F475450
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 312 | 690 | 82 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10132468|Ga0213876_101324681 |
| Length | 99 |
| Sequence | VHVTVRLFARLRELAGAAELRREVADGGTALDVWNGLSRDFPALGDYTTAISVAVNEEYARLAAPVRDGDEVAFLPPVSGGAAAASERSGIQRSPRASV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 178 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 201 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 202 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 203 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 208 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 209 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 210 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 211 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 212 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 213 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 214 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 215 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 216 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 217 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 284 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 297 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.22 |
| Nodule | 0 |
| Rhizoplane | 4.49 |
| Rhizosphere | 89.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10115398 | 3300005293 | Bacteria | 2405 |
| 2 | Ga0065707_10345748 | 3300005295 | Bacteria | 926 |
| 3 | Ga0070676_10183531 | 3300005328 | Bacteria | 1362 |
| 4 | Ga0070683_100132261 | 3300005329 | Bacteria | 2361 |
| 5 | Ga0070690_100498254 | 3300005330 | Bacteria | 911 |
| 6 | Ga0070670_100214536 | 3300005331 | Archaea | 1674 |
| 7 | Ga0070670_100880975 | 3300005331 | Bacteria | 811 |
| 8 | Ga0070677_10112358 | 3300005333 | Bacteria | 1218 |
| 9 | Ga0070677_10386614 | 3300005333 | Unclassified | 734 |
| 10 | Ga0068869_100858111 | 3300005334 | Bacteria | 783 |
| 11 | Ga0068869_101848702 | 3300005334 | Bacteria | 541 |
| 12 | Ga0070666_10503711 | 3300005335 | Bacteria | 878 |
| 13 | Ga0070666_10942516 | 3300005335 | Bacteria | 639 |
| 14 | Ga0070660_100995876 | 3300005339 | Bacteria | 708 |
| 15 | Ga0070689_100034442 | 3300005340 | Bacteria | 3864 |
| 16 | Ga0070689_100405790 | 3300005340 | Bacteria | 1153 |
| 17 | Ga0070689_101384246 | 3300005340 | Unclassified | 635 |
| 18 | Ga0070689_101969776 | 3300005340 | Unclassified | 534 |
| 19 | Ga0070687_101169594 | 3300005343 | Bacteria | 566 |
| 20 | Ga0070687_101500055 | 3300005343 | Unclassified | 507 |
| 21 | Ga0070687_101535969 | 3300005343 | Bacteria | 502 |
| 22 | Ga0070668_102202588 | 3300005347 | Unclassified | 509 |
| 23 | Ga0070675_100106612 | 3300005354 | Bacteria | 2366 |
| 24 | Ga0070675_100467327 | 3300005354 | Bacteria | 1133 |
| 25 | Ga0070674_100786927 | 3300005356 | Unclassified | 820 |
| 26 | Ga0070673_100386007 | 3300005364 | Bacteria | 1249 |
| 27 | Ga0070673_100411074 | 3300005364 | Bacteria | 1211 |
| 28 | Ga0070688_100479774 | 3300005365 | Bacteria | 935 |
| 29 | Ga0070688_100566142 | 3300005365 | Bacteria | 866 |
| 30 | Ga0070659_100286509 | 3300005366 | Bacteria | 1371 |
| 31 | Ga0070667_101015964 | 3300005367 | Unclassified | 774 |
| 32 | Ga0070703_10485987 | 3300005406 | Unclassified | 553 |
| 33 | Ga0070713_100185118 | 3300005436 | Bacteria | 1874 |
| 34 | Ga0070713_100568255 | 3300005436 | Bacteria | 1075 |
| 35 | Ga0070705_100140488 | 3300005440 | Bacteria | 1589 |
| 36 | Ga0070705_100331188 | 3300005440 | Bacteria | 1103 |
| 37 | Ga0070705_101637185 | 3300005440 | Unclassified | 542 |
| 38 | Ga0070700_100781347 | 3300005441 | Bacteria | 767 |
| 39 | Ga0070700_101166394 | 3300005441 | Unclassified | 642 |
| 40 | Ga0070694_100006003 | 3300005444 | Bacteria | 7367 |
| 41 | Ga0070694_101654510 | 3300005444 | Unclassified | 544 |
| 42 | Ga0070708_100007406 | 3300005445 | Bacteria | 8781 |
| 43 | Ga0070663_100023261 | 3300005455 | Bacteria | 4151 |
| 44 | Ga0070678_100366290 | 3300005456 | Bacteria | 1243 |
| 45 | Ga0070678_100962685 | 3300005456 | Unclassified | 783 |
| 46 | Ga0070681_10060434 | 3300005458 | Bacteria | 3766 |
| 47 | Ga0068867_100146582 | 3300005459 | Bacteria | 1851 |
| 48 | Ga0068867_100318868 | 3300005459 | Bacteria | 1287 |
| 49 | Ga0068867_101471985 | 3300005459 | Unclassified | 633 |
| 50 | Ga0070685_10304428 | 3300005466 | Bacteria | 1075 |
| 51 | Ga0070685_10354076 | 3300005466 | Bacteria | 1004 |
| 52 | Ga0070685_11095420 | 3300005466 | Bacteria | 602 |
| 53 | Ga0070685_11289161 | 3300005466 | Unclassified | 558 |
| 54 | Ga0070707_100044568 | 3300005468 | Bacteria | 4247 |
| 55 | Ga0070707_100205433 | 3300005468 | Bacteria | 1920 |
| 56 | Ga0070707_101171118 | 3300005468 | Bacteria | 735 |
| 57 | Ga0070698_100017147 | 3300005471 | Bacteria | 7635 |
| 58 | Ga0070698_100937734 | 3300005471 | Bacteria | 812 |
| 59 | Ga0070698_101257738 | 3300005471 | Bacteria | 690 |
| 60 | Ga0070699_100012833 | 3300005518 | Bacteria | 7223 |
| 61 | Ga0070699_100023354 | 3300005518 | Bacteria | 5326 |
| 62 | Ga0070679_100700874 | 3300005530 | Bacteria | 955 |
| 63 | Ga0070684_101251054 | 3300005535 | Bacteria | 698 |
| 64 | Ga0070697_100067371 | 3300005536 | Bacteria | 2928 |
| 65 | Ga0070697_100243871 | 3300005536 | Bacteria | 1535 |
| 66 | Ga0070672_100574245 | 3300005543 | Unclassified | 981 |
| 67 | Ga0070672_100630168 | 3300005543 | Bacteria | 935 |
| 68 | Ga0070672_101904922 | 3300005543 | Unclassified | 535 |
| 69 | Ga0070686_100416381 | 3300005544 | Bacteria | 1025 |
| 70 | Ga0070695_100228562 | 3300005545 | Bacteria | 1344 |
| 71 | Ga0070696_100018491 | 3300005546 | Bacteria | 4710 |
| 72 | Ga0070696_100059451 | 3300005546 | Bacteria | 2671 |
| 73 | Ga0070665_100380561 | 3300005548 | Bacteria | 1419 |
| 74 | Ga0070665_100612308 | 3300005548 | Bacteria | 1102 |
| 75 | Ga0070665_101562564 | 3300005548 | Unclassified | 668 |
| 76 | Ga0070665_101622290 | 3300005548 | Bacteria | 654 |
| 77 | Ga0070704_100004236 | 3300005549 | Bacteria | 8286 |
| 78 | Ga0070704_100110821 | 3300005549 | Bacteria | 2088 |
| 79 | Ga0070704_102232893 | 3300005549 | Bacteria | 509 |
| 80 | Ga0068855_101124613 | 3300005563 | Bacteria | 820 |
| 81 | Ga0070664_100473636 | 3300005564 | Bacteria | 1152 |
| 82 | Ga0070664_100603901 | 3300005564 | Unclassified | 1018 |
| 83 | Ga0070664_101232474 | 3300005564 | Bacteria | 706 |
| 84 | Ga0068857_100876570 | 3300005577 | Bacteria | 860 |
| 85 | Ga0068854_100154641 | 3300005578 | Bacteria | 1771 |
| 86 | Ga0068854_100268688 | 3300005578 | Bacteria | 1368 |
| 87 | Ga0068854_101915000 | 3300005578 | Unclassified | 545 |
| 88 | Ga0068856_100743086 | 3300005614 | Bacteria | 1001 |
| 89 | Ga0070702_100125864 | 3300005615 | Bacteria | 1611 |
| 90 | Ga0068852_100133733 | 3300005616 | Bacteria | 2287 |
| 91 | Ga0068859_100275861 | 3300005617 | Bacteria | 1774 |
| 92 | Ga0068864_100016021 | 3300005618 | Bacteria | 6236 |
| 93 | Ga0068864_101326415 | 3300005618 | Unclassified | 720 |
| 94 | Ga0068866_10708405 | 3300005718 | Unclassified | 691 |
| 95 | Ga0068861_100532297 | 3300005719 | Bacteria | 1067 |
| 96 | Ga0068861_100648166 | 3300005719 | Bacteria | 975 |
| 97 | Ga0068861_100720400 | 3300005719 | Bacteria | 929 |
| 98 | Ga0068851_10229131 | 3300005834 | Bacteria | 1047 |
| 99 | Ga0068870_10107884 | 3300005840 | Unclassified | 1585 |
| 100 | Ga0068863_100206299 | 3300005841 | Bacteria | 1891 |
| 101 | Ga0068863_100649164 | 3300005841 | Bacteria | 1046 |
| 102 | Ga0068858_100019359 | 3300005842 | Bacteria | 6365 |
| 103 | Ga0068858_100024433 | 3300005842 | Bacteria | 5630 |
| 104 | Ga0068858_100236670 | 3300005842 | Bacteria | 1732 |
| 105 | Ga0068862_100523016 | 3300005844 | Bacteria | 1129 |
| 106 | Ga0068862_100844700 | 3300005844 | Unclassified | 897 |
| 107 | Ga0068862_101861126 | 3300005844 | Unclassified | 611 |
| 108 | Ga0081539_10050084 | 3300005985 | Bacteria | 2365 |
| 109 | Ga0070717_10359416 | 3300006028 | Bacteria | 1303 |
| 110 | Ga0075368_10012191 | 3300006042 | Bacteria | 3139 |
| 111 | Ga0075368_10130153 | 3300006042 | Bacteria | 1046 |
| 112 | Ga0075368_10229476 | 3300006042 | Bacteria | 790 |
| 113 | Ga0075363_100037537 | 3300006048 | Bacteria | 2545 |
| 114 | Ga0075364_10001941 | 3300006051 | Bacteria | 11521 |
| 115 | Ga0075364_10061965 | 3300006051 | Bacteria | 2454 |
| 116 | Ga0075364_10111111 | 3300006051 | Bacteria | 1829 |
| 117 | Ga0075432_10434900 | 3300006058 | Bacteria | 573 |
| 118 | Ga0070716_101270408 | 3300006173 | Bacteria | 594 |
| 119 | Ga0075362_10001991 | 3300006177 | Bacteria | 6723 |
| 120 | Ga0075367_10010746 | 3300006178 | Bacteria | 4820 |
| 121 | Ga0075367_10080211 | 3300006178 | Bacteria | 1973 |
| 122 | Ga0075367_10235060 | 3300006178 | Bacteria | 1148 |
| 123 | Ga0075367_10324959 | 3300006178 | Unclassified | 970 |
| 124 | Ga0075369_10181022 | 3300006186 | Bacteria | 970 |
| 125 | Ga0075369_10259159 | 3300006186 | Bacteria | 808 |
| 126 | Ga0075366_10047206 | 3300006195 | Bacteria | 2553 |
| 127 | Ga0075366_10093145 | 3300006195 | Bacteria | 1806 |
| 128 | Ga0097621_100879523 | 3300006237 | Bacteria | 833 |
| 129 | Ga0068871_100173558 | 3300006358 | Bacteria | 1849 |
| 130 | Ga0068871_101466996 | 3300006358 | Bacteria | 644 |
| 131 | Ga0068871_101671544 | 3300006358 | Bacteria | 603 |
| 132 | Ga0075428_100031002 | 3300006844 | Bacteria | 5913 |
| 133 | Ga0075428_102235573 | 3300006844 | Archaea | 564 |
| 134 | Ga0075431_100098315 | 3300006847 | Bacteria | 3022 |
| 135 | Ga0075433_10076711 | 3300006852 | Unclassified | 2943 |
| 136 | Ga0075433_10801791 | 3300006852 | Bacteria | 823 |
| 137 | Ga0075434_100026639 | 3300006871 | Bacteria | 5666 |
| 138 | Ga0075434_100108884 | 3300006871 | Bacteria | 2781 |
| 139 | Ga0075434_100872466 | 3300006871 | Bacteria | 915 |
| 140 | Ga0075434_101013817 | 3300006871 | Bacteria | 844 |
| 141 | Ga0075429_100006683 | 3300006880 | Bacteria | 9999 |
| 142 | Ga0075429_101298911 | 3300006880 | Bacteria | 634 |
| 143 | Ga0068865_100076034 | 3300006881 | Bacteria | 2396 |
| 144 | Ga0068865_100247638 | 3300006881 | Unclassified | 1405 |
| 145 | Ga0068865_100811075 | 3300006881 | Bacteria | 808 |
| 146 | Ga0068865_101022531 | 3300006881 | Bacteria | 724 |
| 147 | Ga0075436_100271197 | 3300006914 | Bacteria | 1212 |
| 148 | Ga0097620_100275868 | 3300006931 | Bacteria | 1774 |
| 149 | Ga0075435_100028860 | 3300007076 | Bacteria | 4353 |
| 150 | Ga0075435_100848491 | 3300007076 | Bacteria | 796 |
| 151 | Ga0105251_10069657 | 3300009011 | Unclassified | 1639 |
| 152 | Ga0105251_10408681 | 3300009011 | Bacteria | 625 |
| 153 | Ga0111539_10002954 | 3300009094 | Bacteria | 22570 |
| 154 | Ga0111539_10135559 | 3300009094 | Bacteria | 2883 |
| 155 | Ga0111539_10280228 | 3300009094 | Bacteria | 1940 |
| 156 | Ga0111539_10528669 | 3300009094 | Bacteria | 1374 |
| 157 | Ga0111539_10734924 | 3300009094 | Bacteria | 1149 |
| 158 | Ga0105245_10370508 | 3300009098 | Bacteria | 1424 |
| 159 | Ga0105245_10775425 | 3300009098 | Bacteria | 996 |
| 160 | Ga0105245_12018998 | 3300009098 | Unclassified | 630 |
| 161 | Ga0105247_10013971 | 3300009101 | Bacteria | 4814 |
| 162 | Ga0105247_10069428 | 3300009101 | Bacteria | 2199 |
| 163 | Ga0105247_10365430 | 3300009101 | Unclassified | 1019 |
| 164 | Ga0105247_10931958 | 3300009101 | Unclassified | 673 |
| 165 | Ga0105247_11439158 | 3300009101 | Unclassified | 559 |
| 166 | Ga0114129_10008194 | 3300009147 | Bacteria | 14896 |
| 167 | Ga0114129_10023525 | 3300009147 | Bacteria | 8732 |
| 168 | Ga0114129_10027033 | 3300009147 | Bacteria | 8124 |
| 169 | Ga0114129_10031591 | 3300009147 | Bacteria | 7484 |
| 170 | Ga0105243_12009552 | 3300009148 | Bacteria | 612 |
| 171 | Ga0105243_12128827 | 3300009148 | Unclassified | 597 |
| 172 | Ga0105242_10631040 | 3300009176 | Unclassified | 1039 |
| 173 | Ga0105242_12556391 | 3300009176 | Unclassified | 559 |
| 174 | Ga0105248_10018478 | 3300009177 | Bacteria | 7705 |
| 175 | Ga0105248_10245254 | 3300009177 | Bacteria | 2017 |
| 176 | Ga0105248_10383986 | 3300009177 | Bacteria | 1581 |
| 177 | Ga0105248_11075766 | 3300009177 | Unclassified | 909 |
| 178 | Ga0105248_11510760 | 3300009177 | Unclassified | 760 |
| 179 | Ga0105248_11904450 | 3300009177 | Bacteria | 675 |
| 180 | Ga0105248_12249976 | 3300009177 | Bacteria | 620 |
| 181 | Ga0105237_10054639 | 3300009545 | Bacteria | 4002 |
| 182 | Ga0105237_10342864 | 3300009545 | Bacteria | 1498 |
| 183 | Ga0105238_10074364 | 3300009551 | Bacteria | 3391 |
| 184 | Ga0105238_11604062 | 3300009551 | Unclassified | 681 |
| 185 | Ga0105238_11938747 | 3300009551 | Bacteria | 622 |
| 186 | Ga0105249_10239261 | 3300009553 | Bacteria | 1794 |
| 187 | Ga0105249_12595475 | 3300009553 | Bacteria | 579 |
| 188 | Ga0105249_12989869 | 3300009553 | Unclassified | 543 |
| 189 | Ga0105246_10018878 | 3300011119 | Bacteria | 4397 |
| 190 | Ga0157374_11242550 | 3300013296 | Bacteria | 766 |
| 191 | Ga0157378_10253219 | 3300013297 | Bacteria | 1686 |
| 192 | Ga0163162_12330535 | 3300013306 | Unclassified | 615 |
| 193 | Ga0157375_10219574 | 3300013308 | Bacteria | 2059 |
| 194 | Ga0163163_10040143 | 3300014325 | Bacteria | 4569 |
| 195 | Ga0163163_10354864 | 3300014325 | Unclassified | 1523 |
| 196 | Ga0163163_11004280 | 3300014325 | Unclassified | 898 |
| 197 | Ga0163163_11106059 | 3300014325 | Bacteria | 855 |
| 198 | Ga0163163_11444702 | 3300014325 | Unclassified | 749 |
| 199 | Ga0157380_10006444 | 3300014326 | Bacteria | 8268 |
| 200 | Ga0157380_10135603 | 3300014326 | Bacteria | 2106 |
| 201 | Ga0157380_12266901 | 3300014326 | Unclassified | 607 |
| 202 | Ga0157379_10025954 | 3300014968 | Bacteria | 5210 |
| 203 | Ga0157379_10392864 | 3300014968 | Bacteria | 1274 |
| 204 | Ga0157379_12089554 | 3300014968 | Bacteria | 561 |
| 205 | Ga0157376_12891149 | 3300014969 | Unclassified | 520 |
| 206 | Ga0163161_10645174 | 3300017792 | Bacteria | 877 |
| 207 | Ga0213876_10132468 | 3300021384 | Bacteria | 1325 |
| 208 | Ga0207697_10000148 | 3300025315 | Bacteria | 34368 |
| 209 | Ga0207697_10286851 | 3300025315 | Unclassified | 730 |
| 210 | Ga0207697_10508098 | 3300025315 | Bacteria | 532 |
| 211 | Ga0207656_10072298 | 3300025321 | Bacteria | 1535 |
| 212 | Ga0207682_10067940 | 3300025893 | Bacteria | 1505 |
| 213 | Ga0207642_10540639 | 3300025899 | Unclassified | 718 |
| 214 | Ga0207710_10024652 | 3300025900 | Bacteria | 2592 |
| 215 | Ga0207710_10036749 | 3300025900 | Bacteria | 2160 |
| 216 | Ga0207688_10009342 | 3300025901 | Bacteria | 5346 |
| 217 | Ga0207688_10147553 | 3300025901 | Bacteria | 1387 |
| 218 | Ga0207688_10791568 | 3300025901 | Unclassified | 601 |
| 219 | Ga0207680_10181481 | 3300025903 | Unclassified | 1423 |
| 220 | Ga0207680_10422256 | 3300025903 | Bacteria | 944 |
| 221 | Ga0207680_10951180 | 3300025903 | Bacteria | 616 |
| 222 | Ga0207647_10454664 | 3300025904 | Bacteria | 717 |
| 223 | Ga0207645_10000577 | 3300025907 | Bacteria | 30396 |
| 224 | Ga0207645_10033216 | 3300025907 | Bacteria | 3317 |
| 225 | Ga0207645_10077506 | 3300025907 | Bacteria | 2130 |
| 226 | Ga0207645_10415030 | 3300025907 | Bacteria | 906 |
| 227 | Ga0207645_11036199 | 3300025907 | Unclassified | 555 |
| 228 | Ga0207643_10000648 | 3300025908 | Bacteria | 21726 |
| 229 | Ga0207643_10059927 | 3300025908 | Bacteria | 2172 |
| 230 | Ga0207643_10129251 | 3300025908 | Bacteria | 1502 |
| 231 | Ga0207643_10233651 | 3300025908 | Unclassified | 1128 |
| 232 | Ga0207684_10736513 | 3300025910 | Unclassified | 836 |
| 233 | Ga0207707_10037755 | 3300025912 | Bacteria | 4220 |
| 234 | Ga0207707_11437353 | 3300025912 | Bacteria | 549 |
| 235 | Ga0207671_10474490 | 3300025914 | Bacteria | 997 |
| 236 | Ga0207660_10270773 | 3300025917 | Unclassified | 1345 |
| 237 | Ga0207662_10016135 | 3300025918 | Bacteria | 4211 |
| 238 | Ga0207662_10039454 | 3300025918 | Bacteria | 2770 |
| 239 | Ga0207662_10289561 | 3300025918 | Unclassified | 1086 |
| 240 | Ga0207662_10513457 | 3300025918 | Unclassified | 826 |
| 241 | Ga0207662_10679038 | 3300025918 | Unclassified | 721 |
| 242 | Ga0207657_10054067 | 3300025919 | Bacteria | 3474 |
| 243 | Ga0207649_11444977 | 3300025920 | Unclassified | 544 |
| 244 | Ga0207652_11250928 | 3300025921 | Unclassified | 644 |
| 245 | Ga0207646_10039052 | 3300025922 | Bacteria | 4272 |
| 246 | Ga0207646_10277166 | 3300025922 | Bacteria | 1515 |
| 247 | Ga0207646_10565182 | 3300025922 | Bacteria | 1022 |
| 248 | Ga0207646_11845183 | 3300025922 | Bacteria | 516 |
| 249 | Ga0207681_10021283 | 3300025923 | Bacteria | 4120 |
| 250 | Ga0207694_10098919 | 3300025924 | Bacteria | 2310 |
| 251 | Ga0207694_10135800 | 3300025924 | Bacteria | 1975 |
| 252 | Ga0207650_10066421 | 3300025925 | Bacteria | 2704 |
| 253 | Ga0207650_10366080 | 3300025925 | Bacteria | 1188 |
| 254 | Ga0207650_10366660 | 3300025925 | Bacteria | 1187 |
| 255 | Ga0207659_10000969 | 3300025926 | Bacteria | 17135 |
| 256 | Ga0207659_10013177 | 3300025926 | Bacteria | 5290 |
| 257 | Ga0207659_10020573 | 3300025926 | Bacteria | 4364 |
| 258 | Ga0207659_10217004 | 3300025926 | Bacteria | 1536 |
| 259 | Ga0207659_10445192 | 3300025926 | Unclassified | 1090 |
| 260 | Ga0207687_10437261 | 3300025927 | Unclassified | 1083 |
| 261 | Ga0207687_11145869 | 3300025927 | Unclassified | 668 |
| 262 | Ga0207687_11797042 | 3300025927 | Bacteria | 525 |
| 263 | Ga0207700_10147134 | 3300025928 | Bacteria | 1943 |
| 264 | Ga0207644_10143347 | 3300025931 | Bacteria | 1842 |
| 265 | Ga0207644_10594397 | 3300025931 | Unclassified | 918 |
| 266 | Ga0207644_11070422 | 3300025931 | Unclassified | 677 |
| 267 | Ga0207690_10295895 | 3300025932 | Bacteria | 1265 |
| 268 | Ga0207690_10365520 | 3300025932 | Bacteria | 1144 |
| 269 | Ga0207690_11243710 | 3300025932 | Bacteria | 622 |
| 270 | Ga0207706_10009648 | 3300025933 | Bacteria | 8860 |
| 271 | Ga0207706_10525295 | 3300025933 | Unclassified | 1020 |
| 272 | Ga0207686_10335622 | 3300025934 | Bacteria | 1134 |
| 273 | Ga0207686_11337405 | 3300025934 | Unclassified | 589 |
| 274 | Ga0207709_10066821 | 3300025935 | Bacteria | 2266 |
| 275 | Ga0207670_10081470 | 3300025936 | Bacteria | 2265 |
| 276 | Ga0207670_10506912 | 3300025936 | Bacteria | 981 |
| 277 | Ga0207669_10017605 | 3300025937 | Bacteria | 3671 |
| 278 | Ga0207669_10343198 | 3300025937 | Bacteria | 1151 |
| 279 | Ga0207704_10052747 | 3300025938 | Bacteria | 2467 |
| 280 | Ga0207704_10399359 | 3300025938 | Unclassified | 1084 |
| 281 | Ga0207704_10504614 | 3300025938 | Unclassified | 975 |
| 282 | Ga0207704_10730925 | 3300025938 | Bacteria | 822 |
| 283 | Ga0207665_11014783 | 3300025939 | Bacteria | 660 |
| 284 | Ga0207691_10004463 | 3300025940 | Bacteria | 13556 |
| 285 | Ga0207691_10524208 | 3300025940 | Bacteria | 1005 |
| 286 | Ga0207691_10831513 | 3300025940 | Unclassified | 775 |
| 287 | Ga0207711_10033505 | 3300025941 | Bacteria | 4346 |
| 288 | Ga0207711_10629290 | 3300025941 | Bacteria | 1001 |
| 289 | Ga0207711_10687433 | 3300025941 | Bacteria | 954 |
| 290 | Ga0207711_10895376 | 3300025941 | Bacteria | 825 |
| 291 | Ga0207711_10927530 | 3300025941 | Bacteria | 809 |
| 292 | Ga0207689_10931492 | 3300025942 | Bacteria | 733 |
| 293 | Ga0207689_11751753 | 3300025942 | Unclassified | 514 |
| 294 | Ga0207661_10059988 | 3300025944 | Bacteria | 3067 |
| 295 | Ga0207661_11826589 | 3300025944 | Bacteria | 553 |
| 296 | Ga0207661_11861054 | 3300025944 | Unclassified | 547 |
| 297 | Ga0207679_10014873 | 3300025945 | Bacteria | 5127 |
| 298 | Ga0207679_10029985 | 3300025945 | Bacteria | 3794 |
| 299 | Ga0207679_10218972 | 3300025945 | Bacteria | 1601 |
| 300 | Ga0207679_11967363 | 3300025945 | Bacteria | 532 |
| 301 | Ga0207667_11773724 | 3300025949 | Unclassified | 582 |
| 302 | Ga0207651_10276934 | 3300025960 | Bacteria | 1384 |
| 303 | Ga0207651_10393270 | 3300025960 | Unclassified | 1177 |
| 304 | Ga0207712_10023764 | 3300025961 | Bacteria | 4050 |
| 305 | Ga0207712_10265835 | 3300025961 | Bacteria | 1393 |
| 306 | Ga0207668_10051544 | 3300025972 | Bacteria | 2843 |
| 307 | Ga0207640_11035291 | 3300025981 | Unclassified | 724 |
| 308 | Ga0207658_10386074 | 3300025986 | Bacteria | 1227 |
| 309 | Ga0207658_10828339 | 3300025986 | Bacteria | 841 |
| 310 | Ga0207658_11086802 | 3300025986 | Unclassified | 730 |
| 311 | Ga0207677_10148956 | 3300026023 | Bacteria | 1803 |
| 312 | Ga0207677_10945389 | 3300026023 | Bacteria | 779 |
| 313 | Ga0207703_10071228 | 3300026035 | Bacteria | 2871 |
| 314 | Ga0207703_10467702 | 3300026035 | Bacteria | 1180 |
| 315 | Ga0207639_10958450 | 3300026041 | Bacteria | 801 |
| 316 | Ga0207678_10044540 | 3300026067 | Bacteria | 3838 |
| 317 | Ga0207708_10008793 | 3300026075 | Bacteria | 7474 |
| 318 | Ga0207708_10012183 | 3300026075 | Bacteria | 6415 |
| 319 | Ga0207708_10348233 | 3300026075 | Bacteria | 1215 |
| 320 | Ga0207641_10017355 | 3300026088 | Bacteria | 5892 |
| 321 | Ga0207641_10271397 | 3300026088 | Bacteria | 1592 |
| 322 | Ga0207641_10556087 | 3300026088 | Unclassified | 1119 |
| 323 | Ga0207641_10654874 | 3300026088 | Bacteria | 1032 |
| 324 | Ga0207641_10902678 | 3300026088 | Bacteria | 877 |
| 325 | Ga0207641_10911763 | 3300026088 | Unclassified | 873 |
| 326 | Ga0207648_10054986 | 3300026089 | Bacteria | 3475 |
| 327 | Ga0207648_10078893 | 3300026089 | Bacteria | 2873 |
| 328 | Ga0207648_10205123 | 3300026089 | Bacteria | 1749 |
| 329 | Ga0207648_10330619 | 3300026089 | Bacteria | 1371 |
| 330 | Ga0207648_10607562 | 3300026089 | Bacteria | 1008 |
| 331 | Ga0207676_10022493 | 3300026095 | Bacteria | 4637 |
| 332 | Ga0207676_10042789 | 3300026095 | Bacteria | 3484 |
| 333 | Ga0207676_10233286 | 3300026095 | Unclassified | 1646 |
| 334 | Ga0207676_10901037 | 3300026095 | Bacteria | 867 |
| 335 | Ga0207676_11074361 | 3300026095 | Bacteria | 795 |
| 336 | Ga0207674_10083334 | 3300026116 | Bacteria | 3197 |
| 337 | Ga0207674_10417021 | 3300026116 | Bacteria | 1297 |
| 338 | Ga0207674_11078496 | 3300026116 | Bacteria | 772 |
| 339 | Ga0207674_11492021 | 3300026116 | Bacteria | 645 |
| 340 | Ga0207675_100002044 | 3300026118 | Bacteria | 20130 |
| 341 | Ga0207675_100255612 | 3300026118 | Bacteria | 1697 |
| 342 | Ga0207683_10407442 | 3300026121 | Bacteria | 1251 |
| 343 | Ga0207698_10397913 | 3300026142 | Bacteria | 1315 |
| 344 | Ga0207698_10645430 | 3300026142 | Bacteria | 1048 |
| 345 | Ga0209971_1153740 | 3300027682 | Bacteria | 568 |
| 346 | Ga0209813_10027373 | 3300027866 | Bacteria | 1655 |
| 347 | Ga0207428_10007408 | 3300027907 | Bacteria | 10004 |
| 348 | Ga0207428_10454617 | 3300027907 | Unclassified | 933 |
| 349 | Ga0268266_10128322 | 3300028379 | Bacteria | 2266 |
| 350 | Ga0268266_10266432 | 3300028379 | Bacteria | 1589 |
| 351 | Ga0268266_10787131 | 3300028379 | Bacteria | 918 |
| 352 | Ga0268266_11294709 | 3300028379 | Bacteria | 704 |
| 353 | Ga0268265_10097703 | 3300028380 | Bacteria | 2363 |
| 354 | Ga0268265_10234864 | 3300028380 | Bacteria | 1614 |
| 355 | Ga0268265_10334847 | 3300028380 | Bacteria | 1376 |
| 356 | Ga0268265_10437572 | 3300028380 | Bacteria | 1218 |
| 357 | Ga0268265_10487426 | 3300028380 | Bacteria | 1159 |
| 358 | Ga0268265_11682582 | 3300028380 | Bacteria | 640 |
| 359 | Ga0268264_10467874 | 3300028381 | Bacteria | 1224 |
| 360 | Ga0268264_10490633 | 3300028381 | Bacteria | 1196 |
| 361 | Ga0268264_10886228 | 3300028381 | Bacteria | 895 |
| 362 | Ga0268264_11186894 | 3300028381 | Bacteria | 772 |
| 363 | Ga0268264_11772098 | 3300028381 | Unclassified | 628 |
| 364 | Ga0268264_12659005 | 3300028381 | Unclassified | 505 |
| 365 | Ga0307405_10040508 | 3300031731 | Bacteria | 2822 |
| 366 | Ga0307405_10328688 | 3300031731 | Bacteria | 1171 |
| 367 | Ga0307413_10312993 | 3300031824 | Bacteria | 1196 |
| 368 | Ga0307413_10374377 | 3300031824 | Bacteria | 1107 |
| 369 | Ga0307413_12123355 | 3300031824 | Unclassified | 508 |
| 370 | Ga0307406_10704735 | 3300031901 | Bacteria | 843 |
| 371 | Ga0307407_10014361 | 3300031903 | Bacteria | 3876 |
| 372 | Ga0307407_10782095 | 3300031903 | Bacteria | 725 |
| 373 | Ga0307407_11105397 | 3300031903 | Unclassified | 616 |
| 374 | Ga0307412_10293359 | 3300031911 | Bacteria | 1282 |
| 375 | Ga0307412_11154482 | 3300031911 | Bacteria | 692 |
| 376 | Ga0307409_100283138 | 3300031995 | Bacteria | 1533 |
| 377 | Ga0307409_101163208 | 3300031995 | Bacteria | 794 |
| 378 | Ga0307416_100023618 | 3300032002 | Bacteria | 4466 |
| 379 | Ga0307416_100764604 | 3300032002 | Bacteria | 1060 |
| 380 | Ga0307416_100938285 | 3300032002 | Bacteria | 967 |
| 381 | Ga0307416_102965719 | 3300032002 | Unclassified | 568 |
| 382 | Ga0307416_103503215 | 3300032002 | Unclassified | 525 |
| 383 | Ga0307414_10071933 | 3300032004 | Bacteria | 2497 |
| 384 | Ga0307414_10552870 | 3300032004 | Bacteria | 1026 |
| 385 | Ga0307414_11408706 | 3300032004 | Bacteria | 648 |
| 386 | Ga0307411_10048909 | 3300032005 | Bacteria | 2744 |
| 387 | Ga0373948_0077899 | 3300034817 | Bacteria | 753 |
| 388 | Ga0373958_0012965 | 3300034819 | Bacteria | 1435 |
| 389 | Ga0373929_0169242 | 3300035085 | Bacteria | 596 |
| 390 | Ga0373934_0084503 | 3300035086 | Bacteria | 1277 |
| 391 | Ga0373940_0296758 | 3300035088 | Bacteria | 555 |
| 392 | Ga0373949_0085729 | 3300035090 | Bacteria | 845 |
| 393 | Ga0373952_0082384 | 3300035092 | Bacteria | 823 |
| 394 | Ga0373932_0034344 | 3300035112 | Bacteria | 1428 |
| 395 | Ga0373939_0037499 | 3300035114 | Bacteria | 1440 |
| 396 | Ga0373953_0089015 | 3300035117 | Bacteria | 1290 |
| 397 | Ga0373960_0281323 | 3300035121 | Bacteria | 613 |
| 398 | Ga0373960_0323829 | 3300035121 | Bacteria | 578 |
| 399 | Ga0373943_0953318 | 3300035170 | Unclassified | 514 |
| 400 | Ga0373955_0357664 | 3300035172 | Unclassified | 885 |
| 401 | Ga0373955_0569201 | 3300035172 | Unclassified | 693 |
| 402 | Ga0373942_0382880 | 3300035207 | Bacteria | 502 |
| 403 | Ga0373962_0120075 | 3300035242 | Bacteria | 837 |
| 404 | Ga0373924_0056817 | 3300035410 | Bacteria | 1631 |
| 405 | Ga0373931_0938970 | 3300035691 | Bacteria | 583 |
| 406 | Ga0373935_1141165 | 3300035692 | Unclassified | 580 |
| 407 | Ga0373933_0418401 | 3300035724 | Bacteria | 875 |
| 408 | Ga0373947_0195020 | 3300035725 | Unclassified | 1323 |
| 409 | Ga0373937_0009015 | 3300036401 | Bacteria | 8660 |
| 410 | Ga0373937_0138875 | 3300036401 | Bacteria | 2273 |
| 411 | Ga0373937_0387114 | 3300036401 | Bacteria | 1326 |
| 412 | Ga0373925_1597290 | 3300037068 | Unclassified | 533 |
| 413 | Ga0395900_0200613 | 3300037418 | Bacteria | 2019 |
| 414 | Ga0395901_0944907 | 3300038443 | Bacteria | 841 |
| 415 | Ga0436365_1525786 | 3300039437 | Bacteria | 1296 |
| 416 | Ga0436365_1546745 | 3300039437 | Unclassified | 624 |
| 417 | Ga0439439_0148137 | 3300041406 | Bacteria | 665 |
| 418 | Ga0439439_0276356 | 3300041406 | Bacteria | 502 |
| 419 | Ga0439453_0042870 | 3300041408 | Bacteria | 893 |
| 420 | Ga0439461_0183755 | 3300041410 | Bacteria | 555 |
| 421 | Ga0451787_475156 | 3300041441 | Bacteria | 627 |
| 422 | Ga0451798_0729637 | 3300041458 | Bacteria | 754 |
| 423 | Ga0451849_0714227 | 3300041505 | Bacteria | 552 |
| 424 | Ga0451853_0161368 | 3300041512 | Bacteria | 650 |
| 425 | Ga0451853_0346861 | 3300041512 | Unclassified | 746 |
| 426 | Ga0451853_0530934 | 3300041512 | Bacteria | 528 |
| 427 | Ga0439431_0012921 | 3300041997 | Bacteria | 1923 |
| 428 | Ga0439433_0019429 | 3300041999 | Bacteria | 1514 |
| 429 | Ga0439433_0048069 | 3300041999 | Bacteria | 1002 |
| 430 | Ga0439449_0021085 | 3300042007 | Bacteria | 2439 |
| 431 | Ga0439457_051057 | 3300042014 | Bacteria | 929 |
| 432 | Ga0450888_026221 | 3300042126 | Bacteria | 764 |
| 433 | Ga0450898_088715 | 3300042134 | Bacteria | 636 |
| 434 | Ga0450898_137686 | 3300042134 | Unclassified | 529 |
| 435 | Ga0439446_0012405 | 3300042156 | Bacteria | 2327 |
| 436 | Ga0439446_0275066 | 3300042156 | Unclassified | 586 |
| 437 | Ga0439435_0074908 | 3300042436 | Bacteria | 1007 |
| 438 | Ga0439464_0058306 | 3300042439 | Bacteria | 1127 |
| 439 | Ga0439460_0027246 | 3300042461 | Bacteria | 1604 |
| 440 | Ga0450916_094375 | 3300042530 | Bacteria | 524 |
| 441 | Ga0451577_1017653 | 3300042876 | Bacteria | 744 |
| 442 | Ga0466972_0526516 | 3300044658 | Bacteria | 557 |
| 443 | Ga0453683_0325763 | 3300044673 | Bacteria | 985 |
| 444 | Ga0451576_0245552 | 3300045051 | Bacteria | 1871 |
| 445 | Ga0451576_0527542 | 3300045051 | Bacteria | 1240 |
| 446 | Ga0451576_1570429 | 3300045051 | Unclassified | 683 |
| 447 | Ga0495592_0036800 | 3300046454 | Bacteria | 3685 |
| 448 | Ga0495629_0087337 | 3300046459 | Bacteria | 2176 |
| 449 | Ga0495580_0021601 | 3300046472 | Bacteria | 4746 |
| 450 | Ga0495582_0814597 | 3300046473 | Bacteria | 540 |
| 451 | Ga0495594_0347838 | 3300046499 | Bacteria | 844 |
| 452 | Ga0495608_0621883 | 3300046511 | Bacteria | 647 |
| 453 | Ga0495628_0082641 | 3300046516 | Bacteria | 2495 |
| 454 | Ga0495630_0396827 | 3300046517 | Bacteria | 1057 |
| 455 | Ga0495652_0358876 | 3300046529 | Bacteria | 1042 |
| 456 | Ga0495598_0051538 | 3300046537 | Bacteria | 1241 |
| 457 | Ga0495645_0208714 | 3300046543 | Bacteria | 1320 |
| 458 | Ga0495667_0298389 | 3300046559 | Bacteria | 1021 |
| 459 | Ga0495659_0010010 | 3300046664 | Bacteria | 3035 |
| 460 | Ga0495659_0012078 | 3300046664 | Bacteria | 2791 |
| 461 | Ga0495588_0597731 | 3300046674 | Unclassified | 578 |
| 462 | Ga0495657_0237651 | 3300046675 | Unclassified | 1100 |
| 463 | Ga0495599_0016096 | 3300046678 | Bacteria | 4641 |
| 464 | Ga0495623_0080316 | 3300046679 | Bacteria | 2019 |
| 465 | Ga0495623_0399474 | 3300046679 | Bacteria | 740 |
| 466 | Ga0495647_0008034 | 3300046681 | Bacteria | 3545 |
| 467 | Ga0495658_0203869 | 3300046683 | Bacteria | 1234 |
| 468 | Ga0495636_0619271 | 3300047318 | Unclassified | 530 |
| 469 | Ga0495684_0053071 | 3300047471 | Bacteria | 3093 |
| 470 | Ga0495684_0423050 | 3300047471 | Bacteria | 931 |
| 471 | Ga0495602_0193269 | 3300048088 | Unclassified | 1558 |
| 472 | Ga0495614_0425816 | 3300048089 | Unclassified | 626 |
| 473 | Ga0496102_0283069 | 3300048905 | Unclassified | 1563 |
| 474 | Ga0496104_0071451 | 3300048907 | Bacteria | 3300 |
| 475 | Ga0496104_0090082 | 3300048907 | Bacteria | 2931 |
| 476 | Ga0496105_0321925 | 3300048908 | Bacteria | 1239 |
| 477 | Ga0496105_1105393 | 3300048908 | Unclassified | 588 |
| 478 | Ga0496106_0313017 | 3300048909 | Bacteria | 1260 |
| 479 | Ga0496106_1047169 | 3300048909 | Bacteria | 641 |
| 480 | Ga0496107_0756616 | 3300048910 | Unclassified | 713 |
| 481 | Ga0496108_0012146 | 3300048911 | Bacteria | 7003 |
| 482 | Ga0496108_0126536 | 3300048911 | Bacteria | 2194 |
| 483 | Ga0496108_0156640 | 3300048911 | Bacteria | 1967 |
| 484 | Ga0496108_1424181 | 3300048911 | Bacteria | 579 |
| 485 | Ga0496109_0228518 | 3300048912 | Bacteria | 1750 |
| 486 | Ga0496109_0412776 | 3300048912 | Bacteria | 1276 |
| 487 | Ga0496109_0912318 | 3300048912 | Bacteria | 816 |
| 488 | Ga0496110_0065394 | 3300048913 | Bacteria | 3215 |
| 489 | Ga0496110_0126111 | 3300048913 | Bacteria | 2310 |
| 490 | Ga0496110_0213981 | 3300048913 | Bacteria | 1752 |
| 491 | Ga0496112_0123167 | 3300048915 | Bacteria | 2563 |
| 492 | Ga0496112_0173703 | 3300048915 | Bacteria | 2120 |
| 493 | Ga0496113_0014422 | 3300048916 | Bacteria | 5391 |
| 494 | Ga0496113_0583909 | 3300048916 | Bacteria | 895 |
| 495 | Ga0496113_0688483 | 3300048916 | Bacteria | 816 |
| 496 | Ga0496113_1468114 | 3300048916 | Bacteria | 527 |
| 497 | Ga0496114_0287977 | 3300048917 | Bacteria | 1449 |
| 498 | Ga0496114_0348063 | 3300048917 | Bacteria | 1310 |
| 499 | Ga0496114_0713048 | 3300048917 | Unclassified | 879 |
| 500 | Ga0496114_1107393 | 3300048917 | Unclassified | 677 |
| 501 | Ga0496115_0561557 | 3300048918 | Bacteria | 911 |
| 502 | Ga0501031_0010734 | 3300049568 | Bacteria | 5967 |
| 503 | Ga0501031_0101150 | 3300049568 | Bacteria | 1881 |
| 504 | Ga0501031_1068027 | 3300049568 | Unclassified | 515 |
| 505 | Ga0501032_0006127 | 3300049569 | Bacteria | 8858 |
| 506 | Ga0501032_0046755 | 3300049569 | Bacteria | 2924 |
| 507 | Ga0501032_0127552 | 3300049569 | Unclassified | 1680 |
| 508 | Ga0501033_0075147 | 3300049570 | Bacteria | 2480 |
| 509 | Ga0501033_0090264 | 3300049570 | Bacteria | 2241 |
| 510 | Ga0501034_0004095 | 3300049571 | Bacteria | 16360 |
| 511 | Ga0501034_0053918 | 3300049571 | Bacteria | 4048 |
| 512 | Ga0501034_0073863 | 3300049571 | Bacteria | 3418 |
| 513 | Ga0501034_0240966 | 3300049571 | Bacteria | 1754 |
| 514 | Ga0501036_0001297 | 3300049572 | Bacteria | 19150 |
| 515 | Ga0501036_0021599 | 3300049572 | Bacteria | 5411 |
| 516 | Ga0501036_0021831 | 3300049572 | Bacteria | 5383 |
| 517 | Ga0501036_0025319 | 3300049572 | Bacteria | 5006 |
| 518 | Ga0501036_1362232 | 3300049572 | Bacteria | 576 |
| 519 | Ga0501037_0006772 | 3300049573 | Bacteria | 8375 |
| 520 | Ga0501037_0120019 | 3300049573 | Bacteria | 1891 |
| 521 | Ga0501038_0002744 | 3300049574 | Bacteria | 16406 |
| 522 | Ga0501038_0007347 | 3300049574 | Bacteria | 10165 |
| 523 | Ga0501038_0013119 | 3300049574 | Bacteria | 7557 |
| 524 | Ga0501038_0394075 | 3300049574 | Bacteria | 1072 |
| 525 | Ga0501038_0440230 | 3300049574 | Bacteria | 1003 |
| 526 | Ga0501039_0009837 | 3300049575 | Bacteria | 7289 |
| 527 | Ga0501039_0023300 | 3300049575 | Bacteria | 4753 |
| 528 | Ga0501039_0031316 | 3300049575 | Bacteria | 4100 |
| 529 | Ga0501039_0037521 | 3300049575 | Bacteria | 3740 |
| 530 | Ga0501039_0089225 | 3300049575 | Bacteria | 2403 |
| 531 | Ga0501039_0836030 | 3300049575 | Bacteria | 718 |
| 532 | Ga0501040_0143342 | 3300049576 | Bacteria | 1683 |
| 533 | Ga0501040_0361474 | 3300049576 | Bacteria | 1040 |
| 534 | Ga0501041_0007208 | 3300049577 | Bacteria | 6526 |
| 535 | Ga0501041_0143166 | 3300049577 | Bacteria | 1491 |
| 536 | Ga0501041_0936965 | 3300049577 | Bacteria | 557 |
| 537 | Ga0501042_0000551 | 3300049578 | Bacteria | 19742 |
| 538 | Ga0501042_0007620 | 3300049578 | Bacteria | 7103 |
| 539 | Ga0501042_0110386 | 3300049578 | Bacteria | 1981 |
| 540 | Ga0501042_0409899 | 3300049578 | Bacteria | 982 |
| 541 | Ga0501042_0574807 | 3300049578 | Bacteria | 819 |
| 542 | Ga0501043_0004734 | 3300049579 | Bacteria | 11037 |
| 543 | Ga0501043_0007098 | 3300049579 | Bacteria | 8914 |
| 544 | Ga0501043_0015625 | 3300049579 | Bacteria | 5952 |
| 545 | Ga0501043_0017348 | 3300049579 | Bacteria | 5646 |
| 546 | Ga0501046_0003264 | 3300049580 | Bacteria | 14889 |
| 547 | Ga0501046_0006325 | 3300049580 | Bacteria | 10496 |
| 548 | Ga0501046_0009274 | 3300049580 | Bacteria | 8519 |
| 549 | Ga0501047_0001697 | 3300049581 | Bacteria | 21408 |
| 550 | Ga0501047_0062272 | 3300049581 | Bacteria | 3598 |
| 551 | Ga0501047_0173064 | 3300049581 | Bacteria | 2028 |
| 552 | Ga0501047_0194194 | 3300049581 | Bacteria | 1892 |
| 553 | Ga0501047_0407709 | 3300049581 | Unclassified | 1192 |
| 554 | Ga0501047_0620094 | 3300049581 | Unclassified | 902 |
| 555 | Ga0501048_0002137 | 3300049582 | Bacteria | 15063 |
| 556 | Ga0501048_0009187 | 3300049582 | Bacteria | 7430 |
| 557 | Ga0501048_0013999 | 3300049582 | Bacteria | 5947 |
| 558 | Ga0501048_0041817 | 3300049582 | Bacteria | 3283 |
| 559 | Ga0501048_1144200 | 3300049582 | Archaea | 560 |
| 560 | Ga0501067_0008841 | 3300049583 | Bacteria | 5580 |
| 561 | Ga0501067_0075797 | 3300049583 | Bacteria | 1863 |
| 562 | Ga0501068_0002325 | 3300049584 | Bacteria | 10131 |
| 563 | Ga0501068_0014050 | 3300049584 | Bacteria | 4570 |
| 564 | Ga0501068_0016131 | 3300049584 | Bacteria | 4302 |
| 565 | Ga0501068_0693967 | 3300049584 | Bacteria | 666 |
| 566 | Ga0501068_1089672 | 3300049584 | Bacteria | 528 |
| 567 | Ga0501069_0001824 | 3300049585 | Bacteria | 10622 |
| 568 | Ga0501069_0122538 | 3300049585 | Bacteria | 1485 |
| 569 | Ga0501069_0522413 | 3300049585 | Unclassified | 709 |
| 570 | Ga0501069_0839417 | 3300049585 | Bacteria | 558 |
| 571 | Ga0501070_0008436 | 3300049586 | Bacteria | 8702 |
| 572 | Ga0501070_0145492 | 3300049586 | Bacteria | 1956 |
| 573 | Ga0501070_0815349 | 3300049586 | Unclassified | 732 |
| 574 | Ga0501071_0004390 | 3300049587 | Bacteria | 8947 |
| 575 | Ga0501071_0037994 | 3300049587 | Bacteria | 3439 |
| 576 | Ga0501071_0077378 | 3300049587 | Bacteria | 2430 |
| 577 | Ga0501072_0034947 | 3300049588 | Bacteria | 3939 |
| 578 | Ga0501072_0122922 | 3300049588 | Bacteria | 2068 |
| 579 | Ga0501072_0435929 | 3300049588 | Bacteria | 1038 |
| 580 | Ga0501072_0740290 | 3300049588 | Unclassified | 772 |
| 581 | Ga0501073_0000980 | 3300049589 | Bacteria | 20567 |
| 582 | Ga0501073_0003336 | 3300049589 | Bacteria | 12066 |
| 583 | Ga0501073_0064008 | 3300049589 | Bacteria | 2564 |
| 584 | Ga0501073_0367563 | 3300049589 | Unclassified | 994 |
| 585 | Ga0501074_0032568 | 3300049590 | Bacteria | 3775 |
| 586 | Ga0501074_0057417 | 3300049590 | Bacteria | 2804 |
| 587 | Ga0501074_0333303 | 3300049590 | Bacteria | 1077 |
| 588 | Ga0501075_0000631 | 3300049591 | Bacteria | 21544 |
| 589 | Ga0501075_0040428 | 3300049591 | Bacteria | 3492 |
| 590 | Ga0501075_0187463 | 3300049591 | Bacteria | 1578 |
| 591 | Ga0501075_0573496 | 3300049591 | Bacteria | 861 |
| 592 | Ga0501075_1185766 | 3300049591 | Bacteria | 579 |
| 593 | Ga0501076_0049061 | 3300049592 | Bacteria | 3337 |
| 594 | Ga0501076_0077285 | 3300049592 | Bacteria | 2671 |
| 595 | Ga0501076_0197595 | 3300049592 | Bacteria | 1642 |
| 596 | Ga0501076_1752817 | 3300049592 | Bacteria | 509 |
| 597 | Ga0501077_0120813 | 3300049593 | Bacteria | 1660 |
| 598 | Ga0501202_109058 | 3300049652 | Bacteria | 683 |
| 599 | Ga0501211_033779 | 3300049658 | Bacteria | 587 |
| 600 | Ga0501079_0000894 | 3300049741 | Bacteria | 20415 |
| 601 | Ga0501079_0032000 | 3300049741 | Bacteria | 4042 |
| 602 | Ga0501079_0570131 | 3300049741 | Bacteria | 890 |
| 603 | Ga0501080_0000066 | 3300049742 | Bacteria | 68980 |
| 604 | Ga0501080_0017477 | 3300049742 | Bacteria | 6633 |
| 605 | Ga0501080_0130279 | 3300049742 | Bacteria | 2328 |
| 606 | Ga0501080_0237718 | 3300049742 | Bacteria | 1663 |
| 607 | Ga0501080_0272207 | 3300049742 | Bacteria | 1541 |
| 608 | Ga0501080_0456202 | 3300049742 | Bacteria | 1145 |
| 609 | Ga0501080_1686522 | 3300049742 | Unclassified | 535 |
| 610 | Ga0501080_1746188 | 3300049742 | Bacteria | 524 |
| 611 | Ga0501081_0006698 | 3300049743 | Bacteria | 7488 |
| 612 | Ga0501081_0170823 | 3300049743 | Bacteria | 1570 |
| 613 | Ga0501081_0394786 | 3300049743 | Bacteria | 1024 |
| 614 | Ga0501083_0016724 | 3300049744 | Bacteria | 5125 |
| 615 | Ga0501083_0035172 | 3300049744 | Bacteria | 3423 |
| 616 | Ga0501083_0231638 | 3300049744 | Bacteria | 1203 |
| 617 | Ga0501083_0276586 | 3300049744 | Bacteria | 1092 |
| 618 | Ga0501083_0340084 | 3300049744 | Bacteria | 976 |
| 619 | Ga0501035_0015652 | 3300049822 | Bacteria | 7000 |
| 620 | Ga0501035_0095354 | 3300049822 | Bacteria | 2615 |
| 621 | Ga0501035_0099008 | 3300049822 | Bacteria | 2560 |
| 622 | Ga0501035_0155267 | 3300049822 | Bacteria | 1984 |
| 623 | Ga0501035_1285766 | 3300049822 | Bacteria | 564 |
| 624 | Ga0501044_0003120 | 3300049823 | Bacteria | 18780 |
| 625 | Ga0501044_0149288 | 3300049823 | Bacteria | 2320 |
| 626 | Ga0501045_0005627 | 3300049824 | Bacteria | 8676 |
| 627 | Ga0501045_0018769 | 3300049824 | Bacteria | 4923 |
| 628 | Ga0501045_0068448 | 3300049824 | Bacteria | 2608 |
| 629 | Ga0501045_0504729 | 3300049824 | Bacteria | 898 |
| 630 | nmdc:mga03683_3512_c1 | 3300050489 | Bacteria | 5074 |
| 631 | nmdc:mga03n38_37389_c1 | 3300050490 | Bacteria | 2093 |
| 632 | nmdc:mga03n38_381621_c1 | 3300050490 | Unclassified | 772 |
| 633 | nmdc:mga00v17_1057941_c1 | 3300050491 | Unclassified | 509 |
| 634 | nmdc:mga00v17_22107_c1 | 3300050491 | Bacteria | 3666 |
| 635 | nmdc:mga00v17_25358_c1 | 3300050491 | Bacteria | 3446 |
| 636 | nmdc:mga00v17_258373_c1 | 3300050491 | Bacteria | 1130 |
| 637 | nmdc:mga0yw44_1130346_c1 | 3300050492 | Bacteria | 529 |
| 638 | nmdc:mga0k408_57475_c1 | 3300050493 | Bacteria | 2258 |
| 639 | nmdc:mga0k408_62603_c1 | 3300050493 | Bacteria | 2164 |
| 640 | nmdc:mga06z11_11344_c1 | 3300050494 | Bacteria | 3840 |
| 641 | nmdc:mga06z11_12831_c1 | 3300050494 | Bacteria | 3656 |
| 642 | nmdc:mga06z11_504650_c1 | 3300050494 | Bacteria | 733 |
| 643 | nmdc:mga06z11_525214_c1 | 3300050494 | Unclassified | 718 |
| 644 | nmdc:mga04h51_12269_c1 | 3300050495 | Bacteria | 2401 |
| 645 | nmdc:mga04h51_58576_c1 | 3300050495 | Bacteria | 1314 |
| 646 | nmdc:mga05p37_28413_c1 | 3300050507 | Bacteria | 6820 |
| 647 | nmdc:mga05p37_46442_c1 | 3300050507 | Bacteria | 5340 |
| 648 | nmdc:mga05p37_866386_c1 | 3300050507 | Bacteria | 979 |
| 649 | nmdc:mga05p37_94207_c1 | 3300050507 | Bacteria | 3690 |
| 650 | nmdc:mga09592_21965_c1 | 3300050508 | Bacteria | 5264 |
| 651 | nmdc:mga09592_33805_c1 | 3300050508 | Bacteria | 4271 |
| 652 | nmdc:mga0qj67_1159618_c1 | 3300050509 | Bacteria | 602 |
| 653 | nmdc:mga0qj67_127923_c1 | 3300050509 | Bacteria | 2056 |
| 654 | nmdc:mga0qj67_798897_c1 | 3300050509 | Bacteria | 747 |
| 655 | nmdc:mga06r32_11939_c1 | 3300050510 | Bacteria | 7828 |
| 656 | nmdc:mga06r32_182296_c1 | 3300050510 | Bacteria | 2085 |
| 657 | nmdc:mga06r32_522658_c1 | 3300050510 | Bacteria | 1162 |
| 658 | nmdc:mga08y16_118896_c1 | 3300050511 | Bacteria | 2751 |
| 659 | nmdc:mga08y16_2554_c1 | 3300050511 | Bacteria | 18718 |
| 660 | nmdc:mga08y16_62014_c1 | 3300050511 | Bacteria | 3904 |
| 661 | nmdc:mga08y16_751310_c1 | 3300050511 | Unclassified | 971 |
| 662 | nmdc:mga08y16_758913_c1 | 3300050511 | Unclassified | 966 |
| 663 | nmdc:mga08y16_878093_c1 | 3300050511 | Bacteria | 884 |
| 664 | nmdc:mga0n895_1112729_c1 | 3300050512 | Bacteria | 767 |
| 665 | nmdc:mga0n895_187087_c1 | 3300050512 | Bacteria | 2102 |
| 666 | nmdc:mga0n895_295497_c1 | 3300050512 | Bacteria | 1642 |
| 667 | nmdc:mga0n895_95358_c1 | 3300050512 | Bacteria | 2980 |
| 668 | nmdc:mga0rr50_130182_c1 | 3300050513 | Unclassified | 2014 |
| 669 | nmdc:mga0rr50_225036_c1 | 3300050513 | Bacteria | 1550 |
| 670 | nmdc:mga0rr50_423103_c1 | 3300050513 | Bacteria | 1127 |
| 671 | nmdc:mga0a205_14932_c1 | 3300050515 | Bacteria | 7247 |
| 672 | nmdc:mga0a205_32867_c1 | 3300050515 | Bacteria | 4975 |
| 673 | nmdc:mga0a205_519314_c1 | 3300050515 | Bacteria | 1047 |
| 674 | nmdc:mga0sz30_456401_c1 | 3300050516 | Unclassified | 574 |
| 675 | nmdc:mga0sz30_61594_c1 | 3300050516 | Bacteria | 1603 |
| 676 | Ga0500568_0005285 | 3300053139 | Bacteria | 6709 |
| 677 | Ga0501084_0013018 | 3300054114 | Bacteria | 6883 |
| 678 | Ga0501084_0115989 | 3300054114 | Bacteria | 2251 |
| 679 | Ga0501084_0478743 | 3300054114 | Unclassified | 1052 |
| 680 | Ga0501084_0614204 | 3300054114 | Bacteria | 918 |
| 681 | Ga0501084_1269550 | 3300054114 | Bacteria | 617 |
| 682 | Ga0590077_158612 | 3300059426 | Unclassified | 543 |
| 683 | Ga0501082_0002081 | 3300060353 | Bacteria | 17626 |
| 684 | Ga0501082_0004370 | 3300060353 | Bacteria | 12353 |
| 685 | Ga0501082_0004569 | 3300060353 | Bacteria | 12085 |
| 686 | Ga0501082_0254868 | 3300060353 | Bacteria | 1526 |
| 687 | Ga0501082_0345443 | 3300060353 | Bacteria | 1297 |
| 688 | Ga0501082_0740998 | 3300060353 | Unclassified | 860 |
| 689 | Ga0501082_0853626 | 3300060353 | Bacteria | 796 |
| 690 | Ga0530510_0000823 | 3300061734 | Bacteria | 20345 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046681 | Ga0495647_0008034 | Ga0495647_0008034_3144_3368 | 74 |
| 2 | 3300005340 | Ga0070689_101384246 | Ga0070689_1013842462 | 76 |
| 3 | 3300005459 | Ga0068867_101471985 | Ga0068867_1014719851 | 76 |
| 4 | 3300005578 | Ga0068854_100154641 | Ga0068854_1001546412 | 76 |
| 5 | 3300005718 | Ga0068866_10708405 | Ga0068866_107084052 | 76 |
| 6 | 3300006881 | Ga0068865_100247638 | Ga0068865_1002476383 | 76 |
| 7 | 3300009176 | Ga0105242_12556391 | Ga0105242_125563912 | 76 |
| 8 | 3300014325 | Ga0163163_10354864 | Ga0163163_103548643 | 76 |
| 9 | 3300025899 | Ga0207642_10540639 | Ga0207642_105406392 | 76 |
| 10 | 3300025938 | Ga0207704_10504614 | Ga0207704_105046142 | 76 |
| 11 | 3300025981 | Ga0207640_11035291 | Ga0207640_110352911 | 76 |
| 12 | 3300026088 | Ga0207641_10911763 | Ga0207641_109117632 | 76 |
| 13 | 3300026089 | Ga0207648_10330619 | Ga0207648_103306192 | 76 |
| 14 | 3300005340 | Ga0070689_101969776 | Ga0070689_1019697762 | 79 |
| 15 | 3300005343 | Ga0070687_101169594 | Ga0070687_1011695942 | 79 |
| 16 | 3300005466 | Ga0070685_11289161 | Ga0070685_112891611 | 79 |
| 17 | 3300005545 | Ga0070695_100228562 | Ga0070695_1002285622 | 79 |
| 18 | 3300005578 | Ga0068854_101915000 | Ga0068854_1019150002 | 79 |
| 19 | 3300005615 | Ga0070702_100125864 | Ga0070702_1001258642 | 79 |
| 20 | 3300006042 | Ga0075368_10229476 | Ga0075368_102294762 | 79 |
| 21 | 3300005577 | Ga0068857_100876570 | Ga0068857_1008765702 | 80 |
| 22 | 3300009545 | Ga0105237_10054639 | Ga0105237_100546393 | 80 |
| 23 | 3300014325 | Ga0163163_11004280 | Ga0163163_110042803 | 80 |
| 24 | 3300026075 | Ga0207708_10348233 | Ga0207708_103482332 | 80 |
| 25 | 3300026089 | Ga0207648_10607562 | Ga0207648_106075622 | 80 |
| 26 | 3300026116 | Ga0207674_11078496 | Ga0207674_110784962 | 80 |
| 27 | 3300044658 | Ga0466972_0526516 | Ga0466972_0526516_198_443 | 80 |
| 28 | 3300048916 | Ga0496113_1468114 | Ga0496113_1468114_188_439 | 80 |
| 29 | 3300049569 | Ga0501032_0127552 | Ga0501032_0127552_1079_1321 | 80 |
| 30 | 3300049570 | Ga0501033_0075147 | Ga0501033_0075147_247_489 | 80 |
| 31 | 3300049572 | Ga0501036_0021599 | Ga0501036_0021599_2849_3091 | 80 |
| 32 | 3300049574 | Ga0501038_0007347 | Ga0501038_0007347_6437_6679 | 80 |
| 33 | 3300049575 | Ga0501039_0031316 | Ga0501039_0031316_1331_1573 | 80 |
| 34 | 3300049576 | Ga0501040_0143342 | Ga0501040_0143342_647_889 | 80 |
| 35 | 3300049577 | Ga0501041_0007208 | Ga0501041_0007208_637_879 | 80 |
| 36 | 3300049578 | Ga0501042_0000551 | Ga0501042_0000551_11929_12171 | 80 |
| 37 | 3300049579 | Ga0501043_0015625 | Ga0501043_0015625_3722_3964 | 80 |
| 38 | 3300049580 | Ga0501046_0009274 | Ga0501046_0009274_6499_6741 | 80 |
| 39 | 3300049582 | Ga0501048_0013999 | Ga0501048_0013999_2376_2618 | 80 |
| 40 | 3300049584 | Ga0501068_0014050 | Ga0501068_0014050_3828_4070 | 80 |
| 41 | 3300049587 | Ga0501071_0004390 | Ga0501071_0004390_3601_3843 | 80 |
| 42 | 3300049588 | Ga0501072_0034947 | Ga0501072_0034947_1307_1549 | 80 |
| 43 | 3300049589 | Ga0501073_0367563 | Ga0501073_0367563_327_569 | 80 |
| 44 | 3300049590 | Ga0501074_0057417 | Ga0501074_0057417_1585_1827 | 80 |
| 45 | 3300049591 | Ga0501075_0000631 | Ga0501075_0000631_17498_17740 | 80 |
| 46 | 3300049592 | Ga0501076_0049061 | Ga0501076_0049061_2174_2416 | 80 |
| 47 | 3300049593 | Ga0501077_0120813 | Ga0501077_0120813_462_704 | 80 |
| 48 | 3300049741 | Ga0501079_0032000 | Ga0501079_0032000_1627_1869 | 80 |
| 49 | 3300049742 | Ga0501080_0017477 | Ga0501080_0017477_5210_5452 | 80 |
| 50 | 3300049742 | Ga0501080_1746188 | Ga0501080_1746188_214_456 | 80 |
| 51 | 3300049743 | Ga0501081_0006698 | Ga0501081_0006698_3763_4005 | 80 |
| 52 | 3300049744 | Ga0501083_0276586 | Ga0501083_0276586_126_368 | 80 |
| 53 | 3300049822 | Ga0501035_0155267 | Ga0501035_0155267_71_313 | 80 |
| 54 | 3300049824 | Ga0501045_0005627 | Ga0501045_0005627_4650_4892 | 80 |
| 55 | 3300054114 | Ga0501084_0013018 | Ga0501084_0013018_4057_4299 | 80 |
| 56 | 3300060353 | Ga0501082_0004569 | Ga0501082_0004569_3792_4034 | 80 |
| 57 | 3300060353 | Ga0501082_0853626 | Ga0501082_0853626_504_746 | 80 |
| 58 | 3300061734 | Ga0530510_0000823 | Ga0530510_0000823_19198_19440 | 80 |
| 59 | 3300005293 | Ga0065715_10115398 | Ga0065715_101153983 | 81 |
| 60 | 3300005295 | Ga0065707_10345748 | Ga0065707_103457482 | 81 |
| 61 | 3300005328 | Ga0070676_10183531 | Ga0070676_101835311 | 81 |
| 62 | 3300005329 | Ga0070683_100132261 | Ga0070683_1001322612 | 81 |
| 63 | 3300005330 | Ga0070690_100498254 | Ga0070690_1004982542 | 81 |
| 64 | 3300005331 | Ga0070670_100214536 | Ga0070670_1002145363 | 81 |
| 65 | 3300005331 | Ga0070670_100880975 | Ga0070670_1008809752 | 81 |
| 66 | 3300005333 | Ga0070677_10112358 | Ga0070677_101123582 | 81 |
| 67 | 3300005333 | Ga0070677_10386614 | Ga0070677_103866142 | 81 |
| 68 | 3300005334 | Ga0068869_100858111 | Ga0068869_1008581111 | 81 |
| 69 | 3300005334 | Ga0068869_101848702 | Ga0068869_1018487022 | 81 |
| 70 | 3300005335 | Ga0070666_10503711 | Ga0070666_105037111 | 81 |
| 71 | 3300005335 | Ga0070666_10942516 | Ga0070666_109425162 | 81 |
| 72 | 3300005339 | Ga0070660_100995876 | Ga0070660_1009958762 | 81 |
| 73 | 3300005340 | Ga0070689_100034442 | Ga0070689_1000344422 | 81 |
| 74 | 3300005340 | Ga0070689_100405790 | Ga0070689_1004057903 | 81 |
| 75 | 3300005343 | Ga0070687_101500055 | Ga0070687_1015000552 | 81 |
| 76 | 3300005343 | Ga0070687_101535969 | Ga0070687_1015359692 | 81 |
| 77 | 3300005347 | Ga0070668_102202588 | Ga0070668_1022025882 | 81 |
| 78 | 3300005354 | Ga0070675_100106612 | Ga0070675_1001066122 | 81 |
| 79 | 3300005354 | Ga0070675_100467327 | Ga0070675_1004673272 | 81 |
| 80 | 3300005356 | Ga0070674_100786927 | Ga0070674_1007869271 | 81 |
| 81 | 3300005364 | Ga0070673_100386007 | Ga0070673_1003860072 | 81 |
| 82 | 3300005364 | Ga0070673_100411074 | Ga0070673_1004110742 | 81 |
| 83 | 3300005365 | Ga0070688_100479774 | Ga0070688_1004797742 | 81 |
| 84 | 3300005365 | Ga0070688_100566142 | Ga0070688_1005661422 | 81 |
| 85 | 3300005366 | Ga0070659_100286509 | Ga0070659_1002865092 | 81 |
| 86 | 3300005367 | Ga0070667_101015964 | Ga0070667_1010159641 | 81 |
| 87 | 3300005406 | Ga0070703_10485987 | Ga0070703_104859872 | 81 |
| 88 | 3300005436 | Ga0070713_100185118 | Ga0070713_1001851183 | 81 |
| 89 | 3300005436 | Ga0070713_100568255 | Ga0070713_1005682552 | 81 |
| 90 | 3300005440 | Ga0070705_100140488 | Ga0070705_1001404882 | 81 |
| 91 | 3300005440 | Ga0070705_100331188 | Ga0070705_1003311882 | 81 |
| 92 | 3300005440 | Ga0070705_101637185 | Ga0070705_1016371851 | 81 |
| 93 | 3300005441 | Ga0070700_100781347 | Ga0070700_1007813471 | 81 |
| 94 | 3300005441 | Ga0070700_101166394 | Ga0070700_1011663942 | 81 |
| 95 | 3300005444 | Ga0070694_100006003 | Ga0070694_1000060034 | 81 |
| 96 | 3300005444 | Ga0070694_101654510 | Ga0070694_1016545101 | 81 |
| 97 | 3300005445 | Ga0070708_100007406 | Ga0070708_1000074063 | 81 |
| 98 | 3300005455 | Ga0070663_100023261 | Ga0070663_1000232614 | 81 |
| 99 | 3300005456 | Ga0070678_100366290 | Ga0070678_1003662902 | 81 |
| 100 | 3300005456 | Ga0070678_100962685 | Ga0070678_1009626852 | 81 |
| 101 | 3300005458 | Ga0070681_10060434 | Ga0070681_100604342 | 81 |
| 102 | 3300005459 | Ga0068867_100146582 | Ga0068867_1001465823 | 81 |
| 103 | 3300005459 | Ga0068867_100318868 | Ga0068867_1003188682 | 81 |
| 104 | 3300005466 | Ga0070685_10304428 | Ga0070685_103044281 | 81 |
| 105 | 3300005466 | Ga0070685_10354076 | Ga0070685_103540762 | 81 |
| 106 | 3300005466 | Ga0070685_11095420 | Ga0070685_110954202 | 81 |
| 107 | 3300005468 | Ga0070707_100044568 | Ga0070707_1000445681 | 81 |
| 108 | 3300005468 | Ga0070707_100205433 | Ga0070707_1002054332 | 81 |
| 109 | 3300005468 | Ga0070707_101171118 | Ga0070707_1011711182 | 81 |
| 110 | 3300005471 | Ga0070698_100017147 | Ga0070698_1000171477 | 81 |
| 111 | 3300005471 | Ga0070698_100937734 | Ga0070698_1009377342 | 81 |
| 112 | 3300005471 | Ga0070698_101257738 | Ga0070698_1012577381 | 81 |
| 113 | 3300005518 | Ga0070699_100012833 | Ga0070699_1000128336 | 81 |
| 114 | 3300005518 | Ga0070699_100023354 | Ga0070699_1000233547 | 81 |
| 115 | 3300005530 | Ga0070679_100700874 | Ga0070679_1007008741 | 81 |
| 116 | 3300005535 | Ga0070684_101251054 | Ga0070684_1012510541 | 81 |
| 117 | 3300005536 | Ga0070697_100067371 | Ga0070697_1000673712 | 81 |
| 118 | 3300005536 | Ga0070697_100243871 | Ga0070697_1002438712 | 81 |
| 119 | 3300005543 | Ga0070672_100574245 | Ga0070672_1005742452 | 81 |
| 120 | 3300005543 | Ga0070672_100630168 | Ga0070672_1006301682 | 81 |
| 121 | 3300005543 | Ga0070672_101904922 | Ga0070672_1019049222 | 81 |
| 122 | 3300005544 | Ga0070686_100416381 | Ga0070686_1004163812 | 81 |
| 123 | 3300005546 | Ga0070696_100018491 | Ga0070696_1000184915 | 81 |
| 124 | 3300005546 | Ga0070696_100059451 | Ga0070696_1000594512 | 81 |
| 125 | 3300005548 | Ga0070665_100380561 | Ga0070665_1003805613 | 81 |
| 126 | 3300005548 | Ga0070665_100612308 | Ga0070665_1006123081 | 81 |
| 127 | 3300005548 | Ga0070665_101562564 | Ga0070665_1015625642 | 81 |
| 128 | 3300005548 | Ga0070665_101622290 | Ga0070665_1016222902 | 81 |
| 129 | 3300005549 | Ga0070704_100004236 | Ga0070704_1000042365 | 81 |
| 130 | 3300005549 | Ga0070704_100110821 | Ga0070704_1001108212 | 81 |
| 131 | 3300005549 | Ga0070704_102232893 | Ga0070704_1022328932 | 81 |
| 132 | 3300005563 | Ga0068855_101124613 | Ga0068855_1011246132 | 81 |
| 133 | 3300005564 | Ga0070664_100473636 | Ga0070664_1004736362 | 81 |
| 134 | 3300005564 | Ga0070664_100603901 | Ga0070664_1006039011 | 81 |
| 135 | 3300005564 | Ga0070664_101232474 | Ga0070664_1012324742 | 81 |
| 136 | 3300005578 | Ga0068854_100268688 | Ga0068854_1002686883 | 81 |
| 137 | 3300005614 | Ga0068856_100743086 | Ga0068856_1007430862 | 81 |
| 138 | 3300005616 | Ga0068852_100133733 | Ga0068852_1001337332 | 81 |
| 139 | 3300005617 | Ga0068859_100275861 | Ga0068859_1002758612 | 81 |
| 140 | 3300005618 | Ga0068864_100016021 | Ga0068864_1000160212 | 81 |
| 141 | 3300005618 | Ga0068864_101326415 | Ga0068864_1013264151 | 81 |
| 142 | 3300005719 | Ga0068861_100532297 | Ga0068861_1005322972 | 81 |
| 143 | 3300005719 | Ga0068861_100648166 | Ga0068861_1006481662 | 81 |
| 144 | 3300005719 | Ga0068861_100720400 | Ga0068861_1007204002 | 81 |
| 145 | 3300005834 | Ga0068851_10229131 | Ga0068851_102291312 | 81 |
| 146 | 3300005840 | Ga0068870_10107884 | Ga0068870_101078843 | 81 |
| 147 | 3300005841 | Ga0068863_100206299 | Ga0068863_1002062993 | 81 |
| 148 | 3300005841 | Ga0068863_100649164 | Ga0068863_1006491642 | 81 |
| 149 | 3300005842 | Ga0068858_100019359 | Ga0068858_1000193591 | 81 |
| 150 | 3300005842 | Ga0068858_100024433 | Ga0068858_1000244335 | 81 |
| 151 | 3300005842 | Ga0068858_100236670 | Ga0068858_1002366702 | 81 |
| 152 | 3300005844 | Ga0068862_100523016 | Ga0068862_1005230162 | 81 |
| 153 | 3300005844 | Ga0068862_100844700 | Ga0068862_1008447002 | 81 |
| 154 | 3300005844 | Ga0068862_101861126 | Ga0068862_1018611261 | 81 |
| 155 | 3300005985 | Ga0081539_10050084 | Ga0081539_100500842 | 81 |
| 156 | 3300006028 | Ga0070717_10359416 | Ga0070717_103594163 | 81 |
| 157 | 3300006042 | Ga0075368_10012191 | Ga0075368_100121912 | 81 |
| 158 | 3300006042 | Ga0075368_10130153 | Ga0075368_101301532 | 81 |
| 159 | 3300006048 | Ga0075363_100037537 | Ga0075363_1000375372 | 81 |
| 160 | 3300006051 | Ga0075364_10001941 | Ga0075364_100019418 | 81 |
| 161 | 3300006051 | Ga0075364_10061965 | Ga0075364_100619653 | 81 |
| 162 | 3300006051 | Ga0075364_10111111 | Ga0075364_101111112 | 81 |
| 163 | 3300006058 | Ga0075432_10434900 | Ga0075432_104349002 | 81 |
| 164 | 3300006173 | Ga0070716_101270408 | Ga0070716_1012704082 | 81 |
| 165 | 3300006177 | Ga0075362_10001991 | Ga0075362_100019914 | 81 |
| 166 | 3300006178 | Ga0075367_10010746 | Ga0075367_100107464 | 81 |
| 167 | 3300006178 | Ga0075367_10080211 | Ga0075367_100802113 | 81 |
| 168 | 3300006178 | Ga0075367_10235060 | Ga0075367_102350602 | 81 |
| 169 | 3300006178 | Ga0075367_10324959 | Ga0075367_103249592 | 81 |
| 170 | 3300006186 | Ga0075369_10181022 | Ga0075369_101810222 | 81 |
| 171 | 3300006186 | Ga0075369_10259159 | Ga0075369_102591592 | 81 |
| 172 | 3300006195 | Ga0075366_10047206 | Ga0075366_100472062 | 81 |
| 173 | 3300006195 | Ga0075366_10093145 | Ga0075366_100931453 | 81 |
| 174 | 3300006237 | Ga0097621_100879523 | Ga0097621_1008795232 | 81 |
| 175 | 3300006358 | Ga0068871_100173558 | Ga0068871_1001735581 | 81 |
| 176 | 3300006358 | Ga0068871_101466996 | Ga0068871_1014669962 | 81 |
| 177 | 3300006358 | Ga0068871_101671544 | Ga0068871_1016715442 | 81 |
| 178 | 3300006844 | Ga0075428_100031002 | Ga0075428_1000310027 | 81 |
| 179 | 3300006844 | Ga0075428_102235573 | Ga0075428_1022355732 | 81 |
| 180 | 3300006847 | Ga0075431_100098315 | Ga0075431_1000983153 | 81 |
| 181 | 3300006852 | Ga0075433_10076711 | Ga0075433_100767112 | 81 |
| 182 | 3300006852 | Ga0075433_10801791 | Ga0075433_108017912 | 81 |
| 183 | 3300006871 | Ga0075434_100026639 | Ga0075434_1000266394 | 81 |
| 184 | 3300006871 | Ga0075434_100108884 | Ga0075434_1001088843 | 81 |
| 185 | 3300006871 | Ga0075434_100872466 | Ga0075434_1008724662 | 81 |
| 186 | 3300006871 | Ga0075434_101013817 | Ga0075434_1010138171 | 81 |
| 187 | 3300006880 | Ga0075429_100006683 | Ga0075429_1000066837 | 81 |
| 188 | 3300006880 | Ga0075429_101298911 | Ga0075429_1012989111 | 81 |
| 189 | 3300006881 | Ga0068865_100076034 | Ga0068865_1000760343 | 81 |
| 190 | 3300006881 | Ga0068865_100811075 | Ga0068865_1008110752 | 81 |
| 191 | 3300006881 | Ga0068865_101022531 | Ga0068865_1010225312 | 81 |
| 192 | 3300006914 | Ga0075436_100271197 | Ga0075436_1002711972 | 81 |
| 193 | 3300006931 | Ga0097620_100275868 | Ga0097620_1002758682 | 81 |
| 194 | 3300007076 | Ga0075435_100028860 | Ga0075435_1000288605 | 81 |
| 195 | 3300007076 | Ga0075435_100848491 | Ga0075435_1008484912 | 81 |
| 196 | 3300009011 | Ga0105251_10069657 | Ga0105251_100696573 | 81 |
| 197 | 3300009011 | Ga0105251_10408681 | Ga0105251_104086812 | 81 |
| 198 | 3300009094 | Ga0111539_10002954 | Ga0111539_100029543 | 81 |
| 199 | 3300009094 | Ga0111539_10135559 | Ga0111539_101355592 | 81 |
| 200 | 3300009094 | Ga0111539_10280228 | Ga0111539_102802283 | 81 |
| 201 | 3300009094 | Ga0111539_10528669 | Ga0111539_105286692 | 81 |
| 202 | 3300009094 | Ga0111539_10734924 | Ga0111539_107349242 | 81 |
| 203 | 3300009098 | Ga0105245_10370508 | Ga0105245_103705082 | 81 |
| 204 | 3300009098 | Ga0105245_10775425 | Ga0105245_107754252 | 81 |
| 205 | 3300009098 | Ga0105245_12018998 | Ga0105245_120189982 | 81 |
| 206 | 3300009101 | Ga0105247_10013971 | Ga0105247_100139717 | 81 |
| 207 | 3300009101 | Ga0105247_10069428 | Ga0105247_100694284 | 81 |
| 208 | 3300009101 | Ga0105247_10365430 | Ga0105247_103654302 | 81 |
| 209 | 3300009101 | Ga0105247_10931958 | Ga0105247_109319581 | 81 |
| 210 | 3300009101 | Ga0105247_11439158 | Ga0105247_114391582 | 81 |
| 211 | 3300009147 | Ga0114129_10008194 | Ga0114129_100081943 | 81 |
| 212 | 3300009147 | Ga0114129_10023525 | Ga0114129_100235255 | 81 |
| 213 | 3300009147 | Ga0114129_10027033 | Ga0114129_100270336 | 81 |
| 214 | 3300009147 | Ga0114129_10031591 | Ga0114129_100315918 | 81 |
| 215 | 3300009148 | Ga0105243_12009552 | Ga0105243_120095522 | 81 |
| 216 | 3300009148 | Ga0105243_12128827 | Ga0105243_121288272 | 81 |
| 217 | 3300009176 | Ga0105242_10631040 | Ga0105242_106310402 | 81 |
| 218 | 3300009177 | Ga0105248_10018478 | Ga0105248_100184786 | 81 |
| 219 | 3300009177 | Ga0105248_10245254 | Ga0105248_102452544 | 81 |
| 220 | 3300009177 | Ga0105248_10383986 | Ga0105248_103839862 | 81 |
| 221 | 3300009177 | Ga0105248_11075766 | Ga0105248_110757662 | 81 |
| 222 | 3300009177 | Ga0105248_11510760 | Ga0105248_115107602 | 81 |
| 223 | 3300009177 | Ga0105248_11904450 | Ga0105248_119044502 | 81 |
| 224 | 3300009177 | Ga0105248_12249976 | Ga0105248_122499762 | 81 |
| 225 | 3300009545 | Ga0105237_10342864 | Ga0105237_103428642 | 81 |
| 226 | 3300009551 | Ga0105238_10074364 | Ga0105238_100743645 | 81 |
| 227 | 3300009551 | Ga0105238_11604062 | Ga0105238_116040621 | 81 |
| 228 | 3300009551 | Ga0105238_11938747 | Ga0105238_119387472 | 81 |
| 229 | 3300009553 | Ga0105249_10239261 | Ga0105249_102392613 | 81 |
| 230 | 3300009553 | Ga0105249_12595475 | Ga0105249_125954752 | 81 |
| 231 | 3300009553 | Ga0105249_12989869 | Ga0105249_129898692 | 81 |
| 232 | 3300011119 | Ga0105246_10018878 | Ga0105246_100188782 | 81 |
| 233 | 3300013296 | Ga0157374_11242550 | Ga0157374_112425502 | 81 |
| 234 | 3300013297 | Ga0157378_10253219 | Ga0157378_102532193 | 81 |
| 235 | 3300013306 | Ga0163162_12330535 | Ga0163162_123305352 | 81 |
| 236 | 3300013308 | Ga0157375_10219574 | Ga0157375_102195742 | 81 |
| 237 | 3300014325 | Ga0163163_10040143 | Ga0163163_100401433 | 81 |
| 238 | 3300014325 | Ga0163163_11106059 | Ga0163163_111060592 | 81 |
| 239 | 3300014325 | Ga0163163_11444702 | Ga0163163_114447022 | 81 |
| 240 | 3300014326 | Ga0157380_10006444 | Ga0157380_100064443 | 81 |
| 241 | 3300014326 | Ga0157380_10135603 | Ga0157380_101356033 | 81 |
| 242 | 3300014326 | Ga0157380_12266901 | Ga0157380_122669012 | 81 |
| 243 | 3300014968 | Ga0157379_10025954 | Ga0157379_100259544 | 81 |
| 244 | 3300014968 | Ga0157379_10392864 | Ga0157379_103928642 | 81 |
| 245 | 3300014968 | Ga0157379_12089554 | Ga0157379_120895541 | 81 |
| 246 | 3300014969 | Ga0157376_12891149 | Ga0157376_128911492 | 81 |
| 247 | 3300017792 | Ga0163161_10645174 | Ga0163161_106451742 | 81 |
| 248 | 3300021384 | Ga0213876_10132468 | Ga0213876_101324681 | 81 |
| 249 | 3300025315 | Ga0207697_10000148 | Ga0207697_1000014821 | 81 |
| 250 | 3300025315 | Ga0207697_10286851 | Ga0207697_102868512 | 81 |
| 251 | 3300025315 | Ga0207697_10508098 | Ga0207697_105080981 | 81 |
| 252 | 3300025321 | Ga0207656_10072298 | Ga0207656_100722983 | 81 |
| 253 | 3300025893 | Ga0207682_10067940 | Ga0207682_100679402 | 81 |
| 254 | 3300025900 | Ga0207710_10024652 | Ga0207710_100246524 | 81 |
| 255 | 3300025900 | Ga0207710_10036749 | Ga0207710_100367492 | 81 |
| 256 | 3300025901 | Ga0207688_10009342 | Ga0207688_100093427 | 81 |
| 257 | 3300025901 | Ga0207688_10147553 | Ga0207688_101475532 | 81 |
| 258 | 3300025901 | Ga0207688_10791568 | Ga0207688_107915682 | 81 |
| 259 | 3300025903 | Ga0207680_10181481 | Ga0207680_101814812 | 81 |
| 260 | 3300025903 | Ga0207680_10422256 | Ga0207680_104222562 | 81 |
| 261 | 3300025903 | Ga0207680_10951180 | Ga0207680_109511801 | 81 |
| 262 | 3300025904 | Ga0207647_10454664 | Ga0207647_104546642 | 81 |
| 263 | 3300025907 | Ga0207645_10000577 | Ga0207645_1000057718 | 81 |
| 264 | 3300025907 | Ga0207645_10033216 | Ga0207645_100332165 | 81 |
| 265 | 3300025907 | Ga0207645_10077506 | Ga0207645_100775062 | 81 |
| 266 | 3300025907 | Ga0207645_10415030 | Ga0207645_104150302 | 81 |
| 267 | 3300025907 | Ga0207645_11036199 | Ga0207645_110361992 | 81 |
| 268 | 3300025908 | Ga0207643_10000648 | Ga0207643_100006483 | 81 |
| 269 | 3300025908 | Ga0207643_10059927 | Ga0207643_100599273 | 81 |
| 270 | 3300025908 | Ga0207643_10129251 | Ga0207643_101292512 | 81 |
| 271 | 3300025908 | Ga0207643_10233651 | Ga0207643_102336513 | 81 |
| 272 | 3300025910 | Ga0207684_10736513 | Ga0207684_107365132 | 81 |
| 273 | 3300025912 | Ga0207707_10037755 | Ga0207707_100377556 | 81 |
| 274 | 3300025912 | Ga0207707_11437353 | Ga0207707_114373532 | 81 |
| 275 | 3300025914 | Ga0207671_10474490 | Ga0207671_104744902 | 81 |
| 276 | 3300025917 | Ga0207660_10270773 | Ga0207660_102707732 | 81 |
| 277 | 3300025918 | Ga0207662_10016135 | Ga0207662_100161356 | 81 |
| 278 | 3300025918 | Ga0207662_10039454 | Ga0207662_100394543 | 81 |
| 279 | 3300025918 | Ga0207662_10289561 | Ga0207662_102895613 | 81 |
| 280 | 3300025918 | Ga0207662_10513457 | Ga0207662_105134572 | 81 |
| 281 | 3300025918 | Ga0207662_10679038 | Ga0207662_106790382 | 81 |
| 282 | 3300025919 | Ga0207657_10054067 | Ga0207657_100540676 | 81 |
| 283 | 3300025920 | Ga0207649_11444977 | Ga0207649_114449771 | 81 |
| 284 | 3300025921 | Ga0207652_11250928 | Ga0207652_112509282 | 81 |
| 285 | 3300025922 | Ga0207646_10039052 | Ga0207646_100390526 | 81 |
| 286 | 3300025922 | Ga0207646_10277166 | Ga0207646_102771662 | 81 |
| 287 | 3300025922 | Ga0207646_10565182 | Ga0207646_105651822 | 81 |
| 288 | 3300025922 | Ga0207646_11845183 | Ga0207646_118451831 | 81 |
| 289 | 3300025923 | Ga0207681_10021283 | Ga0207681_100212835 | 81 |
| 290 | 3300025924 | Ga0207694_10098919 | Ga0207694_100989193 | 81 |
| 291 | 3300025924 | Ga0207694_10135800 | Ga0207694_101358002 | 81 |
| 292 | 3300025925 | Ga0207650_10066421 | Ga0207650_100664213 | 81 |
| 293 | 3300025925 | Ga0207650_10366080 | Ga0207650_103660802 | 81 |
| 294 | 3300025925 | Ga0207650_10366660 | Ga0207650_103666602 | 81 |
| 295 | 3300025926 | Ga0207659_10000969 | Ga0207659_1000096914 | 81 |
| 296 | 3300025926 | Ga0207659_10013177 | Ga0207659_100131772 | 81 |
| 297 | 3300025926 | Ga0207659_10020573 | Ga0207659_100205736 | 81 |
| 298 | 3300025926 | Ga0207659_10217004 | Ga0207659_102170041 | 81 |
| 299 | 3300025926 | Ga0207659_10445192 | Ga0207659_104451922 | 81 |
| 300 | 3300025927 | Ga0207687_10437261 | Ga0207687_104372612 | 81 |
| 301 | 3300025927 | Ga0207687_11145869 | Ga0207687_111458692 | 81 |
| 302 | 3300025927 | Ga0207687_11797042 | Ga0207687_117970422 | 81 |
| 303 | 3300025928 | Ga0207700_10147134 | Ga0207700_101471342 | 81 |
| 304 | 3300025931 | Ga0207644_10143347 | Ga0207644_101433474 | 81 |
| 305 | 3300025931 | Ga0207644_10594397 | Ga0207644_105943971 | 81 |
| 306 | 3300025931 | Ga0207644_11070422 | Ga0207644_110704222 | 81 |
| 307 | 3300025932 | Ga0207690_10295895 | Ga0207690_102958952 | 81 |
| 308 | 3300025932 | Ga0207690_10365520 | Ga0207690_103655202 | 81 |
| 309 | 3300025932 | Ga0207690_11243710 | Ga0207690_112437102 | 81 |
| 310 | 3300025933 | Ga0207706_10009648 | Ga0207706_100096489 | 81 |
| 311 | 3300025933 | Ga0207706_10525295 | Ga0207706_105252952 | 81 |
| 312 | 3300025934 | Ga0207686_10335622 | Ga0207686_103356222 | 81 |
| 313 | 3300025934 | Ga0207686_11337405 | Ga0207686_113374052 | 81 |
| 314 | 3300025935 | Ga0207709_10066821 | Ga0207709_100668214 | 81 |
| 315 | 3300025936 | Ga0207670_10081470 | Ga0207670_100814702 | 81 |
| 316 | 3300025936 | Ga0207670_10506912 | Ga0207670_105069122 | 81 |
| 317 | 3300025937 | Ga0207669_10017605 | Ga0207669_100176052 | 81 |
| 318 | 3300025937 | Ga0207669_10343198 | Ga0207669_103431982 | 81 |
| 319 | 3300025938 | Ga0207704_10052747 | Ga0207704_100527473 | 81 |
| 320 | 3300025938 | Ga0207704_10399359 | Ga0207704_103993592 | 81 |
| 321 | 3300025938 | Ga0207704_10730925 | Ga0207704_107309252 | 81 |
| 322 | 3300025939 | Ga0207665_11014783 | Ga0207665_110147832 | 81 |
| 323 | 3300025940 | Ga0207691_10004463 | Ga0207691_100044636 | 81 |
| 324 | 3300025940 | Ga0207691_10524208 | Ga0207691_105242082 | 81 |
| 325 | 3300025940 | Ga0207691_10831513 | Ga0207691_108315132 | 81 |
| 326 | 3300025941 | Ga0207711_10033505 | Ga0207711_100335051 | 81 |
| 327 | 3300025941 | Ga0207711_10629290 | Ga0207711_106292902 | 81 |
| 328 | 3300025941 | Ga0207711_10687433 | Ga0207711_106874332 | 81 |
| 329 | 3300025941 | Ga0207711_10895376 | Ga0207711_108953762 | 81 |
| 330 | 3300025941 | Ga0207711_10927530 | Ga0207711_109275301 | 81 |
| 331 | 3300025942 | Ga0207689_10931492 | Ga0207689_109314922 | 81 |
| 332 | 3300025942 | Ga0207689_11751753 | Ga0207689_117517532 | 81 |
| 333 | 3300025944 | Ga0207661_10059988 | Ga0207661_100599882 | 81 |
| 334 | 3300025944 | Ga0207661_11826589 | Ga0207661_118265892 | 81 |
| 335 | 3300025944 | Ga0207661_11861054 | Ga0207661_118610542 | 81 |
| 336 | 3300025945 | Ga0207679_10014873 | Ga0207679_100148734 | 81 |
| 337 | 3300025945 | Ga0207679_10029985 | Ga0207679_100299855 | 81 |
| 338 | 3300025945 | Ga0207679_10218972 | Ga0207679_102189723 | 81 |
| 339 | 3300025945 | Ga0207679_11967363 | Ga0207679_119673632 | 81 |
| 340 | 3300025949 | Ga0207667_11773724 | Ga0207667_117737242 | 81 |
| 341 | 3300025960 | Ga0207651_10276934 | Ga0207651_102769342 | 81 |
| 342 | 3300025960 | Ga0207651_10393270 | Ga0207651_103932703 | 81 |
| 343 | 3300025961 | Ga0207712_10023764 | Ga0207712_100237646 | 81 |
| 344 | 3300025961 | Ga0207712_10265835 | Ga0207712_102658352 | 81 |
| 345 | 3300025972 | Ga0207668_10051544 | Ga0207668_100515443 | 81 |
| 346 | 3300025986 | Ga0207658_10386074 | Ga0207658_103860742 | 81 |
| 347 | 3300025986 | Ga0207658_10828339 | Ga0207658_108283392 | 81 |
| 348 | 3300025986 | Ga0207658_11086802 | Ga0207658_110868022 | 81 |
| 349 | 3300026023 | Ga0207677_10148956 | Ga0207677_101489562 | 81 |
| 350 | 3300026023 | Ga0207677_10945389 | Ga0207677_109453892 | 81 |
| 351 | 3300026035 | Ga0207703_10071228 | Ga0207703_100712282 | 81 |
| 352 | 3300026035 | Ga0207703_10467702 | Ga0207703_104677022 | 81 |
| 353 | 3300026041 | Ga0207639_10958450 | Ga0207639_109584502 | 81 |
| 354 | 3300026067 | Ga0207678_10044540 | Ga0207678_100445402 | 81 |
| 355 | 3300026075 | Ga0207708_10008793 | Ga0207708_100087937 | 81 |
| 356 | 3300026075 | Ga0207708_10012183 | Ga0207708_100121832 | 81 |
| 357 | 3300026088 | Ga0207641_10017355 | Ga0207641_100173557 | 81 |
| 358 | 3300026088 | Ga0207641_10271397 | Ga0207641_102713972 | 81 |
| 359 | 3300026088 | Ga0207641_10556087 | Ga0207641_105560872 | 81 |
| 360 | 3300026088 | Ga0207641_10654874 | Ga0207641_106548742 | 81 |
| 361 | 3300026088 | Ga0207641_10902678 | Ga0207641_109026782 | 81 |
| 362 | 3300026089 | Ga0207648_10054986 | Ga0207648_100549864 | 81 |
| 363 | 3300026089 | Ga0207648_10078893 | Ga0207648_100788932 | 81 |
| 364 | 3300026089 | Ga0207648_10205123 | Ga0207648_102051232 | 81 |
| 365 | 3300026095 | Ga0207676_10022493 | Ga0207676_100224936 | 81 |
| 366 | 3300026095 | Ga0207676_10042789 | Ga0207676_100427892 | 81 |
| 367 | 3300026095 | Ga0207676_10233286 | Ga0207676_102332861 | 81 |
| 368 | 3300026095 | Ga0207676_10901037 | Ga0207676_109010372 | 81 |
| 369 | 3300026095 | Ga0207676_11074361 | Ga0207676_110743612 | 81 |
| 370 | 3300026116 | Ga0207674_10083334 | Ga0207674_100833342 | 81 |
| 371 | 3300026116 | Ga0207674_10417021 | Ga0207674_104170212 | 81 |
| 372 | 3300026116 | Ga0207674_11492021 | Ga0207674_114920212 | 81 |
| 373 | 3300026118 | Ga0207675_100002044 | Ga0207675_1000020449 | 81 |
| 374 | 3300026118 | Ga0207675_100255612 | Ga0207675_1002556122 | 81 |
| 375 | 3300026121 | Ga0207683_10407442 | Ga0207683_104074422 | 81 |
| 376 | 3300026142 | Ga0207698_10397913 | Ga0207698_103979133 | 81 |
| 377 | 3300026142 | Ga0207698_10645430 | Ga0207698_106454302 | 81 |
| 378 | 3300027682 | Ga0209971_1153740 | Ga0209971_11537402 | 81 |
| 379 | 3300027866 | Ga0209813_10027373 | Ga0209813_100273732 | 81 |
| 380 | 3300027907 | Ga0207428_10007408 | Ga0207428_1000740810 | 81 |
| 381 | 3300027907 | Ga0207428_10454617 | Ga0207428_104546172 | 81 |
| 382 | 3300028379 | Ga0268266_10128322 | Ga0268266_101283222 | 81 |
| 383 | 3300028379 | Ga0268266_10266432 | Ga0268266_102664323 | 81 |
| 384 | 3300028379 | Ga0268266_10787131 | Ga0268266_107871312 | 81 |
| 385 | 3300028379 | Ga0268266_11294709 | Ga0268266_112947091 | 81 |
| 386 | 3300028380 | Ga0268265_10097703 | Ga0268265_100977033 | 81 |
| 387 | 3300028380 | Ga0268265_10234864 | Ga0268265_102348643 | 81 |
| 388 | 3300028380 | Ga0268265_10334847 | Ga0268265_103348472 | 81 |
| 389 | 3300028380 | Ga0268265_10437572 | Ga0268265_104375722 | 81 |
| 390 | 3300028380 | Ga0268265_10487426 | Ga0268265_104874262 | 81 |
| 391 | 3300028380 | Ga0268265_11682582 | Ga0268265_116825822 | 81 |
| 392 | 3300028381 | Ga0268264_10467874 | Ga0268264_104678742 | 81 |
| 393 | 3300028381 | Ga0268264_10490633 | Ga0268264_104906332 | 81 |
| 394 | 3300028381 | Ga0268264_10886228 | Ga0268264_108862282 | 81 |
| 395 | 3300028381 | Ga0268264_11186894 | Ga0268264_111868942 | 81 |
| 396 | 3300028381 | Ga0268264_11772098 | Ga0268264_117720982 | 81 |
| 397 | 3300028381 | Ga0268264_12659005 | Ga0268264_126590052 | 81 |
| 398 | 3300031731 | Ga0307405_10040508 | Ga0307405_100405083 | 81 |
| 399 | 3300031731 | Ga0307405_10328688 | Ga0307405_103286882 | 81 |
| 400 | 3300031824 | Ga0307413_10312993 | Ga0307413_103129932 | 81 |
| 401 | 3300031824 | Ga0307413_10374377 | Ga0307413_103743772 | 81 |
| 402 | 3300031824 | Ga0307413_12123355 | Ga0307413_121233551 | 81 |
| 403 | 3300031901 | Ga0307406_10704735 | Ga0307406_107047352 | 81 |
| 404 | 3300031903 | Ga0307407_10014361 | Ga0307407_100143614 | 81 |
| 405 | 3300031903 | Ga0307407_10782095 | Ga0307407_107820952 | 81 |
| 406 | 3300031903 | Ga0307407_11105397 | Ga0307407_111053972 | 81 |
| 407 | 3300031911 | Ga0307412_10293359 | Ga0307412_102933592 | 81 |
| 408 | 3300031911 | Ga0307412_11154482 | Ga0307412_111544822 | 81 |
| 409 | 3300031995 | Ga0307409_100283138 | Ga0307409_1002831383 | 81 |
| 410 | 3300031995 | Ga0307409_101163208 | Ga0307409_1011632082 | 81 |
| 411 | 3300032002 | Ga0307416_100023618 | Ga0307416_1000236184 | 81 |
| 412 | 3300032002 | Ga0307416_100764604 | Ga0307416_1007646042 | 81 |
| 413 | 3300032002 | Ga0307416_100938285 | Ga0307416_1009382852 | 81 |
| 414 | 3300032002 | Ga0307416_102965719 | Ga0307416_1029657192 | 81 |
| 415 | 3300032002 | Ga0307416_103503215 | Ga0307416_1035032151 | 81 |
| 416 | 3300032004 | Ga0307414_10071933 | Ga0307414_100719334 | 81 |
| 417 | 3300032004 | Ga0307414_10552870 | Ga0307414_105528702 | 81 |
| 418 | 3300032004 | Ga0307414_11408706 | Ga0307414_114087062 | 81 |
| 419 | 3300032005 | Ga0307411_10048909 | Ga0307411_100489094 | 81 |
| 420 | 3300034817 | Ga0373948_0077899 | Ga0373948_0077899_180_425 | 81 |
| 421 | 3300034819 | Ga0373958_0012965 | Ga0373958_0012965_935_1180 | 81 |
| 422 | 3300035085 | Ga0373929_0169242 | Ga0373929_0169242_156_401 | 81 |
| 423 | 3300035086 | Ga0373934_0084503 | Ga0373934_0084503_194_439 | 81 |
| 424 | 3300035088 | Ga0373940_0296758 | Ga0373940_0296758_277_522 | 81 |
| 425 | 3300035090 | Ga0373949_0085729 | Ga0373949_0085729_345_590 | 81 |
| 426 | 3300035092 | Ga0373952_0082384 | Ga0373952_0082384_372_617 | 81 |
| 427 | 3300035112 | Ga0373932_0034344 | Ga0373932_0034344_907_1152 | 81 |
| 428 | 3300035114 | Ga0373939_0037499 | Ga0373939_0037499_1017_1262 | 81 |
| 429 | 3300035117 | Ga0373953_0089015 | Ga0373953_0089015_598_843 | 81 |
| 430 | 3300035121 | Ga0373960_0281323 | Ga0373960_0281323_327_572 | 81 |
| 431 | 3300035121 | Ga0373960_0323829 | Ga0373960_0323829_129_374 | 81 |
| 432 | 3300035170 | Ga0373943_0953318 | Ga0373943_0953318_196_441 | 81 |
| 433 | 3300035172 | Ga0373955_0357664 | Ga0373955_0357664_389_634 | 81 |
| 434 | 3300035172 | Ga0373955_0569201 | Ga0373955_0569201_193_438 | 81 |
| 435 | 3300035207 | Ga0373942_0382880 | Ga0373942_0382880_135_380 | 81 |
| 436 | 3300035242 | Ga0373962_0120075 | Ga0373962_0120075_418_663 | 81 |
| 437 | 3300035410 | Ga0373924_0056817 | Ga0373924_0056817_486_731 | 81 |
| 438 | 3300035691 | Ga0373931_0938970 | Ga0373931_0938970_234_479 | 81 |
| 439 | 3300035692 | Ga0373935_1141165 | Ga0373935_1141165_289_534 | 81 |
| 440 | 3300035724 | Ga0373933_0418401 | Ga0373933_0418401_207_452 | 81 |
| 441 | 3300035725 | Ga0373947_0195020 | Ga0373947_0195020_441_719 | 81 |
| 442 | 3300036401 | Ga0373937_0009015 | Ga0373937_0009015_8044_8289 | 81 |
| 443 | 3300036401 | Ga0373937_0138875 | Ga0373937_0138875_554_799 | 81 |
| 444 | 3300036401 | Ga0373937_0387114 | Ga0373937_0387114_160_417 | 81 |
| 445 | 3300037068 | Ga0373925_1597290 | Ga0373925_1597290_110_385 | 81 |
| 446 | 3300037418 | Ga0395900_0200613 | Ga0395900_0200613_1001_1246 | 81 |
| 447 | 3300038443 | Ga0395901_0944907 | Ga0395901_0944907_224_469 | 81 |
| 448 | 3300039437 | Ga0436365_1525786 | Ga0436365_1525786_38_337 | 81 |
| 449 | 3300039437 | Ga0436365_1546745 | Ga0436365_1546745_49_300 | 81 |
| 450 | 3300041406 | Ga0439439_0148137 | Ga0439439_0148137_161_406 | 81 |
| 451 | 3300041406 | Ga0439439_0276356 | Ga0439439_0276356_146_391 | 81 |
| 452 | 3300041408 | Ga0439453_0042870 | Ga0439453_0042870_203_448 | 81 |
| 453 | 3300041410 | Ga0439461_0183755 | Ga0439461_0183755_102_365 | 81 |
| 454 | 3300041441 | Ga0451787_475156 | Ga0451787_475156_307_552 | 81 |
| 455 | 3300041458 | Ga0451798_0729637 | Ga0451798_0729637_28_273 | 81 |
| 456 | 3300041505 | Ga0451849_0714227 | Ga0451849_0714227_12_257 | 81 |
| 457 | 3300041512 | Ga0451853_0161368 | Ga0451853_0161368_120_365 | 81 |
| 458 | 3300041512 | Ga0451853_0346861 | Ga0451853_0346861_464_709 | 81 |
| 459 | 3300041512 | Ga0451853_0530934 | Ga0451853_0530934_111_356 | 81 |
| 460 | 3300041997 | Ga0439431_0012921 | Ga0439431_0012921_1141_1386 | 81 |
| 461 | 3300041999 | Ga0439433_0019429 | Ga0439433_0019429_48_293 | 81 |
| 462 | 3300041999 | Ga0439433_0048069 | Ga0439433_0048069_441_686 | 81 |
| 463 | 3300042007 | Ga0439449_0021085 | Ga0439449_0021085_936_1181 | 81 |
| 464 | 3300042014 | Ga0439457_051057 | Ga0439457_051057_256_501 | 81 |
| 465 | 3300042126 | Ga0450888_026221 | Ga0450888_026221_295_540 | 81 |
| 466 | 3300042134 | Ga0450898_088715 | Ga0450898_088715_371_616 | 81 |
| 467 | 3300042134 | Ga0450898_137686 | Ga0450898_137686_258_503 | 81 |
| 468 | 3300042156 | Ga0439446_0012405 | Ga0439446_0012405_223_468 | 81 |
| 469 | 3300042156 | Ga0439446_0275066 | Ga0439446_0275066_299_544 | 81 |
| 470 | 3300042436 | Ga0439435_0074908 | Ga0439435_0074908_168_413 | 81 |
| 471 | 3300042439 | Ga0439464_0058306 | Ga0439464_0058306_107_352 | 81 |
| 472 | 3300042461 | Ga0439460_0027246 | Ga0439460_0027246_281_526 | 81 |
| 473 | 3300042530 | Ga0450916_094375 | Ga0450916_094375_214_459 | 81 |
| 474 | 3300042876 | Ga0451577_1017653 | Ga0451577_1017653_380_634 | 81 |
| 475 | 3300044673 | Ga0453683_0325763 | Ga0453683_0325763_310_555 | 81 |
| 476 | 3300045051 | Ga0451576_0245552 | Ga0451576_0245552_648_893 | 81 |
| 477 | 3300045051 | Ga0451576_0527542 | Ga0451576_0527542_323_568 | 81 |
| 478 | 3300045051 | Ga0451576_1570429 | Ga0451576_1570429_74_319 | 81 |
| 479 | 3300046454 | Ga0495592_0036800 | Ga0495592_0036800_34_282 | 81 |
| 480 | 3300046459 | Ga0495629_0087337 | Ga0495629_0087337_11_256 | 81 |
| 481 | 3300046472 | Ga0495580_0021601 | Ga0495580_0021601_947_1192 | 81 |
| 482 | 3300046473 | Ga0495582_0814597 | Ga0495582_0814597_245_490 | 81 |
| 483 | 3300046499 | Ga0495594_0347838 | Ga0495594_0347838_139_384 | 81 |
| 484 | 3300046511 | Ga0495608_0621883 | Ga0495608_0621883_381_626 | 81 |
| 485 | 3300046516 | Ga0495628_0082641 | Ga0495628_0082641_692_940 | 81 |
| 486 | 3300046517 | Ga0495630_0396827 | Ga0495630_0396827_395_640 | 81 |
| 487 | 3300046529 | Ga0495652_0358876 | Ga0495652_0358876_598_843 | 81 |
| 488 | 3300046537 | Ga0495598_0051538 | Ga0495598_0051538_524_769 | 81 |
| 489 | 3300046543 | Ga0495645_0208714 | Ga0495645_0208714_502_747 | 81 |
| 490 | 3300046559 | Ga0495667_0298389 | Ga0495667_0298389_130_375 | 81 |
| 491 | 3300046664 | Ga0495659_0010010 | Ga0495659_0010010_2172_2417 | 81 |
| 492 | 3300046664 | Ga0495659_0012078 | Ga0495659_0012078_2017_2271 | 81 |
| 493 | 3300046674 | Ga0495588_0597731 | Ga0495588_0597731_100_345 | 81 |
| 494 | 3300046675 | Ga0495657_0237651 | Ga0495657_0237651_318_563 | 81 |
| 495 | 3300046678 | Ga0495599_0016096 | Ga0495599_0016096_1704_1952 | 81 |
| 496 | 3300046679 | Ga0495623_0080316 | Ga0495623_0080316_113_358 | 81 |
| 497 | 3300046679 | Ga0495623_0399474 | Ga0495623_0399474_111_356 | 81 |
| 498 | 3300046683 | Ga0495658_0203869 | Ga0495658_0203869_786_1031 | 81 |
| 499 | 3300047318 | Ga0495636_0619271 | Ga0495636_0619271_148_393 | 81 |
| 500 | 3300047471 | Ga0495684_0053071 | Ga0495684_0053071_453_698 | 81 |
| 501 | 3300047471 | Ga0495684_0423050 | Ga0495684_0423050_457_705 | 81 |
| 502 | 3300048088 | Ga0495602_0193269 | Ga0495602_0193269_888_1133 | 81 |
| 503 | 3300048089 | Ga0495614_0425816 | Ga0495614_0425816_354_599 | 81 |
| 504 | 3300048905 | Ga0496102_0283069 | Ga0496102_0283069_338_583 | 81 |
| 505 | 3300048907 | Ga0496104_0071451 | Ga0496104_0071451_667_912 | 81 |
| 506 | 3300048907 | Ga0496104_0090082 | Ga0496104_0090082_1090_1335 | 81 |
| 507 | 3300048908 | Ga0496105_0321925 | Ga0496105_0321925_508_753 | 81 |
| 508 | 3300048908 | Ga0496105_1105393 | Ga0496105_1105393_273_548 | 81 |
| 509 | 3300048909 | Ga0496106_0313017 | Ga0496106_0313017_316_561 | 81 |
| 510 | 3300048909 | Ga0496106_1047169 | Ga0496106_1047169_232_477 | 81 |
| 511 | 3300048910 | Ga0496107_0756616 | Ga0496107_0756616_354_599 | 81 |
| 512 | 3300048911 | Ga0496108_0012146 | Ga0496108_0012146_36_281 | 81 |
| 513 | 3300048911 | Ga0496108_0126536 | Ga0496108_0126536_672_917 | 81 |
| 514 | 3300048911 | Ga0496108_0156640 | Ga0496108_0156640_1149_1394 | 81 |
| 515 | 3300048911 | Ga0496108_1424181 | Ga0496108_1424181_59_304 | 81 |
| 516 | 3300048912 | Ga0496109_0228518 | Ga0496109_0228518_416_661 | 81 |
| 517 | 3300048912 | Ga0496109_0412776 | Ga0496109_0412776_725_970 | 81 |
| 518 | 3300048912 | Ga0496109_0912318 | Ga0496109_0912318_393_638 | 81 |
| 519 | 3300048913 | Ga0496110_0065394 | Ga0496110_0065394_90_335 | 81 |
| 520 | 3300048913 | Ga0496110_0126111 | Ga0496110_0126111_257_502 | 81 |
| 521 | 3300048913 | Ga0496110_0213981 | Ga0496110_0213981_936_1181 | 81 |
| 522 | 3300048915 | Ga0496112_0123167 | Ga0496112_0123167_11_256 | 81 |
| 523 | 3300048915 | Ga0496112_0173703 | Ga0496112_0173703_61_306 | 81 |
| 524 | 3300048916 | Ga0496113_0014422 | Ga0496113_0014422_4502_4747 | 81 |
| 525 | 3300048916 | Ga0496113_0583909 | Ga0496113_0583909_305_550 | 81 |
| 526 | 3300048916 | Ga0496113_0688483 | Ga0496113_0688483_212_457 | 81 |
| 527 | 3300048917 | Ga0496114_0287977 | Ga0496114_0287977_1171_1416 | 81 |
| 528 | 3300048917 | Ga0496114_0348063 | Ga0496114_0348063_832_1077 | 81 |
| 529 | 3300048917 | Ga0496114_0713048 | Ga0496114_0713048_330_605 | 81 |
| 530 | 3300048917 | Ga0496114_1107393 | Ga0496114_1107393_50_295 | 81 |
| 531 | 3300048918 | Ga0496115_0561557 | Ga0496115_0561557_489_734 | 81 |
| 532 | 3300049568 | Ga0501031_0010734 | Ga0501031_0010734_1955_2227 | 81 |
| 533 | 3300049568 | Ga0501031_0101150 | Ga0501031_0101150_374_634 | 81 |
| 534 | 3300049568 | Ga0501031_1068027 | Ga0501031_1068027_219_464 | 81 |
| 535 | 3300049569 | Ga0501032_0006127 | Ga0501032_0006127_468_740 | 81 |
| 536 | 3300049569 | Ga0501032_0046755 | Ga0501032_0046755_1854_2114 | 81 |
| 537 | 3300049570 | Ga0501033_0090264 | Ga0501033_0090264_1280_1552 | 81 |
| 538 | 3300049571 | Ga0501034_0004095 | Ga0501034_0004095_8731_8991 | 81 |
| 539 | 3300049571 | Ga0501034_0053918 | Ga0501034_0053918_2939_3184 | 81 |
| 540 | 3300049571 | Ga0501034_0073863 | Ga0501034_0073863_676_936 | 81 |
| 541 | 3300049571 | Ga0501034_0240966 | Ga0501034_0240966_1066_1338 | 81 |
| 542 | 3300049572 | Ga0501036_0001297 | Ga0501036_0001297_3454_3726 | 81 |
| 543 | 3300049572 | Ga0501036_0021831 | Ga0501036_0021831_3019_3279 | 81 |
| 544 | 3300049572 | Ga0501036_0025319 | Ga0501036_0025319_4192_4452 | 81 |
| 545 | 3300049572 | Ga0501036_1362232 | Ga0501036_1362232_242_487 | 81 |
| 546 | 3300049573 | Ga0501037_0006772 | Ga0501037_0006772_2627_2899 | 81 |
| 547 | 3300049573 | Ga0501037_0120019 | Ga0501037_0120019_13_273 | 81 |
| 548 | 3300049574 | Ga0501038_0002744 | Ga0501038_0002744_12303_12575 | 81 |
| 549 | 3300049574 | Ga0501038_0013119 | Ga0501038_0013119_2124_2384 | 81 |
| 550 | 3300049574 | Ga0501038_0394075 | Ga0501038_0394075_401_646 | 81 |
| 551 | 3300049574 | Ga0501038_0440230 | Ga0501038_0440230_435_695 | 81 |
| 552 | 3300049575 | Ga0501039_0009837 | Ga0501039_0009837_2095_2355 | 81 |
| 553 | 3300049575 | Ga0501039_0023300 | Ga0501039_0023300_3323_3595 | 81 |
| 554 | 3300049575 | Ga0501039_0037521 | Ga0501039_0037521_2157_2417 | 81 |
| 555 | 3300049575 | Ga0501039_0089225 | Ga0501039_0089225_685_930 | 81 |
| 556 | 3300049575 | Ga0501039_0836030 | Ga0501039_0836030_310_555 | 81 |
| 557 | 3300049576 | Ga0501040_0361474 | Ga0501040_0361474_433_678 | 81 |
| 558 | 3300049577 | Ga0501041_0143166 | Ga0501041_0143166_1082_1327 | 81 |
| 559 | 3300049577 | Ga0501041_0936965 | Ga0501041_0936965_128_385 | 81 |
| 560 | 3300049578 | Ga0501042_0007620 | Ga0501042_0007620_1920_2192 | 81 |
| 561 | 3300049578 | Ga0501042_0110386 | Ga0501042_0110386_53_298 | 81 |
| 562 | 3300049578 | Ga0501042_0409899 | Ga0501042_0409899_300_560 | 81 |
| 563 | 3300049578 | Ga0501042_0574807 | Ga0501042_0574807_46_291 | 81 |
| 564 | 3300049579 | Ga0501043_0004734 | Ga0501043_0004734_1646_1918 | 81 |
| 565 | 3300049579 | Ga0501043_0007098 | Ga0501043_0007098_8522_8782 | 81 |
| 566 | 3300049579 | Ga0501043_0017348 | Ga0501043_0017348_435_695 | 81 |
| 567 | 3300049580 | Ga0501046_0003264 | Ga0501046_0003264_3918_4190 | 81 |
| 568 | 3300049580 | Ga0501046_0006325 | Ga0501046_0006325_5094_5354 | 81 |
| 569 | 3300049581 | Ga0501047_0001697 | Ga0501047_0001697_10527_10787 | 81 |
| 570 | 3300049581 | Ga0501047_0062272 | Ga0501047_0062272_2695_2967 | 81 |
| 571 | 3300049581 | Ga0501047_0173064 | Ga0501047_0173064_381_656 | 81 |
| 572 | 3300049581 | Ga0501047_0194194 | Ga0501047_0194194_1603_1863 | 81 |
| 573 | 3300049581 | Ga0501047_0407709 | Ga0501047_0407709_381_656 | 81 |
| 574 | 3300049581 | Ga0501047_0620094 | Ga0501047_0620094_370_615 | 81 |
| 575 | 3300049582 | Ga0501048_0002137 | Ga0501048_0002137_10960_11232 | 81 |
| 576 | 3300049582 | Ga0501048_0009187 | Ga0501048_0009187_4698_4958 | 81 |
| 577 | 3300049582 | Ga0501048_0041817 | Ga0501048_0041817_1791_2036 | 81 |
| 578 | 3300049582 | Ga0501048_1144200 | Ga0501048_1144200_163_408 | 81 |
| 579 | 3300049583 | Ga0501067_0008841 | Ga0501067_0008841_68_328 | 81 |
| 580 | 3300049583 | Ga0501067_0075797 | Ga0501067_0075797_1016_1288 | 81 |
| 581 | 3300049584 | Ga0501068_0002325 | Ga0501068_0002325_4652_4912 | 81 |
| 582 | 3300049584 | Ga0501068_0016131 | Ga0501068_0016131_938_1210 | 81 |
| 583 | 3300049584 | Ga0501068_0693967 | Ga0501068_0693967_298_543 | 81 |
| 584 | 3300049584 | Ga0501068_1089672 | Ga0501068_1089672_136_381 | 81 |
| 585 | 3300049585 | Ga0501069_0001824 | Ga0501069_0001824_4046_4318 | 81 |
| 586 | 3300049585 | Ga0501069_0122538 | Ga0501069_0122538_462_722 | 81 |
| 587 | 3300049585 | Ga0501069_0522413 | Ga0501069_0522413_300_551 | 81 |
| 588 | 3300049585 | Ga0501069_0839417 | Ga0501069_0839417_53_298 | 81 |
| 589 | 3300049586 | Ga0501070_0008436 | Ga0501070_0008436_3704_3976 | 81 |
| 590 | 3300049586 | Ga0501070_0145492 | Ga0501070_0145492_614_874 | 81 |
| 591 | 3300049586 | Ga0501070_0815349 | Ga0501070_0815349_246_491 | 81 |
| 592 | 3300049587 | Ga0501071_0037994 | Ga0501071_0037994_1945_2217 | 81 |
| 593 | 3300049587 | Ga0501071_0077378 | Ga0501071_0077378_81_326 | 81 |
| 594 | 3300049588 | Ga0501072_0122922 | Ga0501072_0122922_736_1008 | 81 |
| 595 | 3300049588 | Ga0501072_0435929 | Ga0501072_0435929_644_904 | 81 |
| 596 | 3300049588 | Ga0501072_0740290 | Ga0501072_0740290_213_458 | 81 |
| 597 | 3300049589 | Ga0501073_0000980 | Ga0501073_0000980_2834_3094 | 81 |
| 598 | 3300049589 | Ga0501073_0003336 | Ga0501073_0003336_9232_9504 | 81 |
| 599 | 3300049589 | Ga0501073_0064008 | Ga0501073_0064008_1318_1578 | 81 |
| 600 | 3300049590 | Ga0501074_0032568 | Ga0501074_0032568_417_689 | 81 |
| 601 | 3300049590 | Ga0501074_0333303 | Ga0501074_0333303_288_533 | 81 |
| 602 | 3300049591 | Ga0501075_0040428 | Ga0501075_0040428_1763_2008 | 81 |
| 603 | 3300049591 | Ga0501075_0187463 | Ga0501075_0187463_1140_1412 | 81 |
| 604 | 3300049591 | Ga0501075_0573496 | Ga0501075_0573496_553_798 | 81 |
| 605 | 3300049591 | Ga0501075_1185766 | Ga0501075_1185766_112_372 | 81 |
| 606 | 3300049592 | Ga0501076_0077285 | Ga0501076_0077285_1897_2142 | 81 |
| 607 | 3300049592 | Ga0501076_0197595 | Ga0501076_0197595_1247_1507 | 81 |
| 608 | 3300049592 | Ga0501076_1752817 | Ga0501076_1752817_51_311 | 81 |
| 609 | 3300049652 | Ga0501202_109058 | Ga0501202_109058_413_658 | 81 |
| 610 | 3300049658 | Ga0501211_033779 | Ga0501211_033779_309_554 | 81 |
| 611 | 3300049741 | Ga0501079_0000894 | Ga0501079_0000894_2178_2450 | 81 |
| 612 | 3300049741 | Ga0501079_0570131 | Ga0501079_0570131_144_404 | 81 |
| 613 | 3300049742 | Ga0501080_0000066 | Ga0501080_0000066_15337_15597 | 81 |
| 614 | 3300049742 | Ga0501080_0130279 | Ga0501080_0130279_1204_1449 | 81 |
| 615 | 3300049742 | Ga0501080_0237718 | Ga0501080_0237718_1262_1534 | 81 |
| 616 | 3300049742 | Ga0501080_0272207 | Ga0501080_0272207_639_905 | 81 |
| 617 | 3300049742 | Ga0501080_0456202 | Ga0501080_0456202_511_771 | 81 |
| 618 | 3300049742 | Ga0501080_1686522 | Ga0501080_1686522_45_290 | 81 |
| 619 | 3300049743 | Ga0501081_0170823 | Ga0501081_0170823_591_836 | 81 |
| 620 | 3300049743 | Ga0501081_0394786 | Ga0501081_0394786_110_370 | 81 |
| 621 | 3300049744 | Ga0501083_0016724 | Ga0501083_0016724_180_440 | 81 |
| 622 | 3300049744 | Ga0501083_0035172 | Ga0501083_0035172_2012_2284 | 81 |
| 623 | 3300049744 | Ga0501083_0231638 | Ga0501083_0231638_243_488 | 81 |
| 624 | 3300049744 | Ga0501083_0340084 | Ga0501083_0340084_447_692 | 81 |
| 625 | 3300049822 | Ga0501035_0015652 | Ga0501035_0015652_4814_5074 | 81 |
| 626 | 3300049822 | Ga0501035_0095354 | Ga0501035_0095354_1876_2148 | 81 |
| 627 | 3300049822 | Ga0501035_0099008 | Ga0501035_0099008_1613_1858 | 81 |
| 628 | 3300049822 | Ga0501035_1285766 | Ga0501035_1285766_271_531 | 81 |
| 629 | 3300049823 | Ga0501044_0003120 | Ga0501044_0003120_10615_10875 | 81 |
| 630 | 3300049823 | Ga0501044_0149288 | Ga0501044_0149288_1283_1555 | 81 |
| 631 | 3300049824 | Ga0501045_0018769 | Ga0501045_0018769_2572_2817 | 81 |
| 632 | 3300049824 | Ga0501045_0068448 | Ga0501045_0068448_2149_2421 | 81 |
| 633 | 3300049824 | Ga0501045_0504729 | Ga0501045_0504729_168_413 | 81 |
| 634 | 3300050489 | nmdc:mga03683_3512_c1 | nmdc:mga03683_3512_c1_3017_3289 | 81 |
| 635 | 3300050490 | nmdc:mga03n38_37389_c1 | nmdc:mga03n38_37389_c1_1456_1725 | 81 |
| 636 | 3300050490 | nmdc:mga03n38_381621_c1 | nmdc:mga03n38_381621_c1_318_590 | 81 |
| 637 | 3300050491 | nmdc:mga00v17_1057941_c1 | nmdc:mga00v17_1057941_c1_47_316 | 81 |
| 638 | 3300050491 | nmdc:mga00v17_22107_c1 | nmdc:mga00v17_22107_c1_1198_1470 | 81 |
| 639 | 3300050491 | nmdc:mga00v17_25358_c1 | nmdc:mga00v17_25358_c1_1598_1867 | 81 |
| 640 | 3300050491 | nmdc:mga00v17_258373_c1 | nmdc:mga00v17_258373_c1_435_695 | 81 |
| 641 | 3300050492 | nmdc:mga0yw44_1130346_c1 | nmdc:mga0yw44_1130346_c1_122_394 | 81 |
| 642 | 3300050493 | nmdc:mga0k408_57475_c1 | nmdc:mga0k408_57475_c1_932_1201 | 81 |
| 643 | 3300050493 | nmdc:mga0k408_62603_c1 | nmdc:mga0k408_62603_c1_681_953 | 81 |
| 644 | 3300050494 | nmdc:mga06z11_11344_c1 | nmdc:mga06z11_11344_c1_2498_2767 | 81 |
| 645 | 3300050494 | nmdc:mga06z11_12831_c1 | nmdc:mga06z11_12831_c1_1317_1589 | 81 |
| 646 | 3300050494 | nmdc:mga06z11_504650_c1 | nmdc:mga06z11_504650_c1_63_323 | 81 |
| 647 | 3300050494 | nmdc:mga06z11_525214_c1 | nmdc:mga06z11_525214_c1_408_677 | 81 |
| 648 | 3300050495 | nmdc:mga04h51_12269_c1 | nmdc:mga04h51_12269_c1_1794_2066 | 81 |
| 649 | 3300050495 | nmdc:mga04h51_58576_c1 | nmdc:mga04h51_58576_c1_85_354 | 81 |
| 650 | 3300050507 | nmdc:mga05p37_28413_c1 | nmdc:mga05p37_28413_c1_1654_1899 | 81 |
| 651 | 3300050507 | nmdc:mga05p37_46442_c1 | nmdc:mga05p37_46442_c1_2802_3047 | 81 |
| 652 | 3300050507 | nmdc:mga05p37_866386_c1 | nmdc:mga05p37_866386_c1_265_510 | 81 |
| 653 | 3300050507 | nmdc:mga05p37_94207_c1 | nmdc:mga05p37_94207_c1_55_300 | 81 |
| 654 | 3300050508 | nmdc:mga09592_21965_c1 | nmdc:mga09592_21965_c1_2965_3210 | 81 |
| 655 | 3300050508 | nmdc:mga09592_33805_c1 | nmdc:mga09592_33805_c1_3880_4125 | 81 |
| 656 | 3300050509 | nmdc:mga0qj67_1159618_c1 | nmdc:mga0qj67_1159618_c1_96_341 | 81 |
| 657 | 3300050509 | nmdc:mga0qj67_127923_c1 | nmdc:mga0qj67_127923_c1_1536_1781 | 81 |
| 658 | 3300050509 | nmdc:mga0qj67_798897_c1 | nmdc:mga0qj67_798897_c1_314_559 | 81 |
| 659 | 3300050510 | nmdc:mga06r32_11939_c1 | nmdc:mga06r32_11939_c1_1890_2135 | 81 |
| 660 | 3300050510 | nmdc:mga06r32_182296_c1 | nmdc:mga06r32_182296_c1_1010_1255 | 81 |
| 661 | 3300050510 | nmdc:mga06r32_522658_c1 | nmdc:mga06r32_522658_c1_436_681 | 81 |
| 662 | 3300050511 | nmdc:mga08y16_118896_c1 | nmdc:mga08y16_118896_c1_954_1199 | 81 |
| 663 | 3300050511 | nmdc:mga08y16_2554_c1 | nmdc:mga08y16_2554_c1_16629_16874 | 81 |
| 664 | 3300050511 | nmdc:mga08y16_62014_c1 | nmdc:mga08y16_62014_c1_2834_3079 | 81 |
| 665 | 3300050511 | nmdc:mga08y16_751310_c1 | nmdc:mga08y16_751310_c1_72_317 | 81 |
| 666 | 3300050511 | nmdc:mga08y16_758913_c1 | nmdc:mga08y16_758913_c1_515_769 | 81 |
| 667 | 3300050511 | nmdc:mga08y16_878093_c1 | nmdc:mga08y16_878093_c1_57_302 | 81 |
| 668 | 3300050512 | nmdc:mga0n895_1112729_c1 | nmdc:mga0n895_1112729_c1_407_652 | 81 |
| 669 | 3300050512 | nmdc:mga0n895_187087_c1 | nmdc:mga0n895_187087_c1_1626_1871 | 81 |
| 670 | 3300050512 | nmdc:mga0n895_295497_c1 | nmdc:mga0n895_295497_c1_807_1097 | 81 |
| 671 | 3300050512 | nmdc:mga0n895_95358_c1 | nmdc:mga0n895_95358_c1_691_936 | 81 |
| 672 | 3300050513 | nmdc:mga0rr50_130182_c1 | nmdc:mga0rr50_130182_c1_36_281 | 81 |
| 673 | 3300050513 | nmdc:mga0rr50_225036_c1 | nmdc:mga0rr50_225036_c1_1142_1387 | 81 |
| 674 | 3300050513 | nmdc:mga0rr50_423103_c1 | nmdc:mga0rr50_423103_c1_355_600 | 81 |
| 675 | 3300050515 | nmdc:mga0a205_14932_c1 | nmdc:mga0a205_14932_c1_3411_3656 | 81 |
| 676 | 3300050515 | nmdc:mga0a205_32867_c1 | nmdc:mga0a205_32867_c1_4088_4333 | 81 |
| 677 | 3300050515 | nmdc:mga0a205_519314_c1 | nmdc:mga0a205_519314_c1_583_828 | 81 |
| 678 | 3300050516 | nmdc:mga0sz30_456401_c1 | nmdc:mga0sz30_456401_c1_124_444 | 81 |
| 679 | 3300050516 | nmdc:mga0sz30_61594_c1 | nmdc:mga0sz30_61594_c1_205_513 | 81 |
| 680 | 3300053139 | Ga0500568_0005285 | Ga0500568_0005285_1261_1530 | 81 |
| 681 | 3300054114 | Ga0501084_0115989 | Ga0501084_0115989_840_1112 | 81 |
| 682 | 3300054114 | Ga0501084_0478743 | Ga0501084_0478743_277_537 | 81 |
| 683 | 3300054114 | Ga0501084_0614204 | Ga0501084_0614204_498_758 | 81 |
| 684 | 3300054114 | Ga0501084_1269550 | Ga0501084_1269550_147_404 | 81 |
| 685 | 3300059426 | Ga0590077_158612 | Ga0590077_158612_159_404 | 81 |
| 686 | 3300060353 | Ga0501082_0002081 | Ga0501082_0002081_1390_1662 | 81 |
| 687 | 3300060353 | Ga0501082_0004370 | Ga0501082_0004370_7407_7667 | 81 |
| 688 | 3300060353 | Ga0501082_0254868 | Ga0501082_0254868_764_1024 | 81 |
| 689 | 3300060353 | Ga0501082_0345443 | Ga0501082_0345443_367_612 | 81 |
| 690 | 3300060353 | Ga0501082_0740998 | Ga0501082_0740998_565_831 | 81 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.9226 | 1 | 81 |
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.9167 | 2 | 81 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.9121 | 1 | 81 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.9028 | 1 | 81 |
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8959 | 2 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9633 | 4 | 78 | 3.10.20.30 |
| af_A0A0B4J391_26_106_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9619 | 1 | 81 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9392 | 4 | 78 | 3.10.20.30 |
| af_I6XWG2_11_92_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9203 | 1 | 81 | 3.10.20.30 |
| af_I6XWG2_11_92_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9098 | 1 | 81 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8E0H6-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9993 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A2E4FPK8-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9993 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A2E4I8K0-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9928 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A2V8IP18-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.992 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A2V8A7K9-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9916 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar