacteria 5125
615 Ga0501083_0035172 3300049744 Bacteria 3423
616 Ga0501083_0231638 3300049744 Bacteria 1203
617 Ga0501083_0276586 3300049744 Bacteria 1092
618 Ga0501083_0340084 3300049744 Bacteria 976
619 Ga0501035_0015652 3300049822 Bacteria 7000
620 Ga0501035_0095354 3300049822 Bacteria 2615
621 Ga0501035_0099008 3300049822 Bacteria 2560
622 Ga0501035_0155267 3300049822 Bacteria 1984
623 Ga0501035_1285766 3300049822 Bacteria 564
624 Ga0501044_0003120 3300049823 Bacteria 18780
625 Ga0501044_0149288 3300049823 Bacteria 2320
626 Ga0501045_0005627 3300049824 Bacteria 8676
627 Ga0501045_0018769 3300049824 Bacteria 4923
628 Ga0501045_0068448 3300049824 Bacteria 2608
629 Ga0501045_0504729 3300049824 Bacteria 898
630 nmdc:mga03683_3512_c1 3300050489 Bacteria 5074
631 nmdc:mga03n38_37389_c1 3300050490 Bacteria 2093
632 nmdc:mga03n38_381621_c1 3300050490 Unclassified 772
633 nmdc:mga00v17_1057941_c1 3300050491 Unclassified 509
634 nmdc:mga00v17_22107_c1 3300050491 Bacteria 3666
635 nmdc:mga00v17_25358_c1 3300050491 Bacteria 3446
636 nmdc:mga00v17_258373_c1 3300050491 Bacteria 1130
637 nmdc:mga0yw44_1130346_c1 3300050492 Bacteria 529
638 nmdc:mga0k408_57475_c1 3300050493 Bacteria 2258
639 nmdc:mga0k408_62603_c1 3300050493 Bacteria 2164
640 nmdc:mga06z11_11344_c1 3300050494 Bacteria 3840
641 nmdc:mga06z11_12831_c1 3300050494 Bacteria 3656
642 nmdc:mga06z11_504650_c1 3300050494 Bacteria 733
643 nmdc:mga06z11_525214_c1 3300050494 Unclassified 718
644 nmdc:mga04h51_12269_c1 3300050495 Bacteria 2401
645 nmdc:mga04h51_58576_c1 3300050495 Bacteria 1314
646 nmdc:mga05p37_28413_c1 3300050507 Bacteria 6820
647 nmdc:mga05p37_46442_c1 3300050507 Bacteria 5340
648 nmdc:mga05p37_866386_c1 3300050507 Bacteria 979
649 nmdc:mga05p37_94207_c1 3300050507 Bacteria 3690
650 nmdc:mga09592_21965_c1 3300050508 Bacteria 5264
651 nmdc:mga09592_33805_c1 3300050508 Bacteria 4271
652 nmdc:mga0qj67_1159618_c1 3300050509 Bacteria 602
653 nmdc:mga0qj67_127923_c1 3300050509 Bacteria 2056
654 nmdc:mga0qj67_798897_c1 3300050509 Bacteria 747
655 nmdc:mga06r32_11939_c1 3300050510 Bacteria 7828
656 nmdc:mga06r32_182296_c1 3300050510 Bacteria 2085
657 nmdc:mga06r32_522658_c1 3300050510 Bacteria 1162
658 nmdc:mga08y16_118896_c1 3300050511 Bacteria 2751
659 nmdc:mga08y16_2554_c1 3300050511 Bacteria 18718
660 nmdc:mga08y16_62014_c1 3300050511 Bacteria 3904
661 nmdc:mga08y16_751310_c1 3300050511 Unclassified 971
662 nmdc:mga08y16_758913_c1 3300050511 Unclassified 966
663 nmdc:mga08y16_878093_c1 3300050511 Bacteria 884
664 nmdc:mga0n895_1112729_c1 3300050512 Bacteria 767
665 nmdc:mga0n895_187087_c1 3300050512 Bacteria 2102
666 nmdc:mga0n895_295497_c1 3300050512 Bacteria 1642
667 nmdc:mga0n895_95358_c1 3300050512 Bacteria 2980
668 nmdc:mga0rr50_130182_c1 3300050513 Unclassified 2014
669 nmdc:mga0rr50_225036_c1 3300050513 Bacteria 1550
670 nmdc:mga0rr50_423103_c1 3300050513 Bacteria 1127
671 nmdc:mga0a205_14932_c1 3300050515 Bacteria 7247
672 nmdc:mga0a205_32867_c1 3300050515 Bacteria 4975
673 nmdc:mga0a205_519314_c1 3300050515 Bacteria 1047
674 nmdc:mga0sz30_456401_c1 3300050516 Unclassified 574
675 nmdc:mga0sz30_61594_c1 3300050516 Bacteria 1603
676 Ga0500568_0005285 3300053139 Bacteria 6709
677 Ga0501084_0013018 3300054114 Bacteria 6883
678 Ga0501084_0115989 3300054114 Bacteria 2251
679 Ga0501084_0478743 3300054114 Unclassified 1052
680 Ga0501084_0614204 3300054114 Bacteria 918
681 Ga0501084_1269550 3300054114 Bacteria 617
682 Ga0590077_158612 3300059426 Unclassified 543
683 Ga0501082_0002081 3300060353 Bacteria 17626
684 Ga0501082_0004370 3300060353 Bacteria 12353
685 Ga0501082_0004569 3300060353 Bacteria 12085
686 Ga0501082_0254868 3300060353 Bacteria 1526
687 Ga0501082_0345443 3300060353 Bacteria 1297
688 Ga0501082_0740998 3300060353 Unclassified 860
689 Ga0501082_0853626 3300060353 Bacteria 796
690 Ga0530510_0000823 3300061734 Bacteria 20345

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046681 Ga0495647_0008034 Ga0495647_0008034_3144_3368 74
2 3300005340 Ga0070689_101384246 Ga0070689_1013842462 76
3 3300005459 Ga0068867_101471985 Ga0068867_1014719851 76
4 3300005578 Ga0068854_100154641 Ga0068854_1001546412 76
5 3300005718 Ga0068866_10708405 Ga0068866_107084052 76
6 3300006881 Ga0068865_100247638 Ga0068865_1002476383 76
7 3300009176 Ga0105242_12556391 Ga0105242_125563912 76
8 3300014325 Ga0163163_10354864 Ga0163163_103548643 76
9 3300025899 Ga0207642_10540639 Ga0207642_105406392 76
10 3300025938 Ga0207704_10504614 Ga0207704_105046142 76
11 3300025981 Ga0207640_11035291 Ga0207640_110352911 76
12 3300026088 Ga0207641_10911763 Ga0207641_109117632 76
13 3300026089 Ga0207648_10330619 Ga0207648_103306192 76
14 3300005340 Ga0070689_101969776 Ga0070689_1019697762 79
15 3300005343 Ga0070687_101169594 Ga0070687_1011695942 79
16 3300005466 Ga0070685_11289161 Ga0070685_112891611 79
17 3300005545 Ga0070695_100228562 Ga0070695_1002285622 79
18 3300005578 Ga0068854_101915000 Ga0068854_1019150002 79
19 3300005615 Ga0070702_100125864 Ga0070702_1001258642 79
20 3300006042 Ga0075368_10229476 Ga0075368_102294762 79
21 3300005577 Ga0068857_100876570 Ga0068857_1008765702 80
22 3300009545 Ga0105237_10054639 Ga0105237_100546393 80
23 3300014325 Ga0163163_11004280 Ga0163163_110042803 80
24 3300026075 Ga0207708_10348233 Ga0207708_103482332 80
25 3300026089 Ga0207648_10607562 Ga0207648_106075622 80
26 3300026116 Ga0207674_11078496 Ga0207674_110784962 80
27 3300044658 Ga0466972_0526516 Ga0466972_0526516_198_443 80
28 3300048916 Ga0496113_1468114 Ga0496113_1468114_188_439 80
29 3300049569 Ga0501032_0127552 Ga0501032_0127552_1079_1321 80
30 3300049570 Ga0501033_0075147 Ga0501033_0075147_247_489 80
31 3300049572 Ga0501036_0021599 Ga0501036_0021599_2849_3091 80
32 3300049574 Ga0501038_0007347 Ga0501038_0007347_6437_6679 80
33 3300049575 Ga0501039_0031316 Ga0501039_0031316_1331_1573 80
34 3300049576 Ga0501040_0143342 Ga0501040_0143342_647_889 80
35 3300049577 Ga0501041_0007208 Ga0501041_0007208_637_879 80
36 3300049578 Ga0501042_0000551 Ga0501042_0000551_11929_12171 80
37 3300049579 Ga0501043_0015625 Ga0501043_0015625_3722_3964 80
38 3300049580 Ga0501046_0009274 Ga0501046_0009274_6499_6741 80
39 3300049582 Ga0501048_0013999 Ga0501048_0013999_2376_2618 80
40 3300049584 Ga0501068_0014050 Ga0501068_0014050_3828_4070 80
41 3300049587 Ga0501071_0004390 Ga0501071_0004390_3601_3843 80
42 3300049588 Ga0501072_0034947 Ga0501072_0034947_1307_1549 80
43 3300049589 Ga0501073_0367563 Ga0501073_0367563_327_569 80
44 3300049590 Ga0501074_0057417 Ga0501074_0057417_1585_1827 80
45 3300049591 Ga0501075_0000631 Ga0501075_0000631_17498_17740 80
46 3300049592 Ga0501076_0049061 Ga0501076_0049061_2174_2416 80
47 3300049593 Ga0501077_0120813 Ga0501077_0120813_462_704 80
48 3300049741 Ga0501079_0032000 Ga0501079_0032000_1627_1869 80
49 3300049742 Ga0501080_0017477 Ga0501080_0017477_5210_5452 80
50 3300049742 Ga0501080_1746188 Ga0501080_1746188_214_456 80
51 3300049743 Ga0501081_0006698 Ga0501081_0006698_3763_4005 80
52 3300049744 Ga0501083_0276586 Ga0501083_0276586_126_368 80
53 3300049822 Ga0501035_0155267 Ga0501035_0155267_71_313 80
54 3300049824 Ga0501045_0005627 Ga0501045_0005627_4650_4892 80
55 3300054114 Ga0501084_0013018 Ga0501084_0013018_4057_4299 80
56 3300060353 Ga0501082_0004569 Ga0501082_0004569_3792_4034 80
57 3300060353 Ga0501082_0853626 Ga0501082_0853626_504_746 80
58 3300061734 Ga0530510_0000823 Ga0530510_0000823_19198_19440 80
59 3300005293 Ga0065715_10115398 Ga0065715_101153983 81
60 3300005295 Ga0065707_10345748 Ga0065707_103457482 81
61 3300005328 Ga0070676_10183531 Ga0070676_101835311 81
62 3300005329 Ga0070683_100132261 Ga0070683_1001322612 81
63 3300005330 Ga0070690_100498254 Ga0070690_1004982542 81
64 3300005331 Ga0070670_100214536 Ga0070670_1002145363 81
65 3300005331 Ga0070670_100880975 Ga0070670_1008809752 81
66 3300005333 Ga0070677_10112358 Ga0070677_101123582 81
67 3300005333 Ga0070677_10386614 Ga0070677_103866142 81
68 3300005334 Ga0068869_100858111 Ga0068869_1008581111 81
69 3300005334 Ga0068869_101848702 Ga0068869_1018487022 81
70 3300005335 Ga0070666_10503711 Ga0070666_105037111 81
71 3300005335 Ga0070666_10942516 Ga0070666_109425162 81
72 3300005339 Ga0070660_100995876 Ga0070660_1009958762 81
73 3300005340 Ga0070689_100034442 Ga0070689_1000344422 81
74 3300005340 Ga0070689_100405790 Ga0070689_1004057903 81
75 3300005343 Ga0070687_101500055 Ga0070687_1015000552 81
76 3300005343 Ga0070687_101535969 Ga0070687_1015359692 81
77 3300005347 Ga0070668_102202588 Ga0070668_1022025882 81
78 3300005354 Ga0070675_100106612 Ga0070675_1001066122 81
79 3300005354 Ga0070675_100467327 Ga0070675_1004673272 81
80 3300005356 Ga0070674_100786927 Ga0070674_1007869271 81
81 3300005364 Ga0070673_100386007 Ga0070673_1003860072 81
82 3300005364 Ga0070673_100411074 Ga0070673_1004110742 81
83 3300005365 Ga0070688_100479774 Ga0070688_1004797742 81
84 3300005365 Ga0070688_100566142 Ga0070688_1005661422 81
85 3300005366 Ga0070659_100286509 Ga0070659_1002865092 81
86 3300005367 Ga0070667_101015964 Ga0070667_1010159641 81
87 3300005406 Ga0070703_10485987 Ga0070703_104859872 81
88 3300005436 Ga0070713_100185118 Ga0070713_1001851183 81
89 3300005436 Ga0070713_100568255 Ga0070713_1005682552 81
90 3300005440 Ga0070705_100140488 Ga0070705_1001404882 81
91 3300005440 Ga0070705_100331188 Ga0070705_1003311882 81
92 3300005440 Ga0070705_101637185 Ga0070705_1016371851 81
93 3300005441 Ga0070700_100781347 Ga0070700_1007813471 81
94 3300005441 Ga0070700_101166394 Ga0070700_1011663942 81
95 3300005444 Ga0070694_100006003 Ga0070694_1000060034 81
96 3300005444 Ga0070694_101654510 Ga0070694_1016545101 81
97 3300005445 Ga0070708_100007406 Ga0070708_1000074063 81
98 3300005455 Ga0070663_100023261 Ga0070663_1000232614 81
99 3300005456 Ga0070678_100366290 Ga0070678_1003662902 81
100 3300005456 Ga0070678_100962685 Ga0070678_1009626852 81
101 3300005458 Ga0070681_10060434 Ga0070681_100604342 81
102 3300005459 Ga0068867_100146582 Ga0068867_1001465823 81
103 3300005459 Ga0068867_100318868 Ga0068867_1003188682 81
104 3300005466 Ga0070685_10304428 Ga0070685_103044281 81
105 3300005466 Ga0070685_10354076 Ga0070685_103540762 81
106 3300005466 Ga0070685_11095420 Ga0070685_110954202 81
107 3300005468 Ga0070707_100044568 Ga0070707_1000445681 81
108 3300005468 Ga0070707_100205433 Ga0070707_1002054332 81
109 3300005468 Ga0070707_101171118 Ga0070707_1011711182 81
110 3300005471 Ga0070698_100017147 Ga0070698_1000171477 81
111 3300005471 Ga0070698_100937734 Ga0070698_1009377342 81
112 3300005471 Ga0070698_101257738 Ga0070698_1012577381 81
113 3300005518 Ga0070699_100012833 Ga0070699_1000128336 81
114 3300005518 Ga0070699_100023354 Ga0070699_1000233547 81
115 3300005530 Ga0070679_100700874 Ga0070679_1007008741 81
116 3300005535 Ga0070684_101251054 Ga0070684_1012510541 81
117 3300005536 Ga0070697_100067371 Ga0070697_1000673712 81
118 3300005536 Ga0070697_100243871 Ga0070697_1002438712 81
119 3300005543 Ga0070672_100574245 Ga0070672_1005742452 81
120 3300005543 Ga0070672_100630168 Ga0070672_1006301682 81
121 3300005543 Ga0070672_101904922 Ga0070672_1019049222 81
122 3300005544 Ga0070686_100416381 Ga0070686_1004163812 81
123 3300005546 Ga0070696_100018491 Ga0070696_1000184915 81
124 3300005546 Ga0070696_100059451 Ga0070696_1000594512 81
125 3300005548 Ga0070665_100380561 Ga0070665_1003805613 81
126 3300005548 Ga0070665_100612308 Ga0070665_1006123081 81
127 3300005548 Ga0070665_101562564 Ga0070665_1015625642 81
128 3300005548 Ga0070665_101622290 Ga0070665_1016222902 81
129 3300005549 Ga0070704_100004236 Ga0070704_1000042365 81
130 3300005549 Ga0070704_100110821 Ga0070704_1001108212 81
131 3300005549 Ga0070704_102232893 Ga0070704_1022328932 81
132 3300005563 Ga0068855_101124613 Ga0068855_1011246132 81
133 3300005564 Ga0070664_100473636 Ga0070664_1004736362 81
134 3300005564 Ga0070664_100603901 Ga0070664_1006039011 81
135 3300005564 Ga0070664_101232474 Ga0070664_1012324742 81
136 3300005578 Ga0068854_100268688 Ga0068854_1002686883 81
137 3300005614 Ga0068856_100743086 Ga0068856_1007430862 81
138 3300005616 Ga0068852_100133733 Ga0068852_1001337332 81
139 3300005617 Ga0068859_100275861 Ga0068859_1002758612 81
140 3300005618 Ga0068864_100016021 Ga0068864_1000160212 81
141 3300005618 Ga0068864_101326415 Ga0068864_1013264151 81
142 3300005719 Ga0068861_100532297 Ga0068861_1005322972 81
143 3300005719 Ga0068861_100648166 Ga0068861_1006481662 81
144 3300005719 Ga0068861_100720400 Ga0068861_1007204002 81
145 3300005834 Ga0068851_10229131 Ga0068851_102291312 81
146 3300005840 Ga0068870_10107884 Ga0068870_101078843 81
147 3300005841 Ga0068863_100206299 Ga0068863_1002062993 81
148 3300005841 Ga0068863_100649164 Ga0068863_1006491642 81
149 3300005842 Ga0068858_100019359 Ga0068858_1000193591 81
150 3300005842 Ga0068858_100024433 Ga0068858_1000244335 81
151 3300005842 Ga0068858_100236670 Ga0068858_1002366702 81
152 3300005844 Ga0068862_100523016 Ga0068862_1005230162 81
153 3300005844 Ga0068862_100844700 Ga0068862_1008447002 81
154 3300005844 Ga0068862_101861126 Ga0068862_1018611261 81
155 3300005985 Ga0081539_10050084 Ga0081539_100500842 81
156 3300006028 Ga0070717_10359416 Ga0070717_103594163 81
157 3300006042 Ga0075368_10012191 Ga0075368_100121912 81
158 3300006042 Ga0075368_10130153 Ga0075368_101301532 81
159 3300006048 Ga0075363_100037537 Ga0075363_1000375372 81
160 3300006051 Ga0075364_10001941 Ga0075364_100019418 81
161 3300006051 Ga0075364_10061965 Ga0075364_100619653 81
162 3300006051 Ga0075364_10111111 Ga0075364_101111112 81
163 3300006058 Ga0075432_10434900 Ga0075432_104349002 81
164 3300006173 Ga0070716_101270408 Ga0070716_1012704082 81
165 3300006177 Ga0075362_10001991 Ga0075362_100019914 81
166 3300006178 Ga0075367_10010746 Ga0075367_100107464 81
167 3300006178 Ga0075367_10080211 Ga0075367_100802113 81
168 3300006178 Ga0075367_10235060 Ga0075367_102350602 81
169 3300006178 Ga0075367_10324959 Ga0075367_103249592 81
170 3300006186 Ga0075369_10181022 Ga0075369_101810222 81
171 3300006186 Ga0075369_10259159 Ga0075369_102591592 81
172 3300006195 Ga0075366_10047206 Ga0075366_100472062 81
173 3300006195 Ga0075366_10093145 Ga0075366_100931453 81
174 3300006237 Ga0097621_100879523 Ga0097621_1008795232 81
175 3300006358 Ga0068871_100173558 Ga0068871_1001735581 81
176 3300006358 Ga0068871_101466996 Ga0068871_1014669962 81
177 3300006358 Ga0068871_101671544 Ga0068871_1016715442 81
178 3300006844 Ga0075428_100031002 Ga0075428_1000310027 81
179 3300006844 Ga0075428_102235573 Ga0075428_1022355732 81
180 3300006847 Ga0075431_100098315 Ga0075431_1000983153 81
181 3300006852 Ga0075433_10076711 Ga0075433_100767112 81
182 3300006852 Ga0075433_10801791 Ga0075433_108017912 81
183 3300006871 Ga0075434_100026639 Ga0075434_1000266394 81
184 3300006871 Ga0075434_100108884 Ga0075434_1001088843 81
185 3300006871 Ga0075434_100872466 Ga0075434_1008724662 81
186 3300006871 Ga0075434_101013817 Ga0075434_1010138171 81
187 3300006880 Ga0075429_100006683 Ga0075429_1000066837 81
188 3300006880 Ga0075429_101298911 Ga0075429_1012989111 81
189 3300006881 Ga0068865_100076034 Ga0068865_1000760343 81
190 3300006881 Ga0068865_100811075 Ga0068865_1008110752 81
191 3300006881 Ga0068865_101022531 Ga0068865_1010225312 81
192 3300006914 Ga0075436_100271197 Ga0075436_1002711972 81
193 3300006931 Ga0097620_100275868 Ga0097620_1002758682 81
194 3300007076 Ga0075435_100028860 Ga0075435_1000288605 81
195 3300007076 Ga0075435_100848491 Ga0075435_1008484912 81
196 3300009011 Ga0105251_10069657 Ga0105251_100696573 81
197 3300009011 Ga0105251_10408681 Ga0105251_104086812 81
198 3300009094 Ga0111539_10002954 Ga0111539_100029543 81
199 3300009094 Ga0111539_10135559 Ga0111539_101355592 81
200 3300009094 Ga0111539_10280228 Ga0111539_102802283 81
201 3300009094 Ga0111539_10528669 Ga0111539_105286692 81
202 3300009094 Ga0111539_10734924 Ga0111539_107349242 81
203 3300009098 Ga0105245_10370508 Ga0105245_103705082 81
204 3300009098 Ga0105245_10775425 Ga0105245_107754252 81
205 3300009098 Ga0105245_12018998 Ga0105245_120189982 81
206 3300009101 Ga0105247_10013971 Ga0105247_100139717 81
207 3300009101 Ga0105247_10069428 Ga0105247_100694284 81
208 3300009101 Ga0105247_10365430 Ga0105247_103654302 81
209 3300009101 Ga0105247_10931958 Ga0105247_109319581 81
210 3300009101 Ga0105247_11439158 Ga0105247_114391582 81
211 3300009147 Ga0114129_10008194 Ga0114129_100081943 81
212 3300009147 Ga0114129_10023525 Ga0114129_100235255 81
213 3300009147 Ga0114129_10027033 Ga0114129_100270336 81
214 3300009147 Ga0114129_10031591 Ga0114129_100315918 81
215 3300009148 Ga0105243_12009552 Ga0105243_120095522 81
216 3300009148 Ga0105243_12128827 Ga0105243_121288272 81
217 3300009176 Ga0105242_10631040 Ga0105242_106310402 81
218 3300009177 Ga0105248_10018478 Ga0105248_100184786 81
219 3300009177 Ga0105248_10245254 Ga0105248_102452544 81
220 3300009177 Ga0105248_10383986 Ga0105248_103839862 81
221 3300009177 Ga0105248_11075766 Ga0105248_110757662 81
222 3300009177 Ga0105248_11510760 Ga0105248_115107602 81
223 3300009177 Ga0105248_11904450 Ga0105248_119044502 81
224 3300009177 Ga0105248_12249976 Ga0105248_122499762 81
225 3300009545 Ga0105237_10342864 Ga0105237_103428642 81
226 3300009551 Ga0105238_10074364 Ga0105238_100743645 81
227 3300009551 Ga0105238_11604062 Ga0105238_116040621 81
228 3300009551 Ga0105238_11938747 Ga0105238_119387472 81
229 3300009553 Ga0105249_10239261 Ga0105249_102392613 81
230 3300009553 Ga0105249_12595475 Ga0105249_125954752 81
231 3300009553 Ga0105249_12989869 Ga0105249_129898692 81
232 3300011119 Ga0105246_10018878 Ga0105246_100188782 81
233 3300013296 Ga0157374_11242550 Ga0157374_112425502 81
234 3300013297 Ga0157378_10253219 Ga0157378_102532193 81
235 3300013306 Ga0163162_12330535 Ga0163162_123305352 81
236 3300013308 Ga0157375_10219574 Ga0157375_102195742 81
237 3300014325 Ga0163163_10040143 Ga0163163_100401433 81
238 3300014325 Ga0163163_11106059 Ga0163163_111060592 81
239 3300014325 Ga0163163_11444702 Ga0163163_114447022 81
240 3300014326 Ga0157380_10006444 Ga0157380_100064443 81
241 3300014326 Ga0157380_10135603 Ga0157380_101356033 81
242 3300014326 Ga0157380_12266901 Ga0157380_122669012 81
243 3300014968 Ga0157379_10025954 Ga0157379_100259544 81
244 3300014968 Ga0157379_10392864 Ga0157379_103928642 81
245 3300014968 Ga0157379_12089554 Ga0157379_120895541 81
246 3300014969 Ga0157376_12891149 Ga0157376_128911492 81
247 3300017792 Ga0163161_10645174 Ga0163161_106451742 81
248 3300021384 Ga0213876_10132468 Ga0213876_101324681 81
249 3300025315 Ga0207697_10000148 Ga0207697_1000014821 81
250 3300025315 Ga0207697_10286851 Ga0207697_102868512 81
251 3300025315 Ga0207697_10508098 Ga0207697_105080981 81
252 3300025321 Ga0207656_10072298 Ga0207656_100722983 81
253 3300025893 Ga0207682_10067940 Ga0207682_100679402 81
254 3300025900 Ga0207710_10024652 Ga0207710_100246524 81
255 3300025900 Ga0207710_10036749 Ga0207710_100367492 81
256 3300025901 Ga0207688_10009342 Ga0207688_100093427 81
257 3300025901 Ga0207688_10147553 Ga0207688_101475532 81
258 3300025901 Ga0207688_10791568 Ga0207688_107915682 81
259 3300025903 Ga0207680_10181481 Ga0207680_101814812 81
260 3300025903 Ga0207680_10422256 Ga0207680_104222562 81
261 3300025903 Ga0207680_10951180 Ga0207680_109511801 81
262 3300025904 Ga0207647_10454664 Ga0207647_104546642 81
263 3300025907 Ga0207645_10000577 Ga0207645_1000057718 81
264 3300025907 Ga0207645_10033216 Ga0207645_100332165 81
265 3300025907 Ga0207645_10077506 Ga0207645_100775062 81
266 3300025907 Ga0207645_10415030 Ga0207645_104150302 81
267 3300025907 Ga0207645_11036199 Ga0207645_110361992 81
268 3300025908 Ga0207643_10000648 Ga0207643_100006483 81
269 3300025908 Ga0207643_10059927 Ga0207643_100599273 81
270 3300025908 Ga0207643_10129251 Ga0207643_101292512 81
271 3300025908 Ga0207643_10233651 Ga0207643_102336513 81
272 3300025910 Ga0207684_10736513 Ga0207684_107365132 81
273 3300025912 Ga0207707_10037755 Ga0207707_100377556 81
274 3300025912 Ga0207707_11437353 Ga0207707_114373532 81
275 3300025914 Ga0207671_10474490 Ga0207671_104744902 81
276 3300025917 Ga0207660_10270773 Ga0207660_102707732 81
277 3300025918 Ga0207662_10016135 Ga0207662_100161356 81
278 3300025918 Ga0207662_10039454 Ga0207662_100394543 81
279 3300025918 Ga0207662_10289561 Ga0207662_102895613 81
280 3300025918 Ga0207662_10513457 Ga0207662_105134572 81
281 3300025918 Ga0207662_10679038 Ga0207662_106790382 81
282 3300025919 Ga0207657_10054067 Ga0207657_100540676 81
283 3300025920 Ga0207649_11444977 Ga0207649_114449771 81
284 3300025921 Ga0207652_11250928 Ga0207652_112509282 81
285 3300025922 Ga0207646_10039052 Ga0207646_100390526 81
286 3300025922 Ga0207646_10277166 Ga0207646_102771662 81
287 3300025922 Ga0207646_10565182 Ga0207646_105651822 81
288 3300025922 Ga0207646_11845183 Ga0207646_118451831 81
289 3300025923 Ga0207681_10021283 Ga0207681_100212835 81
290 3300025924 Ga0207694_10098919 Ga0207694_100989193 81
291 3300025924 Ga0207694_10135800 Ga0207694_101358002 81
292 3300025925 Ga0207650_10066421 Ga0207650_100664213 81
293 3300025925 Ga0207650_10366080 Ga0207650_103660802 81
294 3300025925 Ga0207650_10366660 Ga0207650_103666602 81
295 3300025926 Ga0207659_10000969 Ga0207659_1000096914 81
296 3300025926 Ga0207659_10013177 Ga0207659_100131772 81
297 3300025926 Ga0207659_10020573 Ga0207659_100205736 81
298 3300025926 Ga0207659_10217004 Ga0207659_102170041 81
299 3300025926 Ga0207659_10445192 Ga0207659_104451922 81
300 3300025927 Ga0207687_10437261 Ga0207687_104372612 81
301 3300025927 Ga0207687_11145869 Ga0207687_111458692 81
302 3300025927 Ga0207687_11797042 Ga0207687_117970422 81
303 3300025928 Ga0207700_10147134 Ga0207700_101471342 81
304 3300025931 Ga0207644_10143347 Ga0207644_101433474 81
305 3300025931 Ga0207644_10594397 Ga0207644_105943971 81
306 3300025931 Ga0207644_11070422 Ga0207644_110704222 81
307 3300025932 Ga0207690_10295895 Ga0207690_102958952 81
308 3300025932 Ga0207690_10365520 Ga0207690_103655202 81
309 3300025932 Ga0207690_11243710 Ga0207690_112437102 81
310 3300025933 Ga0207706_10009648 Ga0207706_100096489 81
311 3300025933 Ga0207706_10525295 Ga0207706_105252952 81
312 3300025934 Ga0207686_10335622 Ga0207686_103356222 81
313 3300025934 Ga0207686_11337405 Ga0207686_113374052 81
314 3300025935 Ga0207709_10066821 Ga0207709_100668214 81
315 3300025936 Ga0207670_10081470 Ga0207670_100814702 81
316 3300025936 Ga0207670_10506912 Ga0207670_105069122 81
317 3300025937 Ga0207669_10017605 Ga0207669_100176052 81
318 3300025937 Ga0207669_10343198 Ga0207669_103431982 81
319 3300025938 Ga0207704_10052747 Ga0207704_100527473 81
320 3300025938 Ga0207704_10399359 Ga0207704_103993592 81
321 3300025938 Ga0207704_10730925 Ga0207704_107309252 81
322 3300025939 Ga0207665_11014783 Ga0207665_110147832 81
323 3300025940 Ga0207691_10004463 Ga0207691_100044636 81
324 3300025940 Ga0207691_10524208 Ga0207691_105242082 81
325 3300025940 Ga0207691_10831513 Ga0207691_108315132 81
326 3300025941 Ga0207711_10033505 Ga0207711_100335051 81
327 3300025941 Ga0207711_10629290 Ga0207711_106292902 81
328 3300025941 Ga0207711_10687433 Ga0207711_106874332 81
329 3300025941 Ga0207711_10895376 Ga0207711_108953762 81
330 3300025941 Ga0207711_10927530 Ga0207711_109275301 81
331 3300025942 Ga0207689_10931492 Ga0207689_109314922 81
332 3300025942 Ga0207689_11751753 Ga0207689_117517532 81
333 3300025944 Ga0207661_10059988 Ga0207661_100599882 81
334 3300025944 Ga0207661_11826589 Ga0207661_118265892 81
335 3300025944 Ga0207661_11861054 Ga0207661_118610542 81
336 3300025945 Ga0207679_10014873 Ga0207679_100148734 81
337 3300025945 Ga0207679_10029985 Ga0207679_100299855 81
338 3300025945 Ga0207679_10218972 Ga0207679_102189723 81
339 3300025945 Ga0207679_11967363 Ga0207679_119673632 81
340 3300025949 Ga0207667_11773724 Ga0207667_117737242 81
341 3300025960 Ga0207651_10276934 Ga0207651_102769342 81
342 3300025960 Ga0207651_10393270 Ga0207651_103932703 81
343 3300025961 Ga0207712_10023764 Ga0207712_100237646 81
344 3300025961 Ga0207712_10265835 Ga0207712_102658352 81
345 3300025972 Ga0207668_10051544 Ga0207668_100515443 81
346 3300025986 Ga0207658_10386074 Ga0207658_103860742 81
347 3300025986 Ga0207658_10828339 Ga0207658_108283392 81
348 3300025986 Ga0207658_11086802 Ga0207658_110868022 81
349 3300026023 Ga0207677_10148956 Ga0207677_101489562 81
350 3300026023 Ga0207677_10945389 Ga0207677_109453892 81
351 3300026035 Ga0207703_10071228 Ga0207703_100712282 81
352 3300026035 Ga0207703_10467702 Ga0207703_104677022 81
353 3300026041 Ga0207639_10958450 Ga0207639_109584502 81
354 3300026067 Ga0207678_10044540 Ga0207678_100445402 81
355 3300026075 Ga0207708_10008793 Ga0207708_100087937 81
356 3300026075 Ga0207708_10012183 Ga0207708_100121832 81
357 3300026088 Ga0207641_10017355 Ga0207641_100173557 81
358 3300026088 Ga0207641_10271397 Ga0207641_102713972 81
359 3300026088 Ga0207641_10556087 Ga0207641_105560872 81
360 3300026088 Ga0207641_10654874 Ga0207641_106548742 81
361 3300026088 Ga0207641_10902678 Ga0207641_109026782 81
362 3300026089 Ga0207648_10054986 Ga0207648_100549864 81
363 3300026089 Ga0207648_10078893 Ga0207648_100788932 81
364 3300026089 Ga0207648_10205123 Ga0207648_102051232 81
365 3300026095 Ga0207676_10022493 Ga0207676_100224936 81
366 3300026095 Ga0207676_10042789 Ga0207676_100427892 81
367 3300026095 Ga0207676_10233286 Ga0207676_102332861 81
368 3300026095 Ga0207676_10901037 Ga0207676_109010372 81
369 3300026095 Ga0207676_11074361 Ga0207676_110743612 81
370 3300026116 Ga0207674_10083334 Ga0207674_100833342 81
371 3300026116 Ga0207674_10417021 Ga0207674_104170212 81
372 3300026116 Ga0207674_11492021 Ga0207674_114920212 81
373 3300026118 Ga0207675_100002044 Ga0207675_1000020449 81
374 3300026118 Ga0207675_100255612 Ga0207675_1002556122 81
375 3300026121 Ga0207683_10407442 Ga0207683_104074422 81
376 3300026142 Ga0207698_10397913 Ga0207698_103979133 81
377 3300026142 Ga0207698_10645430 Ga0207698_106454302 81
378 3300027682 Ga0209971_1153740 Ga0209971_11537402 81
379 3300027866 Ga0209813_10027373 Ga0209813_100273732 81
380 3300027907 Ga0207428_10007408 Ga0207428_1000740810 81
381 3300027907 Ga0207428_10454617 Ga0207428_104546172 81
382 3300028379 Ga0268266_10128322 Ga0268266_101283222 81
383 3300028379 Ga0268266_10266432 Ga0268266_102664323 81
384 3300028379 Ga0268266_10787131 Ga0268266_107871312 81
385 3300028379 Ga0268266_11294709 Ga0268266_112947091 81
386 3300028380 Ga0268265_10097703 Ga0268265_100977033 81
387 3300028380 Ga0268265_10234864 Ga0268265_102348643 81
388 3300028380 Ga0268265_10334847 Ga0268265_103348472 81
389 3300028380 Ga0268265_10437572 Ga0268265_104375722 81
390 3300028380 Ga0268265_10487426 Ga0268265_104874262 81
391 3300028380 Ga0268265_11682582 Ga0268265_116825822 81
392 3300028381 Ga0268264_10467874 Ga0268264_104678742 81
393 3300028381 Ga0268264_10490633 Ga0268264_104906332 81
394 3300028381 Ga0268264_10886228 Ga0268264_108862282 81
395 3300028381 Ga0268264_11186894 Ga0268264_111868942 81
396 3300028381 Ga0268264_11772098 Ga0268264_117720982 81
397 3300028381 Ga0268264_12659005 Ga0268264_126590052 81
398 3300031731 Ga0307405_10040508 Ga0307405_100405083 81
399 3300031731 Ga0307405_10328688 Ga0307405_103286882 81
400 3300031824 Ga0307413_10312993 Ga0307413_103129932 81
401 3300031824 Ga0307413_10374377 Ga0307413_103743772 81
402 3300031824 Ga0307413_12123355 Ga0307413_121233551 81
403 3300031901 Ga0307406_10704735 Ga0307406_107047352 81
404 3300031903 Ga0307407_10014361 Ga0307407_100143614 81
405 3300031903 Ga0307407_10782095 Ga0307407_107820952 81
406 3300031903 Ga0307407_11105397 Ga0307407_111053972 81
407 3300031911 Ga0307412_10293359 Ga0307412_102933592 81
408 3300031911 Ga0307412_11154482 Ga0307412_111544822 81
409 3300031995 Ga0307409_100283138 Ga0307409_1002831383 81
410 3300031995 Ga0307409_101163208 Ga0307409_1011632082 81
411 3300032002 Ga0307416_100023618 Ga0307416_1000236184 81
412 3300032002 Ga0307416_100764604 Ga0307416_1007646042 81
413 3300032002 Ga0307416_100938285 Ga0307416_1009382852 81
414 3300032002 Ga0307416_102965719 Ga0307416_1029657192 81
415 3300032002 Ga0307416_103503215 Ga0307416_1035032151 81
416 3300032004 Ga0307414_10071933 Ga0307414_100719334 81
417 3300032004 Ga0307414_10552870 Ga0307414_105528702 81
418 3300032004 Ga0307414_11408706 Ga0307414_114087062 81
419 3300032005 Ga0307411_10048909 Ga0307411_100489094 81
420 3300034817 Ga0373948_0077899 Ga0373948_0077899_180_425 81
421 3300034819 Ga0373958_0012965 Ga0373958_0012965_935_1180 81
422 3300035085 Ga0373929_0169242 Ga0373929_0169242_156_401 81
423 3300035086 Ga0373934_0084503 Ga0373934_0084503_194_439 81
424 3300035088 Ga0373940_0296758 Ga0373940_0296758_277_522 81
425 3300035090 Ga0373949_0085729 Ga0373949_0085729_345_590 81
426 3300035092 Ga0373952_0082384 Ga0373952_0082384_372_617 81
427 3300035112 Ga0373932_0034344 Ga0373932_0034344_907_1152 81
428 3300035114 Ga0373939_0037499 Ga0373939_0037499_1017_1262 81
429 3300035117 Ga0373953_0089015 Ga0373953_0089015_598_843 81
430 3300035121 Ga0373960_0281323 Ga0373960_0281323_327_572 81
431 3300035121 Ga0373960_0323829 Ga0373960_0323829_129_374 81
432 3300035170 Ga0373943_0953318 Ga0373943_0953318_196_441 81
433 3300035172 Ga0373955_0357664 Ga0373955_0357664_389_634 81
434 3300035172 Ga0373955_0569201 Ga0373955_0569201_193_438 81
435 3300035207 Ga0373942_0382880 Ga0373942_0382880_135_380 81
436 3300035242 Ga0373962_0120075 Ga0373962_0120075_418_663 81
437 3300035410 Ga0373924_0056817 Ga0373924_0056817_486_731 81
438 3300035691 Ga0373931_0938970 Ga0373931_0938970_234_479 81
439 3300035692 Ga0373935_1141165 Ga0373935_1141165_289_534 81
440 3300035724 Ga0373933_0418401 Ga0373933_0418401_207_452 81
441 3300035725 Ga0373947_0195020 Ga0373947_0195020_441_719 81
442 3300036401 Ga0373937_0009015 Ga0373937_0009015_8044_8289 81
443 3300036401 Ga0373937_0138875 Ga0373937_0138875_554_799 81
444 3300036401 Ga0373937_0387114 Ga0373937_0387114_160_417 81
445 3300037068 Ga0373925_1597290 Ga0373925_1597290_110_385 81
446 3300037418 Ga0395900_0200613 Ga0395900_0200613_1001_1246 81
447 3300038443 Ga0395901_0944907 Ga0395901_0944907_224_469 81
448 3300039437 Ga0436365_1525786 Ga0436365_1525786_38_337 81
449 3300039437 Ga0436365_1546745 Ga0436365_1546745_49_300 81
450 3300041406 Ga0439439_0148137 Ga0439439_0148137_161_406 81
451 3300041406 Ga0439439_0276356 Ga0439439_0276356_146_391 81
452 3300041408 Ga0439453_0042870 Ga0439453_0042870_203_448 81
453 3300041410 Ga0439461_0183755 Ga0439461_0183755_102_365 81
454 3300041441 Ga0451787_475156 Ga0451787_475156_307_552 81
455 3300041458 Ga0451798_0729637 Ga0451798_0729637_28_273 81
456 3300041505 Ga0451849_0714227 Ga0451849_0714227_12_257 81
457 3300041512 Ga0451853_0161368 Ga0451853_0161368_120_365 81
458 3300041512 Ga0451853_0346861 Ga0451853_0346861_464_709 81
459 3300041512 Ga0451853_0530934 Ga0451853_0530934_111_356 81
460 3300041997 Ga0439431_0012921 Ga0439431_0012921_1141_1386 81
461 3300041999 Ga0439433_0019429 Ga0439433_0019429_48_293 81
462 3300041999 Ga0439433_0048069 Ga0439433_0048069_441_686 81
463 3300042007 Ga0439449_0021085 Ga0439449_0021085_936_1181 81
464 3300042014 Ga0439457_051057 Ga0439457_051057_256_501 81
465 3300042126 Ga0450888_026221 Ga0450888_026221_295_540 81
466 3300042134 Ga0450898_088715 Ga0450898_088715_371_616 81
467 3300042134 Ga0450898_137686 Ga0450898_137686_258_503 81
468 3300042156 Ga0439446_0012405 Ga0439446_0012405_223_468 81
469 3300042156 Ga0439446_0275066 Ga0439446_0275066_299_544 81
470 3300042436 Ga0439435_0074908 Ga0439435_0074908_168_413 81
471 3300042439 Ga0439464_0058306 Ga0439464_0058306_107_352 81
472 3300042461 Ga0439460_0027246 Ga0439460_0027246_281_526 81
473 3300042530 Ga0450916_094375 Ga0450916_094375_214_459 81
474 3300042876 Ga0451577_1017653 Ga0451577_1017653_380_634 81
475 3300044673 Ga0453683_0325763 Ga0453683_0325763_310_555 81
476 3300045051 Ga0451576_0245552 Ga0451576_0245552_648_893 81
477 3300045051 Ga0451576_0527542 Ga0451576_0527542_323_568 81
478 3300045051 Ga0451576_1570429 Ga0451576_1570429_74_319 81
479 3300046454 Ga0495592_0036800 Ga0495592_0036800_34_282 81
480 3300046459 Ga0495629_0087337 Ga0495629_0087337_11_256 81
481 3300046472 Ga0495580_0021601 Ga0495580_0021601_947_1192 81
482 3300046473 Ga0495582_0814597 Ga0495582_0814597_245_490 81
483 3300046499 Ga0495594_0347838 Ga0495594_0347838_139_384 81
484 3300046511 Ga0495608_0621883 Ga0495608_0621883_381_626 81
485 3300046516 Ga0495628_0082641 Ga0495628_0082641_692_940 81
486 3300046517 Ga0495630_0396827 Ga0495630_0396827_395_640 81
487 3300046529 Ga0495652_0358876 Ga0495652_0358876_598_843 81
488 3300046537 Ga0495598_0051538 Ga0495598_0051538_524_769 81
489 3300046543 Ga0495645_0208714 Ga0495645_0208714_502_747 81
490 3300046559 Ga0495667_0298389 Ga0495667_0298389_130_375 81
491 3300046664 Ga0495659_0010010 Ga0495659_0010010_2172_2417 81
492 3300046664 Ga0495659_0012078 Ga0495659_0012078_2017_2271 81
493 3300046674 Ga0495588_0597731 Ga0495588_0597731_100_345 81
494 3300046675 Ga0495657_0237651 Ga0495657_0237651_318_563 81
495 3300046678 Ga0495599_0016096 Ga0495599_0016096_1704_1952 81
496 3300046679 Ga0495623_0080316 Ga0495623_0080316_113_358 81
497 3300046679 Ga0495623_0399474 Ga0495623_0399474_111_356 81
498 3300046683 Ga0495658_0203869 Ga0495658_0203869_786_1031 81
499 3300047318 Ga0495636_0619271 Ga0495636_0619271_148_393 81
500 3300047471 Ga0495684_0053071 Ga0495684_0053071_453_698 81
501 3300047471 Ga0495684_0423050 Ga0495684_0423050_457_705 81
502 3300048088 Ga0495602_0193269 Ga0495602_0193269_888_1133 81
503 3300048089 Ga0495614_0425816 Ga0495614_0425816_354_599 81
504 3300048905 Ga0496102_0283069 Ga0496102_0283069_338_583 81
505 3300048907 Ga0496104_0071451 Ga0496104_0071451_667_912 81
506 3300048907 Ga0496104_0090082 Ga0496104_0090082_1090_1335 81
507 3300048908 Ga0496105_0321925 Ga0496105_0321925_508_753 81
508 3300048908 Ga0496105_1105393 Ga0496105_1105393_273_548 81
509 3300048909 Ga0496106_0313017 Ga0496106_0313017_316_561 81
510 3300048909 Ga0496106_1047169 Ga0496106_1047169_232_477 81
511 3300048910 Ga0496107_0756616 Ga0496107_0756616_354_599 81
512 3300048911 Ga0496108_0012146 Ga0496108_0012146_36_281 81
513 3300048911 Ga0496108_0126536 Ga0496108_0126536_672_917 81
514 3300048911 Ga0496108_0156640 Ga0496108_0156640_1149_1394 81
515 3300048911 Ga0496108_1424181 Ga0496108_1424181_59_304 81
516 3300048912 Ga0496109_0228518 Ga0496109_0228518_416_661 81
517 3300048912 Ga0496109_0412776 Ga0496109_0412776_725_970 81
518 3300048912 Ga0496109_0912318 Ga0496109_0912318_393_638 81
519 3300048913 Ga0496110_0065394 Ga0496110_0065394_90_335 81
520 3300048913 Ga0496110_0126111 Ga0496110_0126111_257_502 81
521 3300048913 Ga0496110_0213981 Ga0496110_0213981_936_1181 81
522 3300048915 Ga0496112_0123167 Ga0496112_0123167_11_256 81
523 3300048915 Ga0496112_0173703 Ga0496112_0173703_61_306 81
524 3300048916 Ga0496113_0014422 Ga0496113_0014422_4502_4747 81
525 3300048916 Ga0496113_0583909 Ga0496113_0583909_305_550 81
526 3300048916 Ga0496113_0688483 Ga0496113_0688483_212_457 81
527 3300048917 Ga0496114_0287977 Ga0496114_0287977_1171_1416 81
528 3300048917 Ga0496114_0348063 Ga0496114_0348063_832_1077 81
529 3300048917 Ga0496114_0713048 Ga0496114_0713048_330_605 81
530 3300048917 Ga0496114_1107393 Ga0496114_1107393_50_295 81
531 3300048918 Ga0496115_0561557 Ga0496115_0561557_489_734 81
532 3300049568 Ga0501031_0010734 Ga0501031_0010734_1955_2227 81
533 3300049568 Ga0501031_0101150 Ga0501031_0101150_374_634 81
534 3300049568 Ga0501031_1068027 Ga0501031_1068027_219_464 81
535 3300049569 Ga0501032_0006127 Ga0501032_0006127_468_740 81
536 3300049569 Ga0501032_0046755 Ga0501032_0046755_1854_2114 81
537 3300049570 Ga0501033_0090264 Ga0501033_0090264_1280_1552 81
538 3300049571 Ga0501034_0004095 Ga0501034_0004095_8731_8991 81
539 3300049571 Ga0501034_0053918 Ga0501034_0053918_2939_3184 81
540 3300049571 Ga0501034_0073863 Ga0501034_0073863_676_936 81
541 3300049571 Ga0501034_0240966 Ga0501034_0240966_1066_1338 81
542 3300049572 Ga0501036_0001297 Ga0501036_0001297_3454_3726 81
543 3300049572 Ga0501036_0021831 Ga0501036_0021831_3019_3279 81
544 3300049572 Ga0501036_0025319 Ga0501036_0025319_4192_4452 81
545 3300049572 Ga0501036_1362232 Ga0501036_1362232_242_487 81
546 3300049573 Ga0501037_0006772 Ga0501037_0006772_2627_2899 81
547 3300049573 Ga0501037_0120019 Ga0501037_0120019_13_273 81
548 3300049574 Ga0501038_0002744 Ga0501038_0002744_12303_12575 81
549 3300049574 Ga0501038_0013119 Ga0501038_0013119_2124_2384 81
550 3300049574 Ga0501038_0394075 Ga0501038_0394075_401_646 81
551 3300049574 Ga0501038_0440230 Ga0501038_0440230_435_695 81
552 3300049575 Ga0501039_0009837 Ga0501039_0009837_2095_2355 81
553 3300049575 Ga0501039_0023300 Ga0501039_0023300_3323_3595 81
554 3300049575 Ga0501039_0037521 Ga0501039_0037521_2157_2417 81
555 3300049575 Ga0501039_0089225 Ga0501039_0089225_685_930 81
556 3300049575 Ga0501039_0836030 Ga0501039_0836030_310_555 81
557 3300049576 Ga0501040_0361474 Ga0501040_0361474_433_678 81
558 3300049577 Ga0501041_0143166 Ga0501041_0143166_1082_1327 81
559 3300049577 Ga0501041_0936965 Ga0501041_0936965_128_385 81
560 3300049578 Ga0501042_0007620 Ga0501042_0007620_1920_2192 81
561 3300049578 Ga0501042_0110386 Ga0501042_0110386_53_298 81
562 3300049578 Ga0501042_0409899 Ga0501042_0409899_300_560 81
563 3300049578 Ga0501042_0574807 Ga0501042_0574807_46_291 81
564 3300049579 Ga0501043_0004734 Ga0501043_0004734_1646_1918 81
565 3300049579 Ga0501043_0007098 Ga0501043_0007098_8522_8782 81
566 3300049579 Ga0501043_0017348 Ga0501043_0017348_435_695 81
567 3300049580 Ga0501046_0003264 Ga0501046_0003264_3918_4190 81
568 3300049580 Ga0501046_0006325 Ga0501046_0006325_5094_5354 81
569 3300049581 Ga0501047_0001697 Ga0501047_0001697_10527_10787 81
570 3300049581 Ga0501047_0062272 Ga0501047_0062272_2695_2967 81
571 3300049581 Ga0501047_0173064 Ga0501047_0173064_381_656 81
572 3300049581 Ga0501047_0194194 Ga0501047_0194194_1603_1863 81
573 3300049581 Ga0501047_0407709 Ga0501047_0407709_381_656 81
574 3300049581 Ga0501047_0620094 Ga0501047_0620094_370_615 81
575 3300049582 Ga0501048_0002137 Ga0501048_0002137_10960_11232 81
576 3300049582 Ga0501048_0009187 Ga0501048_0009187_4698_4958 81
577 3300049582 Ga0501048_0041817 Ga0501048_0041817_1791_2036 81
578 3300049582 Ga0501048_1144200 Ga0501048_1144200_163_408 81
579 3300049583 Ga0501067_0008841 Ga0501067_0008841_68_328 81
580 3300049583 Ga0501067_0075797 Ga0501067_0075797_1016_1288 81
581 3300049584 Ga0501068_0002325 Ga0501068_0002325_4652_4912 81
582 3300049584 Ga0501068_0016131 Ga0501068_0016131_938_1210 81
583 3300049584 Ga0501068_0693967 Ga0501068_0693967_298_543 81
584 3300049584 Ga0501068_1089672 Ga0501068_1089672_136_381 81
585 3300049585 Ga0501069_0001824 Ga0501069_0001824_4046_4318 81
586 3300049585 Ga0501069_0122538 Ga0501069_0122538_462_722 81
587 3300049585 Ga0501069_0522413 Ga0501069_0522413_300_551 81
588 3300049585 Ga0501069_0839417 Ga0501069_0839417_53_298 81
589 3300049586 Ga0501070_0008436 Ga0501070_0008436_3704_3976 81
590 3300049586 Ga0501070_0145492 Ga0501070_0145492_614_874 81
591 3300049586 Ga0501070_0815349 Ga0501070_0815349_246_491 81
592 3300049587 Ga0501071_0037994 Ga0501071_0037994_1945_2217 81
593 3300049587 Ga0501071_0077378 Ga0501071_0077378_81_326 81
594 3300049588 Ga0501072_0122922 Ga0501072_0122922_736_1008 81
595 3300049588 Ga0501072_0435929 Ga0501072_0435929_644_904 81
596 3300049588 Ga0501072_0740290 Ga0501072_0740290_213_458 81
597 3300049589 Ga0501073_0000980 Ga0501073_0000980_2834_3094 81
598 3300049589 Ga0501073_0003336 Ga0501073_0003336_9232_9504 81
599 3300049589 Ga0501073_0064008 Ga0501073_0064008_1318_1578 81
600 3300049590 Ga0501074_0032568 Ga0501074_0032568_417_689 81
601 3300049590 Ga0501074_0333303 Ga0501074_0333303_288_533 81
602 3300049591 Ga0501075_0040428 Ga0501075_0040428_1763_2008 81
603 3300049591 Ga0501075_0187463 Ga0501075_0187463_1140_1412 81
604 3300049591 Ga0501075_0573496 Ga0501075_0573496_553_798 81
605 3300049591 Ga0501075_1185766 Ga0501075_1185766_112_372 81
606 3300049592 Ga0501076_0077285 Ga0501076_0077285_1897_2142 81
607 3300049592 Ga0501076_0197595 Ga0501076_0197595_1247_1507 81
608 3300049592 Ga0501076_1752817 Ga0501076_1752817_51_311 81
609 3300049652 Ga0501202_109058 Ga0501202_109058_413_658 81
610 3300049658 Ga0501211_033779 Ga0501211_033779_309_554 81
611 3300049741 Ga0501079_0000894 Ga0501079_0000894_2178_2450 81
612 3300049741 Ga0501079_0570131 Ga0501079_0570131_144_404 81
613 3300049742 Ga0501080_0000066 Ga0501080_0000066_15337_15597 81
614 3300049742 Ga0501080_0130279 Ga0501080_0130279_1204_1449 81
615 3300049742 Ga0501080_0237718 Ga0501080_0237718_1262_1534 81
616 3300049742 Ga0501080_0272207 Ga0501080_0272207_639_905 81
617 3300049742 Ga0501080_0456202 Ga0501080_0456202_511_771 81
618 3300049742 Ga0501080_1686522 Ga0501080_1686522_45_290 81
619 3300049743 Ga0501081_0170823 Ga0501081_0170823_591_836 81
620 3300049743 Ga0501081_0394786 Ga0501081_0394786_110_370 81
621 3300049744 Ga0501083_0016724 Ga0501083_0016724_180_440 81
622 3300049744 Ga0501083_0035172 Ga0501083_0035172_2012_2284 81
623 3300049744 Ga0501083_0231638 Ga0501083_0231638_243_488 81
624 3300049744 Ga0501083_0340084 Ga0501083_0340084_447_692 81
625 3300049822 Ga0501035_0015652 Ga0501035_0015652_4814_5074 81
626 3300049822 Ga0501035_0095354 Ga0501035_0095354_1876_2148 81
627 3300049822 Ga0501035_0099008 Ga0501035_0099008_1613_1858 81
628 3300049822 Ga0501035_1285766 Ga0501035_1285766_271_531 81
629 3300049823 Ga0501044_0003120 Ga0501044_0003120_10615_10875 81
630 3300049823 Ga0501044_0149288 Ga0501044_0149288_1283_1555 81
631 3300049824 Ga0501045_0018769 Ga0501045_0018769_2572_2817 81
632 3300049824 Ga0501045_0068448 Ga0501045_0068448_2149_2421 81
633 3300049824 Ga0501045_0504729 Ga0501045_0504729_168_413 81
634 3300050489 nmdc:mga03683_3512_c1 nmdc:mga03683_3512_c1_3017_3289 81
635 3300050490 nmdc:mga03n38_37389_c1 nmdc:mga03n38_37389_c1_1456_1725 81
636 3300050490 nmdc:mga03n38_381621_c1 nmdc:mga03n38_381621_c1_318_590 81
637 3300050491 nmdc:mga00v17_1057941_c1 nmdc:mga00v17_1057941_c1_47_316 81
638 3300050491 nmdc:mga00v17_22107_c1 nmdc:mga00v17_22107_c1_1198_1470 81
639 3300050491 nmdc:mga00v17_25358_c1 nmdc:mga00v17_25358_c1_1598_1867 81
640 3300050491 nmdc:mga00v17_258373_c1 nmdc:mga00v17_258373_c1_435_695 81
641 3300050492 nmdc:mga0yw44_1130346_c1 nmdc:mga0yw44_1130346_c1_122_394 81
642 3300050493 nmdc:mga0k408_57475_c1 nmdc:mga0k408_57475_c1_932_1201 81
643 3300050493 nmdc:mga0k408_62603_c1 nmdc:mga0k408_62603_c1_681_953 81
644 3300050494 nmdc:mga06z11_11344_c1 nmdc:mga06z11_11344_c1_2498_2767 81
645 3300050494 nmdc:mga06z11_12831_c1 nmdc:mga06z11_12831_c1_1317_1589 81
646 3300050494 nmdc:mga06z11_504650_c1 nmdc:mga06z11_504650_c1_63_323 81
647 3300050494 nmdc:mga06z11_525214_c1 nmdc:mga06z11_525214_c1_408_677 81
648 3300050495 nmdc:mga04h51_12269_c1 nmdc:mga04h51_12269_c1_1794_2066 81
649 3300050495 nmdc:mga04h51_58576_c1 nmdc:mga04h51_58576_c1_85_354 81
650 3300050507 nmdc:mga05p37_28413_c1 nmdc:mga05p37_28413_c1_1654_1899 81
651 3300050507 nmdc:mga05p37_46442_c1 nmdc:mga05p37_46442_c1_2802_3047 81
652 3300050507 nmdc:mga05p37_866386_c1 nmdc:mga05p37_866386_c1_265_510 81
653 3300050507 nmdc:mga05p37_94207_c1 nmdc:mga05p37_94207_c1_55_300 81
654 3300050508 nmdc:mga09592_21965_c1 nmdc:mga09592_21965_c1_2965_3210 81
655 3300050508 nmdc:mga09592_33805_c1 nmdc:mga09592_33805_c1_3880_4125 81
656 3300050509 nmdc:mga0qj67_1159618_c1 nmdc:mga0qj67_1159618_c1_96_341 81
657 3300050509 nmdc:mga0qj67_127923_c1 nmdc:mga0qj67_127923_c1_1536_1781 81
658 3300050509 nmdc:mga0qj67_798897_c1 nmdc:mga0qj67_798897_c1_314_559 81
659 3300050510 nmdc:mga06r32_11939_c1 nmdc:mga06r32_11939_c1_1890_2135 81
660 3300050510 nmdc:mga06r32_182296_c1 nmdc:mga06r32_182296_c1_1010_1255 81
661 3300050510 nmdc:mga06r32_522658_c1 nmdc:mga06r32_522658_c1_436_681 81
662 3300050511 nmdc:mga08y16_118896_c1 nmdc:mga08y16_118896_c1_954_1199 81
663 3300050511 nmdc:mga08y16_2554_c1 nmdc:mga08y16_2554_c1_16629_16874 81
664 3300050511 nmdc:mga08y16_62014_c1 nmdc:mga08y16_62014_c1_2834_3079 81
665 3300050511 nmdc:mga08y16_751310_c1 nmdc:mga08y16_751310_c1_72_317 81
666 3300050511 nmdc:mga08y16_758913_c1 nmdc:mga08y16_758913_c1_515_769 81
667 3300050511 nmdc:mga08y16_878093_c1 nmdc:mga08y16_878093_c1_57_302 81
668 3300050512 nmdc:mga0n895_1112729_c1 nmdc:mga0n895_1112729_c1_407_652 81
669 3300050512 nmdc:mga0n895_187087_c1 nmdc:mga0n895_187087_c1_1626_1871 81
670 3300050512 nmdc:mga0n895_295497_c1 nmdc:mga0n895_295497_c1_807_1097 81
671 3300050512 nmdc:mga0n895_95358_c1 nmdc:mga0n895_95358_c1_691_936 81
672 3300050513 nmdc:mga0rr50_130182_c1 nmdc:mga0rr50_130182_c1_36_281 81
673 3300050513 nmdc:mga0rr50_225036_c1 nmdc:mga0rr50_225036_c1_1142_1387 81
674 3300050513 nmdc:mga0rr50_423103_c1 nmdc:mga0rr50_423103_c1_355_600 81
675 3300050515 nmdc:mga0a205_14932_c1 nmdc:mga0a205_14932_c1_3411_3656 81
676 3300050515 nmdc:mga0a205_32867_c1 nmdc:mga0a205_32867_c1_4088_4333 81
677 3300050515 nmdc:mga0a205_519314_c1 nmdc:mga0a205_519314_c1_583_828 81
678 3300050516 nmdc:mga0sz30_456401_c1 nmdc:mga0sz30_456401_c1_124_444 81
679 3300050516 nmdc:mga0sz30_61594_c1 nmdc:mga0sz30_61594_c1_205_513 81
680 3300053139 Ga0500568_0005285 Ga0500568_0005285_1261_1530 81
681 3300054114 Ga0501084_0115989 Ga0501084_0115989_840_1112 81
682 3300054114 Ga0501084_0478743 Ga0501084_0478743_277_537 81
683 3300054114 Ga0501084_0614204 Ga0501084_0614204_498_758 81
684 3300054114 Ga0501084_1269550 Ga0501084_1269550_147_404 81
685 3300059426 Ga0590077_158612 Ga0590077_158612_159_404 81
686 3300060353 Ga0501082_0002081 Ga0501082_0002081_1390_1662 81
687 3300060353 Ga0501082_0004370 Ga0501082_0004370_7407_7667 81
688 3300060353 Ga0501082_0254868 Ga0501082_0254868_764_1024 81
689 3300060353 Ga0501082_0345443 Ga0501082_0345443_367_612 81
690 3300060353 Ga0501082_0740998 Ga0501082_0740998_565_831 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

5

81

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9226 1 81
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9167 2 81
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9121 1 81
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.9028 1 81
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8959 2 81
ID Description Score Start End Superfamily
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9633 4 78 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9619 1 81 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9392 4 78 3.10.20.30
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9203 1 81 3.10.20.30
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9098 1 81 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2V8E0H6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9993 1 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A2E4FPK8-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9993 1 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A2E4I8K0-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9928 1 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A2V8IP18-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.992 1 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A2V8A7K9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9916 1 81 GO:0000166
GO:0006777
GO:1990133

Feature Viewer

pLDDT pTM Quality
95.97 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map