F475460

General Info

Members Datasets Scaffolds Average Seq Length
690 386 619 153

Family's Representative Sequence

Representative Sequence 3300031595|Ga0265313_10030601|Ga0265313_100306012
Length 144
Sequence MPKIDVAAVPERKGTGYPPQFNAPCAERVRQRLGNAGGLTDFGVNLMRLPPGNWSSQRHWHSHEDEFVYVLEGELTLIEDGGDCAAFPKGTGNGHHMVNRSDAMAVYLEVGSRQPADLTTCSDIDMMSANADGRFVHKDGTPYP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
4 2512875024 Mesorhizobium loti R88b Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
8 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
9 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
10 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
11 2643221736 Bosea sp. Root483D1 Isolate Unclassified
12 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
13 2738541293 Rhizobium sp. GV031 Isolate Unclassified
14 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
15 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
16 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
17 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
18 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
19 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
20 2841760612 Bosea sp. Tri-49 Isolate Nodule
21 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
22 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
23 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
24 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
25 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
26 2844104063 Bosea sp. Tri-39 Isolate Nodule
27 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
28 2851246043 Bosea sp. Tri-54 Isolate Nodule
29 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
30 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
31 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
32 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
33 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
34 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
35 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
36 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
37 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
38 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
39 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
40 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
41 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
42 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
43 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
44 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
45 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
46 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
47 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
48 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
49 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
50 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
51 2909042592 Labrys sp. LIt4 Isolate Nodule
52 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
53 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
54 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
55 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
56 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
57 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
58 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
59 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
60 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
61 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
62 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
63 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
64 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
65 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
66 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
67 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
68 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
69 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
70 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
71 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
72 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
73 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
74 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
75 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
79 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
98 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
99 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
100 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
107 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
108 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
109 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
110 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
114 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
115 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
122 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
127 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
128 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
132 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
133 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
134 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
135 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
136 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
137 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
138 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
139 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
140 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
143 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
144 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
145 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
146 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
147 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
148 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
149 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
151 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
155 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
156 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
158 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
159 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
160 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
171 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
172 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
173 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
176 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
177 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
178 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
242 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
245 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
246 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
247 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
248 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
249 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
252 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
256 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
257 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
258 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
261 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
262 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
267 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
277 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
280 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
284 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
285 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
310 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
311 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
339 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
360 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
361 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
372 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
373 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
374 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
375 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
376 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
377 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
378 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
379 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
380 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
381 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
382 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
383 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
386 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.71
Metatranscriptomes 0
Isolates 10.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 7.25
Rhizoplane 4.06
Rhizosphere 76.52
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8759762 2162886011 Bacteria 1048
2 rootH1_10089477 3300003316 Bacteria 3853
3 rootH1_10187089 3300003323 Bacteria 1946
4 Ga0065712_10086956 3300005290 Bacteria 2607
5 Ga0065707_10014405 3300005295 Bacteria 1888
6 Ga0070658_10018443 3300005327 Bacteria 5586
7 Ga0070658_10053478 3300005327 Bacteria 3277
8 Ga0070658_10179056 3300005327 Bacteria 1784
9 Ga0070658_10607732 3300005327 Bacteria 948
10 Ga0070658_11095568 3300005327 Bacteria 693
11 Ga0070683_100975968 3300005329 Bacteria 813
12 Ga0070690_100001207 3300005330 Bacteria 13352
13 Ga0070690_101309311 3300005330 Bacteria 581
14 Ga0070670_100160687 3300005331 Bacteria 1947
15 Ga0070670_100182808 3300005331 Bacteria 1820
16 Ga0068869_100001173 3300005334 Bacteria 15377
17 Ga0068869_100041558 3300005334 Bacteria 3294
18 Ga0070666_10006559 3300005335 Bacteria 7150
19 Ga0070666_10107266 3300005335 Bacteria 1930
20 Ga0070666_10178562 3300005335 Bacteria 1488
21 Ga0070680_100000100 3300005336 Bacteria 49540
22 Ga0070680_100031230 3300005336 Bacteria 4282
23 Ga0068868_100030920 3300005338 Bacteria 4108
24 Ga0070660_100026765 3300005339 Bacteria 4297
25 Ga0070660_100060488 3300005339 Bacteria 2940
26 Ga0070660_100492611 3300005339 Bacteria 1019
27 Ga0070689_100004919 3300005340 Bacteria 9067
28 Ga0070687_100001063 3300005343 Bacteria 9398
29 Ga0070668_100595548 3300005347 Bacteria 966
30 Ga0070668_101198339 3300005347 Bacteria 688
31 Ga0070675_100004592 3300005354 Bacteria 10544
32 Ga0070671_100013931 3300005355 Bacteria 6489
33 Ga0070671_100025224 3300005355 Bacteria 4877
34 Ga0070671_100570320 3300005355 Bacteria 977
35 Ga0070674_100048580 3300005356 Bacteria 2913
36 Ga0070674_100078461 3300005356 Bacteria 2353
37 Ga0070673_100017107 3300005364 Bacteria 5146
38 Ga0070688_100011830 3300005365 Bacteria 4866
39 Ga0070688_101139585 3300005365 Bacteria 625
40 Ga0070659_100004294 3300005366 Bacteria 10174
41 Ga0070667_100071415 3300005367 Bacteria 2956
42 Ga0070667_100198212 3300005367 Bacteria 1781
43 Ga0070667_100316524 3300005367 Bacteria 1408
44 Ga0070667_100567637 3300005367 Bacteria 1044
45 Ga0070703_10330955 3300005406 Bacteria 644
46 Ga0070713_100106481 3300005436 Bacteria 2438
47 Ga0070701_10083096 3300005438 Bacteria 1738
48 Ga0070701_11244441 3300005438 Bacteria 530
49 Ga0070711_100110907 3300005439 Bacteria 2014
50 Ga0070700_100635299 3300005441 Bacteria 841
51 Ga0070694_100074610 3300005444 Bacteria 2345
52 Ga0070694_100245939 3300005444 Bacteria 1351
53 Ga0070663_100344216 3300005455 Bacteria 1205
54 Ga0070663_100521898 3300005455 Bacteria 989
55 Ga0070663_100946631 3300005455 Bacteria 746
56 Ga0070678_100359171 3300005456 Bacteria 1255
57 Ga0070678_100488187 3300005456 Bacteria 1085
58 Ga0070662_100002203 3300005457 Bacteria 11957
59 Ga0070662_100205085 3300005457 Bacteria 1566
60 Ga0070662_101321290 3300005457 Bacteria 621
61 Ga0070681_10000003 3300005458 Bacteria 252785
62 Ga0070681_10011899 3300005458 Bacteria 8627
63 Ga0070681_10012589 3300005458 Bacteria 8394
64 Ga0070681_10572466 3300005458 Bacteria 1043
65 Ga0068867_100009429 3300005459 Bacteria 6885
66 Ga0070685_10144993 3300005466 Bacteria 1499
67 Ga0070706_100256157 3300005467 Bacteria 1634
68 Ga0070706_101062470 3300005467 Bacteria 746
69 Ga0070707_100962154 3300005468 Bacteria 819
70 Ga0070679_100000617 3300005530 Bacteria 30256
71 Ga0070679_100002859 3300005530 Bacteria 15691
72 Ga0070679_100134472 3300005530 Bacteria 2454
73 Ga0070679_100306407 3300005530 Bacteria 1539
74 Ga0070684_100074972 3300005535 Bacteria 2983
75 Ga0068853_100004867 3300005539 Bacteria 10441
76 Ga0068853_100746552 3300005539 Bacteria 935
77 Ga0068853_101258851 3300005539 Bacteria 715
78 Ga0070672_100005409 3300005543 Bacteria 8460
79 Ga0070672_100315141 3300005543 Bacteria 1329
80 Ga0070686_100000293 3300005544 Bacteria 33629
81 Ga0070695_100028477 3300005545 Bacteria 3467
82 Ga0070693_100215841 3300005547 Bacteria 1254
83 Ga0070665_100012379 3300005548 Bacteria 8598
84 Ga0070665_100029685 3300005548 Bacteria 5502
85 Ga0070665_100043223 3300005548 Bacteria 4529
86 Ga0070665_100076443 3300005548 Bacteria 3355
87 Ga0070665_100111711 3300005548 Bacteria 2735
88 Ga0070665_100261818 3300005548 Bacteria 1731
89 Ga0070665_101361359 3300005548 Bacteria 719
90 Ga0070704_100541308 3300005549 Bacteria 1016
91 Ga0068855_100000010 3300005563 Bacteria 246022
92 Ga0068855_100008942 3300005563 Bacteria 12108
93 Ga0068855_101441640 3300005563 Bacteria 708
94 Ga0070664_100110535 3300005564 Bacteria 2398
95 Ga0070664_100496083 3300005564 Bacteria 1125
96 Ga0068857_100040969 3300005577 Bacteria 4106
97 Ga0068857_100059009 3300005577 Bacteria 3408
98 Ga0068857_100372171 3300005577 Bacteria 1325
99 Ga0068857_100556346 3300005577 Bacteria 1081
100 Ga0068856_100246583 3300005614 Bacteria 1801
101 Ga0070702_100000359 3300005615 Bacteria 15921
102 Ga0068852_100158317 3300005616 Bacteria 2112
103 Ga0068859_100001219 3300005617 Bacteria 26247
104 Ga0068859_100011800 3300005617 Bacteria 8780
105 Ga0068859_101729843 3300005617 Bacteria 691
106 Ga0068864_100008319 3300005618 Bacteria 8558
107 Ga0068864_100241518 3300005618 Bacteria 1674
108 Ga0068866_10236126 3300005718 Bacteria 1111
109 Ga0068861_100001118 3300005719 Bacteria 16634
110 Ga0068861_100091884 3300005719 Bacteria 2397
111 Ga0068861_100126498 3300005719 Bacteria 2068
112 Ga0068861_100348850 3300005719 Bacteria 1298
113 Ga0068870_10127249 3300005840 Bacteria 1475
114 Ga0068863_100013717 3300005841 Bacteria 7812
115 Ga0068863_100052578 3300005841 Bacteria 3860
116 Ga0068863_101424819 3300005841 Bacteria 701
117 Ga0068858_100003828 3300005842 Bacteria 14879
118 Ga0068858_100073512 3300005842 Bacteria 3173
119 Ga0068860_100000274 3300005843 Bacteria 75310
120 Ga0068860_100029840 3300005843 Bacteria 5246
121 Ga0068860_100418628 3300005843 Bacteria 1328
122 Ga0068862_100018205 3300005844 Bacteria 5848
123 Ga0068862_100020732 3300005844 Bacteria 5490
124 Ga0068862_100045872 3300005844 Bacteria 3730
125 Ga0068862_100439597 3300005844 Bacteria 1227
126 Ga0081455_10054938 3300005937 Bacteria 3390
127 Ga0081455_10258515 3300005937 Bacteria 1269
128 Ga0081540_1000213 3300005983 Bacteria 61164
129 Ga0081540_1163641 3300005983 Bacteria 859
130 Ga0070717_10076467 3300006028 Bacteria 2802
131 Ga0075363_100443865 3300006048 Bacteria 766
132 Ga0075364_10031574 3300006051 Bacteria 3403
133 Ga0070712_100715148 3300006175 Bacteria 855
134 Ga0075367_10036025 3300006178 Bacteria 2867
135 Ga0075367_10126195 3300006178 Bacteria 1579
136 Ga0075367_10626924 3300006178 Bacteria 683
137 Ga0097621_100000341 3300006237 Bacteria 31966
138 Ga0097621_100099829 3300006237 Bacteria 2441
139 Ga0097621_100252420 3300006237 Bacteria 1545
140 Ga0097621_100302987 3300006237 Bacteria 1412
141 Ga0068871_100000340 3300006358 Bacteria 32379
142 Ga0068871_100052366 3300006358 Bacteria 3306
143 Ga0075428_100041639 3300006844 Bacteria 5050
144 Ga0075428_100127042 3300006844 Bacteria 2774
145 Ga0075428_100279966 3300006844 Bacteria 1795
146 Ga0075430_100004465 3300006846 Bacteria 11801
147 Ga0075430_100024970 3300006846 Bacteria 5083
148 Ga0075430_100026810 3300006846 Bacteria 4901
149 Ga0075430_100274244 3300006846 Bacteria 1396
150 Ga0075431_100008217 3300006847 Bacteria 10430
151 Ga0075431_100270157 3300006847 Bacteria 1723
152 Ga0075431_100323820 3300006847 Bacteria 1554
153 Ga0075434_100316477 3300006871 Bacteria 1581
154 Ga0075429_100048877 3300006880 Bacteria 3678
155 Ga0075429_100854497 3300006880 Bacteria 797
156 Ga0068865_100039024 3300006881 Bacteria 3219
157 Ga0068865_100046840 3300006881 Bacteria 2968
158 Ga0068865_100287014 3300006881 Bacteria 1312
159 Ga0075436_101278117 3300006914 Bacteria 555
160 Ga0097620_100001219 3300006931 Bacteria 26247
161 Ga0097620_100011800 3300006931 Bacteria 8780
162 Ga0097620_101729808 3300006931 Bacteria 691
163 Ga0075435_100925174 3300007076 Bacteria 761
164 Ga0099795_10319566 3300007788 Bacteria 687
165 Ga0105240_10004725 3300009093 Bacteria 20555
166 Ga0105240_10209355 3300009093 Bacteria 2280
167 Ga0105240_10329580 3300009093 Bacteria 1738
168 Ga0111539_10119717 3300009094 Bacteria 3085
169 Ga0111539_10131475 3300009094 Bacteria 2931
170 Ga0111539_10184948 3300009094 Bacteria 2433
171 Ga0111539_10727918 3300009094 Bacteria 1155
172 Ga0105245_10648350 3300009098 Bacteria 1086
173 Ga0105245_11170708 3300009098 Bacteria 816
174 Ga0105247_10074249 3300009101 Bacteria 2132
175 Ga0105247_10141377 3300009101 Bacteria 1578
176 Ga0114129_10020069 3300009147 Bacteria 9512
177 Ga0114129_10651127 3300009147 Bacteria 1360
178 Ga0105241_10920612 3300009174 Bacteria 813
179 Ga0105242_10235070 3300009176 Bacteria 1644
180 Ga0105248_10002894 3300009177 Bacteria 19051
181 Ga0105248_10121436 3300009177 Bacteria 2947
182 Ga0105248_10304272 3300009177 Bacteria 1795
183 Ga0105248_10329928 3300009177 Bacteria 1718
184 Ga0105248_10421296 3300009177 Bacteria 1504
185 Ga0105248_11630474 3300009177 Bacteria 731
186 Ga0105238_10011351 3300009551 Bacteria 8964
187 Ga0105238_10126632 3300009551 Bacteria 2532
188 Ga0105238_10182225 3300009551 Bacteria 2077
189 Ga0105238_10211660 3300009551 Bacteria 1915
190 Ga0105238_10298174 3300009551 Bacteria 1595
191 Ga0105238_10599671 3300009551 Bacteria 1109
192 Ga0105238_10884063 3300009551 Bacteria 911
193 Ga0105249_10025505 3300009553 Bacteria 5322
194 Ga0105249_10290638 3300009553 Bacteria 1636
195 Ga0105249_10473084 3300009553 Bacteria 1295
196 Ga0105249_10874250 3300009553 Bacteria 965
197 Ga0105239_10012604 3300010375 Bacteria 9407
198 Ga0105239_10094436 3300010375 Bacteria 3304
199 Ga0105239_10328803 3300010375 Bacteria 1724
200 Ga0105239_10335653 3300010375 Bacteria 1705
201 Ga0105246_10610098 3300011119 Bacteria 944
202 Ga0157370_10193841 3300013104 Bacteria 1886
203 Ga0157370_10286872 3300013104 Bacteria 1521
204 Ga0157369_10084640 3300013105 Bacteria 3389
205 Ga0157374_10049581 3300013296 Bacteria 3900
206 Ga0157374_11173703 3300013296 Bacteria 789
207 Ga0157378_10076390 3300013297 Bacteria 3018
208 Ga0163162_10013049 3300013306 Bacteria 8110
209 Ga0163162_10062320 3300013306 Bacteria 3769
210 Ga0157372_10376723 3300013307 Bacteria 1654
211 Ga0157372_10813557 3300013307 Bacteria 1085
212 Ga0157375_10785046 3300013308 Bacteria 1102
213 Ga0157375_10921739 3300013308 Bacteria 1017
214 Ga0163163_10000548 3300014325 Bacteria 32947
215 Ga0163163_10181871 3300014325 Bacteria 2150
216 Ga0163163_10267305 3300014325 Bacteria 1761
217 Ga0163163_10274437 3300014325 Bacteria 1737
218 Ga0163163_11401241 3300014325 Bacteria 761
219 Ga0157380_10008474 3300014326 Bacteria 7343
220 Ga0157380_10015389 3300014326 Bacteria 5622
221 Ga0157380_10173711 3300014326 Bacteria 1886
222 Ga0157380_10654123 3300014326 Bacteria 1049
223 Ga0157377_10020163 3300014745 Bacteria 3490
224 Ga0157379_10002565 3300014968 Bacteria 15242
225 Ga0157379_10062422 3300014968 Bacteria 3332
226 Ga0157379_10104112 3300014968 Bacteria 2547
227 Ga0157379_11395960 3300014968 Bacteria 679
228 Ga0157376_10187475 3300014969 Bacteria 1895
229 Ga0157376_10829731 3300014969 Bacteria 939
230 Ga0183361_10019 3300016635 Bacteria 129849
231 Ga0163161_10024154 3300017792 Bacteria 4293
232 Ga0163161_10504879 3300017792 Bacteria 985
233 Ga0213876_10000199 3300021384 Bacteria 61562
234 Ga0207697_10181202 3300025315 Bacteria 923
235 Ga0207692_10595713 3300025898 Bacteria 710
236 Ga0207642_10244627 3300025899 Bacteria 1015
237 Ga0207642_10278944 3300025899 Bacteria 960
238 Ga0207710_10229939 3300025900 Bacteria 923
239 Ga0207680_10088475 3300025903 Bacteria 1964
240 Ga0207680_10235683 3300025903 Bacteria 1259
241 Ga0207680_10302089 3300025903 Bacteria 1116
242 Ga0207647_10160107 3300025904 Bacteria 1313
243 Ga0207699_10325280 3300025906 Bacteria 1080
244 Ga0207643_10222552 3300025908 Bacteria 1155
245 Ga0207705_10000629 3300025909 Bacteria 29508
246 Ga0207705_10058035 3300025909 Bacteria 2792
247 Ga0207705_10325429 3300025909 Bacteria 1182
248 Ga0207684_10203249 3300025910 Bacteria 1709
249 Ga0207654_10221975 3300025911 Bacteria 1254
250 Ga0207654_10911827 3300025911 Bacteria 637
251 Ga0207707_10000001 3300025912 Bacteria 1212482
252 Ga0207707_10002401 3300025912 Bacteria 16856
253 Ga0207707_10005879 3300025912 Bacteria 10725
254 Ga0207707_10466337 3300025912 Bacteria 1080
255 Ga0207707_10560057 3300025912 Bacteria 970
256 Ga0207695_10029064 3300025913 Bacteria 6117
257 Ga0207695_10167457 3300025913 Bacteria 2125
258 Ga0207695_10576283 3300025913 Bacteria 1007
259 Ga0207671_10164666 3300025914 Bacteria 1719
260 Ga0207671_10201689 3300025914 Bacteria 1554
261 Ga0207671_10367040 3300025914 Bacteria 1143
262 Ga0207660_10000896 3300025917 Bacteria 19600
263 Ga0207660_10006202 3300025917 Bacteria 7764
264 Ga0207662_10002950 3300025918 Bacteria 8646
265 Ga0207657_10000704 3300025919 Bacteria 35496
266 Ga0207657_10021074 3300025919 Bacteria 6143
267 Ga0207649_10043363 3300025920 Bacteria 2750
268 Ga0207649_10119173 3300025920 Bacteria 1777
269 Ga0207649_11373267 3300025920 Bacteria 559
270 Ga0207652_10000413 3300025921 Bacteria 44358
271 Ga0207652_10023321 3300025921 Bacteria 5125
272 Ga0207652_10028700 3300025921 Bacteria 4645
273 Ga0207652_10856262 3300025921 Bacteria 805
274 Ga0207681_10122713 3300025923 Bacteria 1908
275 Ga0207681_10624552 3300025923 Bacteria 892
276 Ga0207694_10000011 3300025924 Bacteria 417640
277 Ga0207694_10254856 3300025924 Bacteria 1436
278 Ga0207694_10367244 3300025924 Bacteria 1193
279 Ga0207650_10119176 3300025925 Bacteria 2052
280 Ga0207659_10066296 3300025926 Bacteria 2620
281 Ga0207659_10651928 3300025926 Bacteria 900
282 Ga0207687_10789665 3300025927 Bacteria 809
283 Ga0207700_10030609 3300025928 Bacteria 3813
284 Ga0207644_10051159 3300025931 Bacteria 2964
285 Ga0207690_10003837 3300025932 Bacteria 8896
286 Ga0207706_10003404 3300025933 Bacteria 15195
287 Ga0207706_10173125 3300025933 Bacteria 1897
288 Ga0207706_10860108 3300025933 Bacteria 768
289 Ga0207686_10035895 3300025934 Bacteria 2979
290 Ga0207686_10047226 3300025934 Bacteria 2661
291 Ga0207670_10004061 3300025936 Bacteria 7836
292 Ga0207669_10027195 3300025937 Bacteria 3127
293 Ga0207669_10058927 3300025937 Bacteria 2346
294 Ga0207669_10266878 3300025937 Bacteria 1283
295 Ga0207704_10022596 3300025938 Bacteria 3374
296 Ga0207704_10139647 3300025938 Bacteria 1693
297 Ga0207704_10254216 3300025938 Bacteria 1321
298 Ga0207665_10192047 3300025939 Bacteria 1484
299 Ga0207691_10035234 3300025940 Bacteria 4647
300 Ga0207711_10094029 3300025941 Bacteria 2641
301 Ga0207711_10164032 3300025941 Bacteria 2013
302 Ga0207711_10853675 3300025941 Bacteria 847
303 Ga0207689_10005748 3300025942 Bacteria 11016
304 Ga0207689_10567411 3300025942 Bacteria 954
305 Ga0207661_10432669 3300025944 Bacteria 1196
306 Ga0207679_10007930 3300025945 Bacteria 6750
307 Ga0207679_10289559 3300025945 Bacteria 1407
308 Ga0207679_10536715 3300025945 Bacteria 1048
309 Ga0207667_10000093 3300025949 Bacteria 145814
310 Ga0207667_10001457 3300025949 Bacteria 29683
311 Ga0207667_10512953 3300025949 Bacteria 1215
312 Ga0207667_11503743 3300025949 Bacteria 644
313 Ga0207651_10053897 3300025960 Bacteria 2752
314 Ga0207712_10137029 3300025961 Bacteria 1873
315 Ga0207712_10197782 3300025961 Bacteria 1591
316 Ga0207712_10318710 3300025961 Bacteria 1282
317 Ga0207712_10399597 3300025961 Bacteria 1155
318 Ga0207712_11268081 3300025961 Bacteria 658
319 Ga0207668_10332320 3300025972 Bacteria 1265
320 Ga0207668_11088671 3300025972 Bacteria 716
321 Ga0207640_10304524 3300025981 Bacteria 1262
322 Ga0207640_10505077 3300025981 Bacteria 1008
323 Ga0207658_10052026 3300025986 Bacteria 3021
324 Ga0207658_10480778 3300025986 Bacteria 1104
325 Ga0207677_10056319 3300026023 Bacteria 2693
326 Ga0207677_10070969 3300026023 Bacteria 2457
327 Ga0207703_10000667 3300026035 Bacteria 34257
328 Ga0207703_10054479 3300026035 Bacteria 3252
329 Ga0207703_10061260 3300026035 Bacteria 3080
330 Ga0207703_10545256 3300026035 Bacteria 1093
331 Ga0207639_10008663 3300026041 Bacteria 6981
332 Ga0207678_10017343 3300026067 Bacteria 6321
333 Ga0207678_10142098 3300026067 Bacteria 2049
334 Ga0207678_10143698 3300026067 Bacteria 2036
335 Ga0207678_11183120 3300026067 Bacteria 677
336 Ga0207708_10082817 3300026075 Bacteria 2467
337 Ga0207708_10740723 3300026075 Bacteria 843
338 Ga0207702_10229681 3300026078 Bacteria 1733
339 Ga0207641_10021368 3300026088 Bacteria 5319
340 Ga0207641_10047015 3300026088 Bacteria 3638
341 Ga0207641_10056202 3300026088 Bacteria 3344
342 Ga0207641_11284295 3300026088 Bacteria 732
343 Ga0207641_11582747 3300026088 Bacteria 657
344 Ga0207648_10004593 3300026089 Bacteria 14152
345 Ga0207676_10574828 3300026095 Bacteria 1079
346 Ga0207676_11076634 3300026095 Bacteria 794
347 Ga0207676_11344747 3300026095 Bacteria 710
348 Ga0207674_10052832 3300026116 Bacteria 4143
349 Ga0207674_10081965 3300026116 Bacteria 3228
350 Ga0207674_10094452 3300026116 Bacteria 2977
351 Ga0207674_10128744 3300026116 Bacteria 2496
352 Ga0207674_11885381 3300026116 Bacteria 564
353 Ga0207675_100001315 3300026118 Bacteria 24901
354 Ga0207675_100053500 3300026118 Bacteria 3766
355 Ga0207675_100162290 3300026118 Bacteria 2132
356 Ga0207675_100170388 3300026118 Bacteria 2081
357 Ga0207675_100667563 3300026118 Bacteria 1046
358 Ga0207683_10009296 3300026121 Bacteria 8374
359 Ga0207683_10024431 3300026121 Bacteria 5205
360 Ga0207683_10078454 3300026121 Bacteria 2926
361 Ga0207683_10095227 3300026121 Bacteria 2654
362 Ga0207698_10280834 3300026142 Bacteria 1540
363 Ga0209813_10054981 3300027866 Bacteria 1256
364 Ga0207428_10281415 3300027907 Bacteria 1234
365 Ga0268266_10000676 3300028379 Bacteria 46038
366 Ga0268266_10010435 3300028379 Bacteria 8116
367 Ga0268266_10014221 3300028379 Bacteria 6846
368 Ga0268266_10054459 3300028379 Bacteria 3437
369 Ga0268266_10136022 3300028379 Bacteria 2201
370 Ga0268266_10199282 3300028379 Bacteria 1831
371 Ga0268266_10215399 3300028379 Bacteria 1763
372 Ga0268265_10002175 3300028380 Bacteria 15165
373 Ga0268265_10024790 3300028380 Bacteria 4249
374 Ga0268265_10276364 3300028380 Bacteria 1501
375 Ga0268265_10462639 3300028380 Bacteria 1187
376 Ga0268264_10000058 3300028381 Bacteria 308956
377 Ga0268264_10000060 3300028381 Bacteria 305056
378 Ga0268264_10072503 3300028381 Bacteria 2920
379 Ga0268264_10365408 3300028381 Bacteria 1378
380 Ga0268264_10857576 3300028381 Bacteria 910
381 Ga0265334_10030844 3300028573 Bacteria 2144
382 Ga0307517_10243806 3300028786 Bacteria 1063
383 Ga0307517_10571011 3300028786 Bacteria 562
384 Ga0265338_10001143 3300028800 Bacteria 43898
385 Ga0265338_10166873 3300028800 Bacteria 1694
386 Ga0265330_10343531 3300031235 Bacteria 630
387 Ga0265325_10000003 3300031241 Bacteria 370490
388 Ga0265325_10093846 3300031241 Bacteria 1476
389 Ga0265329_10016878 3300031242 Bacteria 2524
390 Ga0265340_10018857 3300031247 Bacteria 3555
391 Ga0265340_10054101 3300031247 Bacteria 1937
392 Ga0265339_10008231 3300031249 Bacteria 6650
393 Ga0265331_10007890 3300031250 Bacteria 6103
394 Ga0265331_10018523 3300031250 Bacteria 3608
395 Ga0265331_10027595 3300031250 Bacteria 2845
396 Ga0265316_10042338 3300031344 Bacteria 3641
397 Ga0307513_10029913 3300031456 Bacteria 6194
398 Ga0307513_10034926 3300031456 Bacteria 5633
399 Ga0307513_10098957 3300031456 Bacteria 2946
400 Ga0307509_10015345 3300031507 Bacteria 8942
401 Ga0307408_100200972 3300031548 Bacteria 1613
402 Ga0265313_10002034 3300031595 Bacteria 18144
403 Ga0265313_10003018 3300031595 Bacteria 14000
404 Ga0265313_10030601 3300031595 Bacteria 2769
405 Ga0265314_10097202 3300031711 Bacteria 1903
406 Ga0265314_10614199 3300031711 Bacteria 558
407 Ga0265342_10002356 3300031712 Bacteria 16385
408 Ga0265342_10012225 3300031712 Bacteria 5822
409 Ga0307516_10084087 3300031730 Bacteria 3022
410 Ga0307516_10094375 3300031730 Bacteria 2816
411 Ga0307405_10838922 3300031731 Bacteria 773
412 Ga0307412_10004387 3300031911 Bacteria 7866
413 Ga0307412_10143484 3300031911 Bacteria 1752
414 Ga0307409_101962692 3300031995 Bacteria 615
415 Ga0307510_10000006 3300033180 Bacteria 566474
416 Ga0307510_10045389 3300033180 Bacteria 4745
417 Ga0373940_0079961 3300035088 Bacteria 965
418 Ga0373936_0013587 3300035113 Bacteria 3107
419 Ga0373936_0263960 3300035113 Bacteria 771
420 Ga0373939_0108628 3300035114 Bacteria 963
421 Ga0373943_0564476 3300035170 Bacteria 669
422 Ga0373955_0242971 3300035172 Bacteria 1079
423 Ga0373924_0114098 3300035410 Bacteria 1170
424 Ga0373935_0705821 3300035692 Bacteria 742
425 Ga0373927_0583788 3300035695 Bacteria 739
426 Ga0395899_0000016 3300037312 Bacteria 468322
427 Ga0395899_0118364 3300037312 Bacteria 1899
428 Ga0395900_0009659 3300037418 Bacteria 9892
429 Ga0395900_0207890 3300037418 Bacteria 1977
430 Ga0395900_0472200 3300037418 Bacteria 1208
431 Ga0395898_0265652 3300037466 Bacteria 1636
432 Ga0395898_0303336 3300037466 Bacteria 1523
433 Ga0395905_0000069 3300037471 Bacteria 176869
434 Ga0395905_0090129 3300037471 Bacteria 2875
435 Ga0395905_0132645 3300037471 Bacteria 2343
436 Ga0395905_0337074 3300037471 Bacteria 1399
437 Ga0395905_0477196 3300037471 Bacteria 1146
438 Ga0395905_0511984 3300037471 Bacteria 1100
439 Ga0395901_0069562 3300038443 Bacteria 3666
440 Ga0395901_0209533 3300038443 Bacteria 2040
441 Ga0395901_0262273 3300038443 Bacteria 1798
442 Ga0436365_1372975 3300039437 Bacteria 5412
443 Ga0436365_1490174 3300039437 Bacteria 54443
444 Ga0436361_0664527 3300039447 Bacteria 1449
445 Ga0436363_1145957 3300039450 Bacteria 1982
446 Ga0439464_0150334 3300042439 Bacteria 728
447 Ga0451576_0054973 3300045051 Bacteria 4166
448 Ga0451576_1195248 3300045051 Bacteria 794
449 Ga0466958_0032020 3300045836 Bacteria 3126
450 Ga0495603_0102725 3300046455 Bacteria 1669
451 Ga0495638_0062154 3300046460 Bacteria 2306
452 Ga0495638_0071417 3300046460 Bacteria 2123
453 Ga0495641_0297233 3300046461 Bacteria 728
454 Ga0495650_0107466 3300046471 Bacteria 1040
455 Ga0495650_0269057 3300046471 Bacteria 576
456 Ga0495605_0010891 3300046474 Bacteria 5081
457 Ga0495584_0066387 3300046491 Bacteria 1814
458 Ga0495585_0011902 3300046492 Bacteria 5138
459 Ga0495596_0079222 3300046500 Bacteria 1275
460 Ga0495607_0089028 3300046501 Bacteria 1676
461 Ga0495583_0044568 3300046506 Bacteria 2056
462 Ga0495606_0001322 3300046507 Bacteria 33851
463 Ga0495606_0065099 3300046507 Bacteria 2317
464 Ga0495616_0104150 3300046513 Bacteria 1326
465 Ga0495631_0029015 3300046518 Bacteria 2520
466 Ga0495632_0008560 3300046519 Bacteria 6260
467 Ga0495632_0096025 3300046519 Bacteria 1400
468 Ga0495643_0039959 3300046522 Bacteria 2563
469 Ga0495644_0019674 3300046523 Bacteria 2578
470 Ga0495648_0060366 3300046524 Bacteria 2256
471 Ga0495642_0007283 3300046528 Bacteria 4247
472 Ga0495642_0023925 3300046528 Bacteria 2414
473 Ga0495642_0032391 3300046528 Bacteria 2097
474 Ga0495609_0072871 3300046538 Bacteria 1507
475 Ga0495597_0024058 3300046542 Bacteria 2813
476 Ga0495668_0022559 3300046616 Bacteria 3598
477 Ga0495668_0050954 3300046616 Bacteria 2293
478 Ga0495668_0183060 3300046616 Bacteria 1147
479 Ga0495668_0393483 3300046616 Bacteria 761
480 Ga0495611_0002895 3300046648 Bacteria 7656
481 Ga0495625_0113821 3300046660 Bacteria 1847
482 Ga0495625_0251596 3300046660 Bacteria 1147
483 Ga0495589_0016469 3300046794 Bacteria 3800
484 Ga0495660_0340446 3300046810 Bacteria 669
485 Ga0495636_0374405 3300047318 Bacteria 675
486 Ga0495674_0019683 3300047319 Bacteria 6261
487 Ga0495683_0006861 3300047323 Bacteria 6188
488 Ga0495677_0002863 3300047445 Bacteria 6723
489 Ga0495677_0174596 3300047445 Bacteria 832
490 Ga0495677_0255876 3300047445 Bacteria 685
491 Ga0495685_002965 3300047447 Bacteria 5373
492 Ga0495685_131461 3300047447 Bacteria 818
493 Ga0495681_0054613 3300047470 Bacteria 1866
494 Ga0495686_0005875 3300047472 Bacteria 9568
495 Ga0496100_0015643 3300048903 Bacteria 4433
496 Ga0496100_0045550 3300048903 Bacteria 2816
497 Ga0496100_0361909 3300048903 Bacteria 1098
498 Ga0496101_0056655 3300048904 Bacteria 2834
499 Ga0496101_0491896 3300048904 Bacteria 969
500 Ga0496102_0273956 3300048905 Bacteria 1591
501 Ga0496104_0001121 3300048907 Bacteria 22928
502 Ga0496105_0296556 3300048908 Bacteria 1300
503 Ga0496105_1079276 3300048908 Bacteria 597
504 Ga0496106_0506613 3300048909 Bacteria 969
505 Ga0496107_0577437 3300048910 Bacteria 832
506 Ga0496108_0049676 3300048911 Bacteria 3508
507 Ga0496108_0623182 3300048911 Bacteria 939
508 Ga0496109_0021712 3300048912 Bacteria 5681
509 Ga0496109_0109654 3300048912 Bacteria 2566
510 Ga0496110_0054366 3300048913 Bacteria 3522
511 Ga0496110_0391515 3300048913 Bacteria 1267
512 Ga0496111_0036443 3300048914 Bacteria 3517
513 Ga0496112_0069837 3300048915 Bacteria 3470
514 Ga0496112_0222889 3300048915 Bacteria 1841
515 Ga0496112_0861435 3300048915 Bacteria 829
516 Ga0496112_1221463 3300048915 Bacteria 668
517 Ga0496113_0088614 3300048916 Bacteria 2380
518 Ga0496114_0042505 3300048917 Bacteria 3768
519 Ga0496114_0059861 3300048917 Bacteria 3182
520 Ga0496114_0293527 3300048917 Unclassified 1435
521 Ga0496114_0559175 3300048917 Bacteria 1010
522 Ga0496114_0641134 3300048917 Bacteria 935
523 Ga0496116_0012102 3300048919 Bacteria 7068
524 Ga0496117_0004884 3300048920 Bacteria 14455
525 Ga0496117_0074458 3300048920 Bacteria 2260
526 Ga0496117_0187571 3300048920 Bacteria 1182
527 Ga0496118_0001630 3300048921 Bacteria 33114
528 Ga0496118_0016606 3300048921 Bacteria 6746
529 Ga0496119_0010064 3300048922 Bacteria 7996
530 Ga0496119_0054595 3300048922 Bacteria 2432
531 Ga0496119_0107977 3300048922 Bacteria 1550
532 Ga0496120_0000412 3300048923 Bacteria 68157
533 Ga0496120_0033194 3300048923 Bacteria 3103
534 Ga0496121_0007495 3300048924 Bacteria 13174
535 Ga0496121_0017037 3300048924 Bacteria 7454
536 Ga0496121_0024062 3300048924 Bacteria 5836
537 Ga0496121_0150403 3300048924 Bacteria 1714
538 Ga0496121_0245394 3300048924 Bacteria 1245
539 Ga0496122_0010791 3300048925 Bacteria 9361
540 Ga0496123_0014951 3300048926 Bacteria 6398
541 Ga0496124_0004910 3300048927 Bacteria 15361
542 Ga0496125_0001826 3300048928 Bacteria 29381
543 Ga0496126_0327021 3300048929 Bacteria 1259
544 Ga0496126_0747691 3300048929 Bacteria 755
545 Ga0496126_0839104 3300048929 Bacteria 702
546 Ga0495682_0005529 3300049460 Bacteria 5235
547 Ga0495682_0210090 3300049460 Bacteria 690
548 Ga0501032_0531808 3300049569 Bacteria 750
549 Ga0501036_0455004 3300049572 Bacteria 1066
550 Ga0501036_0498463 3300049572 Bacteria 1013
551 Ga0501037_0544197 3300049573 Bacteria 784
552 Ga0501038_0879840 3300049574 Bacteria 662
553 Ga0501039_0875531 3300049575 Bacteria 700
554 Ga0501039_1529254 3300049575 Unclassified 513
555 Ga0501041_0146184 3300049577 Bacteria 1475
556 Ga0501041_0474816 3300049577 Bacteria 795
557 Ga0501041_0769723 3300049577 Bacteria 617
558 Ga0501042_0129862 3300049578 Bacteria 1816
559 Ga0501042_0366626 3300049578 Bacteria 1042
560 Ga0501046_0462795 3300049580 Bacteria 911
561 Ga0501071_0040460 3300049587 Bacteria 3335
562 Ga0501071_0488857 3300049587 Bacteria 944
563 Ga0501072_0183838 3300049588 Bacteria 1668
564 Ga0501072_0725121 3300049588 Bacteria 781
565 Ga0501072_0790817 3300049588 Bacteria 743
566 Ga0501073_0352755 3300049589 Bacteria 1016
567 Ga0501073_0770026 3300049589 Bacteria 664
568 Ga0501075_1141726 3300049591 Bacteria 591
569 Ga0501076_0174180 3300049592 Bacteria 1754
570 Ga0501076_0293315 3300049592 Bacteria 1332
571 Ga0501076_1564974 3300049592 Bacteria 541
572 Ga0501077_0240515 3300049593 Bacteria 1151
573 Ga0501080_0624361 3300049742 Bacteria 955
574 Ga0501080_0971015 3300049742 Bacteria 738
575 Ga0501081_0430257 3300049743 Bacteria 979
576 Ga0501081_0729605 3300049743 Bacteria 744
577 Ga0501083_0317378 3300049744 Bacteria 1013
578 Ga0501035_0271002 3300049822 Unclassified 1437
579 Ga0501044_0008139 3300049823 Bacteria 11507
580 Ga0501045_0121553 3300049824 Bacteria 1939
581 Ga0501045_0987447 3300049824 Bacteria 617
582 nmdc:mga03683_20631_c1 3300050489 Bacteria 2531
583 nmdc:mga03n38_26439_c1 3300050490 Bacteria 2396
584 nmdc:mga0yw44_23265_c1 3300050492 Bacteria 3488
585 nmdc:mga06z11_164882_c1 3300050494 Bacteria 1269
586 nmdc:mga06z11_17996_c1 3300050494 Bacteria 3219
587 nmdc:mga04h51_47616_c1 3300050495 Bacteria 1425
588 nmdc:mga05p37_101701_c1 3300050507 Bacteria 3539
589 nmdc:mga05p37_270572_c1 3300050507 Bacteria 2030
590 nmdc:mga09592_796195_c1 3300050508 Bacteria 800
591 nmdc:mga0qj67_114907_c1 3300050509 Bacteria 2174
592 nmdc:mga0qj67_217374_c1 3300050509 Bacteria 1552
593 nmdc:mga0qj67_234921_c1 3300050509 Bacteria 1488
594 nmdc:mga0qj67_256711_c1 3300050509 Bacteria 1418
595 nmdc:mga06r32_41095_c1 3300050510 Archaea 4393
596 nmdc:mga06r32_42563_c1 3300050510 Bacteria 4319
597 nmdc:mga08y16_121478_c1 3300050511 Bacteria 2718
598 nmdc:mga08y16_556831_c1 3300050511 Bacteria 1160
599 nmdc:mga0n895_763360_c1 3300050512 Bacteria 959
600 nmdc:mga0n895_813131_c1 3300050512 Bacteria 924
601 nmdc:mga0a205_1169474_c1 3300050515 Bacteria 617
602 nmdc:mga0sz30_498_c1 3300050516 Bacteria 14575
603 Ga0500555_113367 3300053103 Bacteria 681
604 Ga0500591_021093 3300053115 Bacteria 3158
605 Ga0500595_096907 3300053119 Bacteria 849
606 Ga0500642_0085365 3300053130 Bacteria 1454
607 Ga0500652_144470 3300053131 Bacteria 989
608 Ga0500590_126666 3300053148 Bacteria 1188
609 Ga0500590_263529 3300053148 Bacteria 675
610 Ga0500616_0048408 3300053153 Bacteria 2254
611 Ga0500616_0098604 3300053153 Bacteria 1433
612 Ga0500627_0345838 3300053158 Bacteria 642
613 Ga0500630_079480 3300053159 Bacteria 1537
614 Ga0500639_082373 3300053163 Bacteria 1619
615 Ga0500601_000289 3300053737 Bacteria 9554
616 Ga0500661_020008 3300055283 Bacteria 1190
617 Ga0501082_0544786 3300060353 Bacteria 1015
618 Ga0501082_1306347 3300060353 Bacteria 634
619 Ga0530510_0332034 3300061734 Bacteria 1141

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031595 Ga0265313_10030601 Ga0265313_100306012 144
2 3300049569 Ga0501032_0531808 Ga0501032_0531808_259_699 145
3 3300026116 Ga0207674_11885381 Ga0207674_118853811 147
4 iso_pu_bacteria 2921643360 2921643623 147
5 3300031548 Ga0307408_100200972 Ga0307408_1002009722 148
6 3300031731 Ga0307405_10838922 Ga0307405_108389222 148
7 3300031911 Ga0307412_10143484 Ga0307412_101434842 148
8 iso_pu_bacteria 2528768022 2528852430 148
9 iso_pu_bacteria 2824671348 2824672428 148
10 iso_pu_bacteria 2824687955 2824689017 148
11 iso_pu_bacteria 2824773399 2824775438 148
12 iso_pu_bacteria 2838122688 2838123532 148
13 iso_pu_bacteria 2841949485 2841949632 148
14 iso_pu_bacteria 2841957949 2841958867 148
15 iso_pu_bacteria 2841966195 2841971860 148
16 iso_pu_bacteria 2841983080 2841983644 148
17 iso_pu_bacteria 2929615660 2929618282 148
18 iso_pu_bacteria 2929624759 2929632470 148
19 iso_pu_bacteria 2933577622 2933580210 148
20 iso_pu_bacteria 8055742211 8055746129 148
21 3300037471 Ga0395905_0090129 Ga0395905_0090129_358_807 149
22 iso_pu_bacteria 2503198000 2503200437 149
23 iso_pu_bacteria 2512875016 2512932195 149
24 iso_pu_bacteria 2512875024 2512960199 149
25 iso_pu_bacteria 2513237098 2513679132 149
26 iso_pu_bacteria 2562617112 2563063639 149
27 iso_pu_bacteria 2582581316 2585331131 149
28 iso_pu_bacteria 2643221595 2643988020 149
29 iso_pu_bacteria 2643221627 2644158187 149
30 iso_pu_bacteria 2643221736 2644745370 149
31 iso_pu_bacteria 2711768613 2713474519 149
32 iso_pu_bacteria 2738541293 2738800831 149
33 iso_pu_bacteria 2756170246 2756671897 149
34 iso_pu_bacteria 2791355123 2792752089 149
35 iso_pu_bacteria 2841760612 2841760880 149
36 iso_pu_bacteria 2844002411 2844008162 149
37 iso_pu_bacteria 2844104063 2844106537 149
38 iso_pu_bacteria 2847670302 2847675301 149
39 iso_pu_bacteria 2851246043 2851246893 149
40 iso_pu_bacteria 2856314179 2856314893 149
41 iso_pu_bacteria 2871466892 2871470247 149
42 iso_pu_bacteria 2871495908 2871502614 149
43 iso_pu_bacteria 2876363079 2876367776 149
44 iso_pu_bacteria 2876392853 2876394040 149
45 iso_pu_bacteria 2878035449 2878042136 149
46 iso_pu_bacteria 2878760144 2878766506 149
47 iso_pu_bacteria 2878767105 2878773702 149
48 iso_pu_bacteria 2881161766 2881167156 149
49 iso_pu_bacteria 2881364244 2881368644 149
50 iso_pu_bacteria 2882632389 2882640636 149
51 iso_pu_bacteria 2885305155 2885308662 149
52 iso_pu_bacteria 2885326080 2885327597 149
53 iso_pu_bacteria 2885383462 2885389287 149
54 iso_pu_bacteria 2903521522 2903521707 149
55 iso_pu_bacteria 2903528002 2903528084 149
56 iso_pu_bacteria 2903540706 2903547655 149
57 iso_pu_bacteria 2903768456 2903771057 149
58 iso_pu_bacteria 2904659560 2904660371 149
59 iso_pu_bacteria 2906378014 2906380421 149
60 iso_pu_bacteria 2906414383 2906419537 149
61 iso_pu_bacteria 2906626472 2906633970 149
62 iso_pu_bacteria 2909042592 2909045762 149
63 iso_pu_bacteria 2937994558 2938001530 149
64 iso_pu_bacteria 2958165035 2958171684 149
65 iso_pu_bacteria 2961114664 2961115696 149
66 iso_pu_bacteria 2961163497 2961170125 149
67 iso_pu_bacteria 2963644680 2963647012 149
68 iso_pu_bacteria 2965018300 2965024876 149
69 iso_pu_bacteria 2968110612 2968111429 149
70 iso_pu_bacteria 2968171901 2968178517 149
71 iso_pu_bacteria 2970554993 2970561362 149
72 iso_pu_bacteria 2977922695 2977928201 149
73 iso_pu_bacteria 2987659509 2987666366 149
74 iso_pu_bacteria 3000135777 3000139969 149
75 iso_pu_bacteria 3004188549 3004195372 149
76 iso_pu_bacteria 3004211236 3004215407 149
77 iso_pu_bacteria 3004218560 3004225750 149
78 iso_pu_bacteria 3004334049 3004335310 149
79 3300003316 rootH1_10089477 rootH1_100894772 150
80 3300005327 Ga0070658_10607732 Ga0070658_106077322 150
81 3300005336 Ga0070680_100000100 Ga0070680_10000010035 150
82 3300005347 Ga0070668_100595548 Ga0070668_1005955481 150
83 3300005355 Ga0070671_100570320 Ga0070671_1005703202 150
84 3300005439 Ga0070711_100110907 Ga0070711_1001109073 150
85 3300005457 Ga0070662_101321290 Ga0070662_1013212901 150
86 3300005458 Ga0070681_10000003 Ga0070681_1000000382 150
87 3300005530 Ga0070679_100000617 Ga0070679_10000061718 150
88 3300005543 Ga0070672_100315141 Ga0070672_1003151413 150
89 3300005548 Ga0070665_101361359 Ga0070665_1013613592 150
90 3300005564 Ga0070664_100496083 Ga0070664_1004960831 150
91 3300006178 Ga0075367_10126195 Ga0075367_101261951 150
92 3300006881 Ga0068865_100287014 Ga0068865_1002870142 150
93 3300009177 Ga0105248_11630474 Ga0105248_116304741 150
94 3300009551 Ga0105238_10884063 Ga0105238_108840631 150
95 3300013104 Ga0157370_10286872 Ga0157370_102868723 150
96 3300014325 Ga0163163_11401241 Ga0163163_114012411 150
97 3300014969 Ga0157376_10829731 Ga0157376_108297312 150
98 3300016635 Ga0183361_10019 Ga0183361_1001937 150
99 3300021384 Ga0213876_10000199 Ga0213876_1000019923 150
100 3300025898 Ga0207692_10595713 Ga0207692_105957131 150
101 3300025909 Ga0207705_10325429 Ga0207705_103254291 150
102 3300025912 Ga0207707_10000001 Ga0207707_10000001969 150
103 3300025917 Ga0207660_10006202 Ga0207660_100062021 150
104 3300025921 Ga0207652_10000413 Ga0207652_1000041341 150
105 3300025923 Ga0207681_10624552 Ga0207681_106245522 150
106 3300025933 Ga0207706_10860108 Ga0207706_108601082 150
107 3300025934 Ga0207686_10047226 Ga0207686_100472262 150
108 3300025938 Ga0207704_10254216 Ga0207704_102542162 150
109 3300025981 Ga0207640_10304524 Ga0207640_103045243 150
110 3300026023 Ga0207677_10056319 Ga0207677_100563195 150
111 3300026067 Ga0207678_10143698 Ga0207678_101436983 150
112 3300026118 Ga0207675_100053500 Ga0207675_1000535003 150
113 3300026118 Ga0207675_100162290 Ga0207675_1001622902 150
114 3300028573 Ga0265334_10030844 Ga0265334_100308442 150
115 3300028786 Ga0307517_10571011 Ga0307517_105710111 150
116 3300028800 Ga0265338_10001143 Ga0265338_1000114329 150
117 3300031235 Ga0265330_10343531 Ga0265330_103435312 150
118 3300031241 Ga0265325_10000003 Ga0265325_10000003257 150
119 3300031249 Ga0265339_10008231 Ga0265339_100082313 150
120 3300031250 Ga0265331_10007890 Ga0265331_100078906 150
121 3300031456 Ga0307513_10098957 Ga0307513_100989572 150
122 3300031507 Ga0307509_10015345 Ga0307509_100153457 150
123 3300031595 Ga0265313_10002034 Ga0265313_100020346 150
124 3300031711 Ga0265314_10097202 Ga0265314_100972023 150
125 3300031712 Ga0265342_10002356 Ga0265342_1000235613 150
126 3300035410 Ga0373924_0114098 Ga0373924_0114098_465_917 150
127 3300035692 Ga0373935_0705821 Ga0373935_0705821_260_712 150
128 3300037471 Ga0395905_0511984 Ga0395905_0511984_58_510 150
129 3300039437 Ga0436365_1490174 Ga0436365_1490174_40195_40647 150
130 3300046461 Ga0495641_0297233 Ga0495641_0297233_261_713 150
131 3300046471 Ga0495650_0107466 Ga0495650_0107466_395_847 150
132 3300046660 Ga0495625_0251596 Ga0495625_0251596_652_1104 150
133 3300047472 Ga0495686_0005875 Ga0495686_0005875_6910_7362 150
134 3300048917 Ga0496114_0059861 Ga0496114_0059861_1736_2188 150
135 3300049460 Ga0495682_0210090 Ga0495682_0210090_124_576 150
136 3300049572 Ga0501036_0455004 Ga0501036_0455004_374_829 150
137 3300049572 Ga0501036_0498463 Ga0501036_0498463_413_868 150
138 3300049573 Ga0501037_0544197 Ga0501037_0544197_138_593 150
139 3300049574 Ga0501038_0879840 Ga0501038_0879840_88_543 150
140 3300049577 Ga0501041_0146184 Ga0501041_0146184_321_776 150
141 3300049577 Ga0501041_0474816 Ga0501041_0474816_118_570 150
142 3300049577 Ga0501041_0769723 Ga0501041_0769723_74_529 150
143 3300049578 Ga0501042_0129862 Ga0501042_0129862_1195_1650 150
144 3300049578 Ga0501042_0366626 Ga0501042_0366626_58_513 150
145 3300049580 Ga0501046_0462795 Ga0501046_0462795_132_587 150
146 3300049587 Ga0501071_0040460 Ga0501071_0040460_346_801 150
147 3300049588 Ga0501072_0183838 Ga0501072_0183838_720_1175 150
148 3300049588 Ga0501072_0790817 Ga0501072_0790817_10_465 150
149 3300049591 Ga0501075_1141726 Ga0501075_1141726_38_493 150
150 3300049592 Ga0501076_0293315 Ga0501076_0293315_541_996 150
151 3300049592 Ga0501076_1564974 Ga0501076_1564974_64_519 150
152 3300049743 Ga0501081_0430257 Ga0501081_0430257_211_666 150
153 3300049743 Ga0501081_0729605 Ga0501081_0729605_46_501 150
154 3300049744 Ga0501083_0317378 Ga0501083_0317378_270_722 150
155 3300049824 Ga0501045_0987447 Ga0501045_0987447_20_475 150
156 3300050489 nmdc:mga03683_20631_c1 nmdc:mga03683_20631_c1_1581_2033 150
157 3300050490 nmdc:mga03n38_26439_c1 nmdc:mga03n38_26439_c1_32_484 150
158 3300050494 nmdc:mga06z11_164882_c1 nmdc:mga06z11_164882_c1_141_593 150
159 3300050516 nmdc:mga0sz30_498_c1 nmdc:mga0sz30_498_c1_13006_13458 150
160 3300053115 Ga0500591_021093 Ga0500591_021093_2127_2579 150
161 3300053159 Ga0500630_079480 Ga0500630_079480_826_1278 150
162 3300053163 Ga0500639_082373 Ga0500639_082373_945_1397 150
163 3300060353 Ga0501082_1306347 Ga0501082_1306347_41_493 150
164 3300005327 Ga0070658_10179056 Ga0070658_101790562 151
165 3300005327 Ga0070658_11095568 Ga0070658_110955682 151
166 3300005330 Ga0070690_101309311 Ga0070690_1013093111 151
167 3300005334 Ga0068869_100041558 Ga0068869_1000415584 151
168 3300005335 Ga0070666_10107266 Ga0070666_101072662 151
169 3300005367 Ga0070667_100316524 Ga0070667_1003165242 151
170 3300005367 Ga0070667_100567637 Ga0070667_1005676372 151
171 3300005406 Ga0070703_10330955 Ga0070703_103309551 151
172 3300005444 Ga0070694_100245939 Ga0070694_1002459392 151
173 3300005455 Ga0070663_100344216 Ga0070663_1003442163 151
174 3300005455 Ga0070663_100946631 Ga0070663_1009466312 151
175 3300005545 Ga0070695_100028477 Ga0070695_1000284772 151
176 3300005548 Ga0070665_100012379 Ga0070665_1000123798 151
177 3300005548 Ga0070665_100111711 Ga0070665_1001117112 151
178 3300005577 Ga0068857_100556346 Ga0068857_1005563462 151
179 3300005617 Ga0068859_101729843 Ga0068859_1017298432 151
180 3300005719 Ga0068861_100348850 Ga0068861_1003488502 151
181 3300005843 Ga0068860_100418628 Ga0068860_1004186282 151
182 3300005844 Ga0068862_100018205 Ga0068862_1000182055 151
183 3300006844 Ga0075428_100041639 Ga0075428_1000416398 151
184 3300006846 Ga0075430_100026810 Ga0075430_1000268106 151
185 3300006847 Ga0075431_100270157 Ga0075431_1002701572 151
186 3300006880 Ga0075429_100048877 Ga0075429_1000488772 151
187 3300006931 Ga0097620_101729808 Ga0097620_1017298081 151
188 3300009093 Ga0105240_10209355 Ga0105240_102093552 151
189 3300009093 Ga0105240_10329580 Ga0105240_103295802 151
190 3300009094 Ga0111539_10131475 Ga0111539_101314752 151
191 3300009098 Ga0105245_11170708 Ga0105245_111707082 151
192 3300009147 Ga0114129_10020069 Ga0114129_100200694 151
193 3300009174 Ga0105241_10920612 Ga0105241_109206122 151
194 3300009177 Ga0105248_10329928 Ga0105248_103299282 151
195 3300009551 Ga0105238_10599671 Ga0105238_105996712 151
196 3300009553 Ga0105249_10025505 Ga0105249_100255053 151
197 3300009553 Ga0105249_10473084 Ga0105249_104730842 151
198 3300010375 Ga0105239_10094436 Ga0105239_100944362 151
199 3300014325 Ga0163163_10274437 Ga0163163_102744372 151
200 3300014968 Ga0157379_10002565 Ga0157379_100025653 151
201 3300017792 Ga0163161_10024154 Ga0163161_100241542 151
202 3300017792 Ga0163161_10504879 Ga0163161_105048792 151
203 3300025911 Ga0207654_10221975 Ga0207654_102219752 151
204 3300025911 Ga0207654_10911827 Ga0207654_109118272 151
205 3300025913 Ga0207695_10576283 Ga0207695_105762832 151
206 3300025914 Ga0207671_10367040 Ga0207671_103670401 151
207 3300025926 Ga0207659_10651928 Ga0207659_106519282 151
208 3300025927 Ga0207687_10789665 Ga0207687_107896651 151
209 3300025937 Ga0207669_10027195 Ga0207669_100271955 151
210 3300025941 Ga0207711_10164032 Ga0207711_101640322 151
211 3300025945 Ga0207679_10536715 Ga0207679_105367152 151
212 3300025961 Ga0207712_10137029 Ga0207712_101370292 151
213 3300025961 Ga0207712_10197782 Ga0207712_101977822 151
214 3300025972 Ga0207668_10332320 Ga0207668_103323201 151
215 3300025986 Ga0207658_10480778 Ga0207658_104807782 151
216 3300026035 Ga0207703_10054479 Ga0207703_100544792 151
217 3300026035 Ga0207703_10545256 Ga0207703_105452561 151
218 3300026067 Ga0207678_10142098 Ga0207678_101420983 151
219 3300026067 Ga0207678_11183120 Ga0207678_111831202 151
220 3300026088 Ga0207641_10056202 Ga0207641_100562022 151
221 3300026121 Ga0207683_10009296 Ga0207683_1000929617 151
222 3300027907 Ga0207428_10281415 Ga0207428_102814152 151
223 3300028379 Ga0268266_10014221 Ga0268266_100142215 151
224 3300028379 Ga0268266_10199282 Ga0268266_101992822 151
225 3300028380 Ga0268265_10462639 Ga0268265_104626392 151
226 3300028381 Ga0268264_10365408 Ga0268264_103654082 151
227 3300028800 Ga0265338_10166873 Ga0265338_101668732 151
228 3300031241 Ga0265325_10093846 Ga0265325_100938462 151
229 3300031247 Ga0265340_10054101 Ga0265340_100541013 151
230 3300031250 Ga0265331_10027595 Ga0265331_100275952 151
231 3300031344 Ga0265316_10042338 Ga0265316_100423382 151
232 3300046507 Ga0495606_0001322 Ga0495606_0001322_12429_12890 151
233 3300046524 Ga0495648_0060366 Ga0495648_0060366_1221_1676 151
234 3300047319 Ga0495674_0019683 Ga0495674_0019683_3317_3772 151
235 3300047445 Ga0495677_0255876 Ga0495677_0255876_156_611 151
236 3300048913 Ga0496110_0391515 Ga0496110_0391515_773_1228 151
237 3300048917 Ga0496114_0293527 Ga0496114_0293527_457_912 151
238 3300048924 Ga0496121_0024062 Ga0496121_0024062_4475_4936 151
239 3300048929 Ga0496126_0327021 Ga0496126_0327021_525_980 151
240 3300049575 Ga0501039_1529254 Ga0501039_1529254_30_485 151
241 3300049822 Ga0501035_0271002 Ga0501035_0271002_841_1296 151
242 3300050507 nmdc:mga05p37_101701_c1 nmdc:mga05p37_101701_c1_1531_1986 151
243 3300050509 nmdc:mga0qj67_234921_c1 nmdc:mga0qj67_234921_c1_465_920 151
244 3300050510 nmdc:mga06r32_41095_c1 nmdc:mga06r32_41095_c1_2778_3233 151
245 3300050511 nmdc:mga08y16_121478_c1 nmdc:mga08y16_121478_c1_1641_2096 151
246 3300053103 Ga0500555_113367 Ga0500555_113367_169_624 151
247 3300053119 Ga0500595_096907 Ga0500595_096907_346_825 151
248 3300053130 Ga0500642_0085365 Ga0500642_0085365_552_1007 151
249 3300053153 Ga0500616_0098604 Ga0500616_0098604_421_876 151
250 3300005295 Ga0065707_10014405 Ga0065707_100144052 152
251 3300005329 Ga0070683_100975968 Ga0070683_1009759682 152
252 3300005355 Ga0070671_100013931 Ga0070671_1000139315 152
253 3300005458 Ga0070681_10012589 Ga0070681_100125893 152
254 3300005530 Ga0070679_100134472 Ga0070679_1001344723 152
255 3300005841 Ga0068863_101424819 Ga0068863_1014248192 152
256 3300005937 Ga0081455_10054938 Ga0081455_100549383 152
257 3300006880 Ga0075429_100854497 Ga0075429_1008544971 152
258 3300007076 Ga0075435_100925174 Ga0075435_1009251741 152
259 3300009093 Ga0105240_10004725 Ga0105240_1000472514 152
260 3300009176 Ga0105242_10235070 Ga0105242_102350702 152
261 3300009177 Ga0105248_10304272 Ga0105248_103042722 152
262 3300009551 Ga0105238_10298174 Ga0105238_102981742 152
263 3300011119 Ga0105246_10610098 Ga0105246_106100982 152
264 3300013104 Ga0157370_10193841 Ga0157370_101938413 152
265 3300013105 Ga0157369_10084640 Ga0157369_100846405 152
266 3300025912 Ga0207707_10002401 Ga0207707_1000240111 152
267 3300025913 Ga0207695_10029064 Ga0207695_100290648 152
268 3300025934 Ga0207686_10035895 Ga0207686_100358954 152
269 3300025945 Ga0207679_10289559 Ga0207679_102895592 152
270 3300025949 Ga0207667_10512953 Ga0207667_105129532 152
271 3300026088 Ga0207641_11284295 Ga0207641_112842952 152
272 3300026095 Ga0207676_11076634 Ga0207676_110766342 152
273 3300028381 Ga0268264_10857576 Ga0268264_108575761 152
274 3300035088 Ga0373940_0079961 Ga0373940_0079961_471_938 152
275 3300038443 Ga0395901_0069562 Ga0395901_0069562_2638_3099 152
276 3300045051 Ga0451576_1195248 Ga0451576_1195248_90_548 152
277 3300046471 Ga0495650_0269057 Ga0495650_0269057_105_563 152
278 3300046528 Ga0495642_0032391 Ga0495642_0032391_32_490 152
279 3300046616 Ga0495668_0022559 Ga0495668_0022559_1711_2169 152
280 3300046616 Ga0495668_0393483 Ga0495668_0393483_76_549 152
281 3300047447 Ga0495685_131461 Ga0495685_131461_147_605 152
282 3300048904 Ga0496101_0491896 Ga0496101_0491896_425_883 152
283 3300048907 Ga0496104_0001121 Ga0496104_0001121_19392_19853 152
284 3300048908 Ga0496105_0296556 Ga0496105_0296556_730_1191 152
285 3300048910 Ga0496107_0577437 Ga0496107_0577437_330_797 152
286 3300048911 Ga0496108_0049676 Ga0496108_0049676_1760_2221 152
287 3300048912 Ga0496109_0021712 Ga0496109_0021712_1202_1663 152
288 3300048913 Ga0496110_0054366 Ga0496110_0054366_2918_3379 152
289 3300048914 Ga0496111_0036443 Ga0496111_0036443_3031_3492 152
290 3300048915 Ga0496112_0069837 Ga0496112_0069837_2586_3047 152
291 3300048915 Ga0496112_0861435 Ga0496112_0861435_327_785 152
292 3300048915 Ga0496112_1221463 Ga0496112_1221463_62_520 152
293 3300048916 Ga0496113_0088614 Ga0496113_0088614_1454_1915 152
294 3300048917 Ga0496114_0042505 Ga0496114_0042505_3261_3719 152
295 3300048924 Ga0496121_0007495 Ga0496121_0007495_2065_2679 152
296 3300049742 Ga0501080_0624361 Ga0501080_0624361_425_883 152
297 3300049823 Ga0501044_0008139 Ga0501044_0008139_10936_11394 152
298 3300050507 nmdc:mga05p37_270572_c1 nmdc:mga05p37_270572_c1_1029_1487 152
299 3300050508 nmdc:mga09592_796195_c1 nmdc:mga09592_796195_c1_156_614 152
300 3300050512 nmdc:mga0n895_813131_c1 nmdc:mga0n895_813131_c1_297_758 152
301 3300053131 Ga0500652_144470 Ga0500652_144470_451_912 152
302 3300053148 Ga0500590_263529 Ga0500590_263529_110_568 152
303 3300053737 Ga0500601_000289 Ga0500601_000289_7414_7872 152
304 2162886011 MRS1b_contig_8759762 MRS1b_0523.00001910 153
305 3300003323 rootH1_10187089 rootH1_101870892 153
306 3300005290 Ga0065712_10086956 Ga0065712_100869566 153
307 3300005327 Ga0070658_10018443 Ga0070658_100184435 153
308 3300005327 Ga0070658_10053478 Ga0070658_100534782 153
309 3300005330 Ga0070690_100001207 Ga0070690_1000012079 153
310 3300005331 Ga0070670_100160687 Ga0070670_1001606871 153
311 3300005331 Ga0070670_100182808 Ga0070670_1001828083 153
312 3300005334 Ga0068869_100001173 Ga0068869_10000117313 153
313 3300005335 Ga0070666_10006559 Ga0070666_100065594 153
314 3300005335 Ga0070666_10178562 Ga0070666_101785622 153
315 3300005336 Ga0070680_100031230 Ga0070680_1000312301 153
316 3300005338 Ga0068868_100030920 Ga0068868_1000309209 153
317 3300005339 Ga0070660_100026765 Ga0070660_1000267655 153
318 3300005339 Ga0070660_100060488 Ga0070660_1000604882 153
319 3300005339 Ga0070660_100492611 Ga0070660_1004926112 153
320 3300005340 Ga0070689_100004919 Ga0070689_1000049199 153
321 3300005343 Ga0070687_100001063 Ga0070687_1000010633 153
322 3300005347 Ga0070668_101198339 Ga0070668_1011983391 153
323 3300005354 Ga0070675_100004592 Ga0070675_1000045929 153
324 3300005355 Ga0070671_100025224 Ga0070671_10002522410 153
325 3300005356 Ga0070674_100048580 Ga0070674_1000485804 153
326 3300005356 Ga0070674_100078461 Ga0070674_1000784612 153
327 3300005364 Ga0070673_100017107 Ga0070673_1000171077 153
328 3300005365 Ga0070688_100011830 Ga0070688_1000118306 153
329 3300005365 Ga0070688_101139585 Ga0070688_1011395851 153
330 3300005366 Ga0070659_100004294 Ga0070659_1000042944 153
331 3300005367 Ga0070667_100071415 Ga0070667_1000714154 153
332 3300005367 Ga0070667_100198212 Ga0070667_1001982124 153
333 3300005436 Ga0070713_100106481 Ga0070713_1001064812 153
334 3300005438 Ga0070701_10083096 Ga0070701_100830962 153
335 3300005438 Ga0070701_11244441 Ga0070701_112444411 153
336 3300005441 Ga0070700_100635299 Ga0070700_1006352992 153
337 3300005444 Ga0070694_100074610 Ga0070694_1000746102 153
338 3300005455 Ga0070663_100521898 Ga0070663_1005218982 153
339 3300005456 Ga0070678_100359171 Ga0070678_1003591713 153
340 3300005456 Ga0070678_100488187 Ga0070678_1004881872 153
341 3300005457 Ga0070662_100002203 Ga0070662_10000220312 153
342 3300005457 Ga0070662_100205085 Ga0070662_1002050853 153
343 3300005458 Ga0070681_10011899 Ga0070681_100118993 153
344 3300005458 Ga0070681_10572466 Ga0070681_105724662 153
345 3300005459 Ga0068867_100009429 Ga0068867_1000094299 153
346 3300005466 Ga0070685_10144993 Ga0070685_101449933 153
347 3300005467 Ga0070706_100256157 Ga0070706_1002561571 153
348 3300005467 Ga0070706_101062470 Ga0070706_1010624702 153
349 3300005468 Ga0070707_100962154 Ga0070707_1009621541 153
350 3300005530 Ga0070679_100002859 Ga0070679_10000285913 153
351 3300005530 Ga0070679_100306407 Ga0070679_1003064073 153
352 3300005535 Ga0070684_100074972 Ga0070684_1000749722 153
353 3300005539 Ga0068853_100004867 Ga0068853_1000048673 153
354 3300005539 Ga0068853_100746552 Ga0068853_1007465522 153
355 3300005539 Ga0068853_101258851 Ga0068853_1012588511 153
356 3300005543 Ga0070672_100005409 Ga0070672_1000054093 153
357 3300005544 Ga0070686_100000293 Ga0070686_10000029310 153
358 3300005547 Ga0070693_100215841 Ga0070693_1002158412 153
359 3300005548 Ga0070665_100029685 Ga0070665_1000296859 153
360 3300005548 Ga0070665_100043223 Ga0070665_1000432232 153
361 3300005548 Ga0070665_100076443 Ga0070665_1000764434 153
362 3300005548 Ga0070665_100261818 Ga0070665_1002618183 153
363 3300005549 Ga0070704_100541308 Ga0070704_1005413082 153
364 3300005563 Ga0068855_100000010 Ga0068855_10000001040 153
365 3300005563 Ga0068855_100008942 Ga0068855_1000089428 153
366 3300005563 Ga0068855_101441640 Ga0068855_1014416401 153
367 3300005564 Ga0070664_100110535 Ga0070664_1001105353 153
368 3300005577 Ga0068857_100040969 Ga0068857_1000409693 153
369 3300005577 Ga0068857_100059009 Ga0068857_1000590098 153
370 3300005577 Ga0068857_100372171 Ga0068857_1003721712 153
371 3300005614 Ga0068856_100246583 Ga0068856_1002465834 153
372 3300005615 Ga0070702_100000359 Ga0070702_1000003594 153
373 3300005616 Ga0068852_100158317 Ga0068852_1001583175 153
374 3300005617 Ga0068859_100001219 Ga0068859_10000121924 153
375 3300005617 Ga0068859_100011800 Ga0068859_1000118008 153
376 3300005618 Ga0068864_100008319 Ga0068864_10000831910 153
377 3300005618 Ga0068864_100241518 Ga0068864_1002415183 153
378 3300005718 Ga0068866_10236126 Ga0068866_102361262 153
379 3300005719 Ga0068861_100001118 Ga0068861_1000011189 153
380 3300005719 Ga0068861_100091884 Ga0068861_1000918843 153
381 3300005719 Ga0068861_100126498 Ga0068861_1001264982 153
382 3300005840 Ga0068870_10127249 Ga0068870_101272492 153
383 3300005841 Ga0068863_100013717 Ga0068863_1000137176 153
384 3300005841 Ga0068863_100052578 Ga0068863_1000525782 153
385 3300005842 Ga0068858_100003828 Ga0068858_1000038284 153
386 3300005842 Ga0068858_100073512 Ga0068858_1000735125 153
387 3300005843 Ga0068860_100000274 Ga0068860_10000027410 153
388 3300005843 Ga0068860_100029840 Ga0068860_1000298403 153
389 3300005844 Ga0068862_100020732 Ga0068862_1000207322 153
390 3300005844 Ga0068862_100045872 Ga0068862_1000458724 153
391 3300005844 Ga0068862_100439597 Ga0068862_1004395971 153
392 3300005937 Ga0081455_10258515 Ga0081455_102585152 153
393 3300005983 Ga0081540_1000213 Ga0081540_100021359 153
394 3300005983 Ga0081540_1163641 Ga0081540_11636412 153
395 3300006028 Ga0070717_10076467 Ga0070717_100764672 153
396 3300006048 Ga0075363_100443865 Ga0075363_1004438652 153
397 3300006051 Ga0075364_10031574 Ga0075364_100315745 153
398 3300006175 Ga0070712_100715148 Ga0070712_1007151482 153
399 3300006178 Ga0075367_10036025 Ga0075367_100360253 153
400 3300006178 Ga0075367_10626924 Ga0075367_106269241 153
401 3300006237 Ga0097621_100000341 Ga0097621_10000034123 153
402 3300006237 Ga0097621_100099829 Ga0097621_1000998293 153
403 3300006237 Ga0097621_100252420 Ga0097621_1002524203 153
404 3300006237 Ga0097621_100302987 Ga0097621_1003029873 153
405 3300006358 Ga0068871_100000340 Ga0068871_1000003409 153
406 3300006358 Ga0068871_100052366 Ga0068871_1000523663 153
407 3300006844 Ga0075428_100127042 Ga0075428_1001270422 153
408 3300006844 Ga0075428_100279966 Ga0075428_1002799662 153
409 3300006846 Ga0075430_100004465 Ga0075430_1000044659 153
410 3300006846 Ga0075430_100024970 Ga0075430_1000249705 153
411 3300006846 Ga0075430_100274244 Ga0075430_1002742442 153
412 3300006847 Ga0075431_100008217 Ga0075431_1000082174 153
413 3300006847 Ga0075431_100323820 Ga0075431_1003238202 153
414 3300006871 Ga0075434_100316477 Ga0075434_1003164773 153
415 3300006881 Ga0068865_100039024 Ga0068865_1000390242 153
416 3300006881 Ga0068865_100046840 Ga0068865_1000468402 153
417 3300006914 Ga0075436_101278117 Ga0075436_1012781171 153
418 3300006931 Ga0097620_100001219 Ga0097620_10000121924 153
419 3300006931 Ga0097620_100011800 Ga0097620_1000118005 153
420 3300007788 Ga0099795_10319566 Ga0099795_103195661 153
421 3300009094 Ga0111539_10119717 Ga0111539_101197175 153
422 3300009094 Ga0111539_10184948 Ga0111539_101849484 153
423 3300009094 Ga0111539_10727918 Ga0111539_107279181 153
424 3300009098 Ga0105245_10648350 Ga0105245_106483502 153
425 3300009101 Ga0105247_10074249 Ga0105247_100742491 153
426 3300009101 Ga0105247_10141377 Ga0105247_101413772 153
427 3300009147 Ga0114129_10651127 Ga0114129_106511272 153
428 3300009177 Ga0105248_10002894 Ga0105248_1000289419 153
429 3300009177 Ga0105248_10121436 Ga0105248_101214362 153
430 3300009177 Ga0105248_10421296 Ga0105248_104212962 153
431 3300009551 Ga0105238_10011351 Ga0105238_100113519 153
432 3300009551 Ga0105238_10126632 Ga0105238_101266322 153
433 3300009551 Ga0105238_10182225 Ga0105238_101822252 153
434 3300009551 Ga0105238_10211660 Ga0105238_102116601 153
435 3300009553 Ga0105249_10290638 Ga0105249_102906383 153
436 3300009553 Ga0105249_10874250 Ga0105249_108742501 153
437 3300010375 Ga0105239_10012604 Ga0105239_100126046 153
438 3300010375 Ga0105239_10328803 Ga0105239_103288034 153
439 3300010375 Ga0105239_10335653 Ga0105239_103356532 153
440 3300013296 Ga0157374_10049581 Ga0157374_100495816 153
441 3300013296 Ga0157374_11173703 Ga0157374_111737032 153
442 3300013297 Ga0157378_10076390 Ga0157378_100763907 153
443 3300013306 Ga0163162_10013049 Ga0163162_1001304910 153
444 3300013306 Ga0163162_10062320 Ga0163162_100623202 153
445 3300013307 Ga0157372_10376723 Ga0157372_103767232 153
446 3300013307 Ga0157372_10813557 Ga0157372_108135573 153
447 3300013308 Ga0157375_10785046 Ga0157375_107850461 153
448 3300013308 Ga0157375_10921739 Ga0157375_109217392 153
449 3300014325 Ga0163163_10000548 Ga0163163_1000054832 153
450 3300014325 Ga0163163_10181871 Ga0163163_101818712 153
451 3300014325 Ga0163163_10267305 Ga0163163_102673052 153
452 3300014326 Ga0157380_10008474 Ga0157380_100084748 153
453 3300014326 Ga0157380_10015389 Ga0157380_100153895 153
454 3300014326 Ga0157380_10173711 Ga0157380_101737112 153
455 3300014326 Ga0157380_10654123 Ga0157380_106541232 153
456 3300014745 Ga0157377_10020163 Ga0157377_100201632 153
457 3300014968 Ga0157379_10062422 Ga0157379_100624223 153
458 3300014968 Ga0157379_10104112 Ga0157379_101041126 153
459 3300014968 Ga0157379_11395960 Ga0157379_113959601 153
460 3300014969 Ga0157376_10187475 Ga0157376_101874752 153
461 3300025315 Ga0207697_10181202 Ga0207697_101812022 153
462 3300025899 Ga0207642_10244627 Ga0207642_102446272 153
463 3300025899 Ga0207642_10278944 Ga0207642_102789442 153
464 3300025900 Ga0207710_10229939 Ga0207710_102299391 153
465 3300025903 Ga0207680_10088475 Ga0207680_100884753 153
466 3300025903 Ga0207680_10235683 Ga0207680_102356831 153
467 3300025903 Ga0207680_10302089 Ga0207680_103020892 153
468 3300025904 Ga0207647_10160107 Ga0207647_101601072 153
469 3300025906 Ga0207699_10325280 Ga0207699_103252802 153
470 3300025908 Ga0207643_10222552 Ga0207643_102225522 153
471 3300025909 Ga0207705_10000629 Ga0207705_100006296 153
472 3300025909 Ga0207705_10058035 Ga0207705_100580353 153
473 3300025910 Ga0207684_10203249 Ga0207684_102032492 153
474 3300025912 Ga0207707_10005879 Ga0207707_100058798 153
475 3300025912 Ga0207707_10466337 Ga0207707_104663372 153
476 3300025912 Ga0207707_10560057 Ga0207707_105600572 153
477 3300025913 Ga0207695_10167457 Ga0207695_101674571 153
478 3300025914 Ga0207671_10164666 Ga0207671_101646662 153
479 3300025914 Ga0207671_10201689 Ga0207671_102016893 153
480 3300025917 Ga0207660_10000896 Ga0207660_100008963 153
481 3300025918 Ga0207662_10002950 Ga0207662_1000295010 153
482 3300025919 Ga0207657_10000704 Ga0207657_1000070424 153
483 3300025919 Ga0207657_10021074 Ga0207657_100210747 153
484 3300025920 Ga0207649_10043363 Ga0207649_100433634 153
485 3300025920 Ga0207649_10119173 Ga0207649_101191732 153
486 3300025920 Ga0207649_11373267 Ga0207649_113732671 153
487 3300025921 Ga0207652_10023321 Ga0207652_100233215 153
488 3300025921 Ga0207652_10028700 Ga0207652_100287003 153
489 3300025921 Ga0207652_10856262 Ga0207652_108562622 153
490 3300025923 Ga0207681_10122713 Ga0207681_101227132 153
491 3300025924 Ga0207694_10000011 Ga0207694_10000011346 153
492 3300025924 Ga0207694_10254856 Ga0207694_102548562 153
493 3300025924 Ga0207694_10367244 Ga0207694_103672442 153
494 3300025925 Ga0207650_10119176 Ga0207650_101191762 153
495 3300025926 Ga0207659_10066296 Ga0207659_100662964 153
496 3300025928 Ga0207700_10030609 Ga0207700_100306092 153
497 3300025931 Ga0207644_10051159 Ga0207644_100511595 153
498 3300025932 Ga0207690_10003837 Ga0207690_100038375 153
499 3300025933 Ga0207706_10003404 Ga0207706_1000340416 153
500 3300025933 Ga0207706_10173125 Ga0207706_101731254 153
501 3300025936 Ga0207670_10004061 Ga0207670_100040619 153
502 3300025937 Ga0207669_10058927 Ga0207669_100589273 153
503 3300025937 Ga0207669_10266878 Ga0207669_102668782 153
504 3300025938 Ga0207704_10022596 Ga0207704_100225962 153
505 3300025938 Ga0207704_10139647 Ga0207704_101396473 153
506 3300025939 Ga0207665_10192047 Ga0207665_101920471 153
507 3300025940 Ga0207691_10035234 Ga0207691_100352345 153
508 3300025941 Ga0207711_10094029 Ga0207711_100940294 153
509 3300025941 Ga0207711_10853675 Ga0207711_108536752 153
510 3300025942 Ga0207689_10005748 Ga0207689_100057485 153
511 3300025942 Ga0207689_10567411 Ga0207689_105674112 153
512 3300025944 Ga0207661_10432669 Ga0207661_104326691 153
513 3300025945 Ga0207679_10007930 Ga0207679_100079307 153
514 3300025949 Ga0207667_10000093 Ga0207667_1000009328 153
515 3300025949 Ga0207667_10001457 Ga0207667_1000145724 153
516 3300025949 Ga0207667_11503743 Ga0207667_115037431 153
517 3300025960 Ga0207651_10053897 Ga0207651_100538974 153
518 3300025961 Ga0207712_10318710 Ga0207712_103187103 153
519 3300025961 Ga0207712_10399597 Ga0207712_103995971 153
520 3300025961 Ga0207712_11268081 Ga0207712_112680812 153
521 3300025972 Ga0207668_11088671 Ga0207668_110886712 153
522 3300025981 Ga0207640_10505077 Ga0207640_105050771 153
523 3300025986 Ga0207658_10052026 Ga0207658_100520264 153
524 3300026023 Ga0207677_10070969 Ga0207677_100709692 153
525 3300026035 Ga0207703_10000667 Ga0207703_1000066721 153
526 3300026035 Ga0207703_10061260 Ga0207703_100612605 153
527 3300026041 Ga0207639_10008663 Ga0207639_100086633 153
528 3300026067 Ga0207678_10017343 Ga0207678_100173437 153
529 3300026075 Ga0207708_10082817 Ga0207708_100828173 153
530 3300026075 Ga0207708_10740723 Ga0207708_107407232 153
531 3300026078 Ga0207702_10229681 Ga0207702_102296812 153
532 3300026088 Ga0207641_10021368 Ga0207641_100213683 153
533 3300026088 Ga0207641_10047015 Ga0207641_100470158 153
534 3300026088 Ga0207641_11582747 Ga0207641_115827472 153
535 3300026089 Ga0207648_10004593 Ga0207648_100045936 153
536 3300026095 Ga0207676_10574828 Ga0207676_105748281 153
537 3300026095 Ga0207676_11344747 Ga0207676_113447471 153
538 3300026116 Ga0207674_10052832 Ga0207674_100528325 153
539 3300026116 Ga0207674_10081965 Ga0207674_100819652 153
540 3300026116 Ga0207674_10094452 Ga0207674_100944525 153
541 3300026116 Ga0207674_10128744 Ga0207674_101287443 153
542 3300026118 Ga0207675_100001315 Ga0207675_10000131523 153
543 3300026118 Ga0207675_100170388 Ga0207675_1001703882 153
544 3300026118 Ga0207675_100667563 Ga0207675_1006675632 153
545 3300026121 Ga0207683_10024431 Ga0207683_100244315 153
546 3300026121 Ga0207683_10078454 Ga0207683_100784542 153
547 3300026121 Ga0207683_10095227 Ga0207683_100952274 153
548 3300026142 Ga0207698_10280834 Ga0207698_102808342 153
549 3300027866 Ga0209813_10054981 Ga0209813_100549812 153
550 3300028379 Ga0268266_10000676 Ga0268266_1000067642 153
551 3300028379 Ga0268266_10010435 Ga0268266_100104356 153
552 3300028379 Ga0268266_10054459 Ga0268266_100544594 153
553 3300028379 Ga0268266_10136022 Ga0268266_101360222 153
554 3300028379 Ga0268266_10215399 Ga0268266_102153993 153
555 3300028380 Ga0268265_10002175 Ga0268265_1000217516 153
556 3300028380 Ga0268265_10024790 Ga0268265_100247903 153
557 3300028380 Ga0268265_10276364 Ga0268265_102763642 153
558 3300028381 Ga0268264_10000058 Ga0268264_10000058261 153
559 3300028381 Ga0268264_10000060 Ga0268264_10000060255 153
560 3300028381 Ga0268264_10072503 Ga0268264_100725034 153
561 3300028786 Ga0307517_10243806 Ga0307517_102438062 153
562 3300031242 Ga0265329_10016878 Ga0265329_100168786 153
563 3300031247 Ga0265340_10018857 Ga0265340_100188573 153
564 3300031250 Ga0265331_10018523 Ga0265331_100185232 153
565 3300031456 Ga0307513_10029913 Ga0307513_100299136 153
566 3300031456 Ga0307513_10034926 Ga0307513_100349263 153
567 3300031595 Ga0265313_10003018 Ga0265313_1000301812 153
568 3300031711 Ga0265314_10614199 Ga0265314_106141991 153
569 3300031712 Ga0265342_10012225 Ga0265342_100122254 153
570 3300031730 Ga0307516_10084087 Ga0307516_100840872 153
571 3300031730 Ga0307516_10094375 Ga0307516_100943752 153
572 3300031911 Ga0307412_10004387 Ga0307412_100043872 153
573 3300031995 Ga0307409_101962692 Ga0307409_1019626921 153
574 3300033180 Ga0307510_10000006 Ga0307510_10000006236 153
575 3300033180 Ga0307510_10045389 Ga0307510_100453895 153
576 3300035113 Ga0373936_0013587 Ga0373936_0013587_989_1450 153
577 3300035113 Ga0373936_0263960 Ga0373936_0263960_59_520 153
578 3300035114 Ga0373939_0108628 Ga0373939_0108628_317_778 153
579 3300035170 Ga0373943_0564476 Ga0373943_0564476_56_517 153
580 3300035172 Ga0373955_0242971 Ga0373955_0242971_570_1031 153
581 3300035695 Ga0373927_0583788 Ga0373927_0583788_71_532 153
582 3300037312 Ga0395899_0000016 Ga0395899_0000016_62882_63343 153
583 3300037312 Ga0395899_0118364 Ga0395899_0118364_877_1338 153
584 3300037418 Ga0395900_0009659 Ga0395900_0009659_2053_2514 153
585 3300037418 Ga0395900_0207890 Ga0395900_0207890_1211_1672 153
586 3300037418 Ga0395900_0472200 Ga0395900_0472200_649_1110 153
587 3300037466 Ga0395898_0265652 Ga0395898_0265652_490_951 153
588 3300037466 Ga0395898_0303336 Ga0395898_0303336_633_1094 153
589 3300037471 Ga0395905_0000069 Ga0395905_0000069_37481_37987 153
590 3300037471 Ga0395905_0132645 Ga0395905_0132645_888_1349 153
591 3300037471 Ga0395905_0337074 Ga0395905_0337074_914_1375 153
592 3300037471 Ga0395905_0477196 Ga0395905_0477196_333_794 153
593 3300038443 Ga0395901_0209533 Ga0395901_0209533_366_827 153
594 3300038443 Ga0395901_0262273 Ga0395901_0262273_996_1457 153
595 3300039437 Ga0436365_1372975 Ga0436365_1372975_1651_2112 153
596 3300039447 Ga0436361_0664527 Ga0436361_0664527_966_1427 153
597 3300039450 Ga0436363_1145957 Ga0436363_1145957_798_1259 153
598 3300042439 Ga0439464_0150334 Ga0439464_0150334_196_657 153
599 3300045051 Ga0451576_0054973 Ga0451576_0054973_699_1160 153
600 3300045836 Ga0466958_0032020 Ga0466958_0032020_2092_2553 153
601 3300046455 Ga0495603_0102725 Ga0495603_0102725_20_616 153
602 3300046460 Ga0495638_0062154 Ga0495638_0062154_1449_1910 153
603 3300046460 Ga0495638_0071417 Ga0495638_0071417_1631_2098 153
604 3300046474 Ga0495605_0010891 Ga0495605_0010891_3500_3967 153
605 3300046491 Ga0495584_0066387 Ga0495584_0066387_665_1132 153
606 3300046492 Ga0495585_0011902 Ga0495585_0011902_3807_4274 153
607 3300046500 Ga0495596_0079222 Ga0495596_0079222_126_593 153
608 3300046501 Ga0495607_0089028 Ga0495607_0089028_716_1183 153
609 3300046506 Ga0495583_0044568 Ga0495583_0044568_475_942 153
610 3300046507 Ga0495606_0065099 Ga0495606_0065099_1747_2214 153
611 3300046513 Ga0495616_0104150 Ga0495616_0104150_720_1187 153
612 3300046518 Ga0495631_0029015 Ga0495631_0029015_255_722 153
613 3300046519 Ga0495632_0008560 Ga0495632_0008560_3775_4242 153
614 3300046519 Ga0495632_0096025 Ga0495632_0096025_292_780 153
615 3300046522 Ga0495643_0039959 Ga0495643_0039959_842_1309 153
616 3300046523 Ga0495644_0019674 Ga0495644_0019674_905_1372 153
617 3300046528 Ga0495642_0007283 Ga0495642_0007283_3245_3706 153
618 3300046528 Ga0495642_0023925 Ga0495642_0023925_1589_2056 153
619 3300046538 Ga0495609_0072871 Ga0495609_0072871_567_1034 153
620 3300046542 Ga0495597_0024058 Ga0495597_0024058_941_1408 153
621 3300046616 Ga0495668_0050954 Ga0495668_0050954_1707_2171 153
622 3300046616 Ga0495668_0183060 Ga0495668_0183060_337_804 153
623 3300046648 Ga0495611_0002895 Ga0495611_0002895_841_1308 153
624 3300046660 Ga0495625_0113821 Ga0495625_0113821_555_1022 153
625 3300046794 Ga0495589_0016469 Ga0495589_0016469_153_620 153
626 3300046810 Ga0495660_0340446 Ga0495660_0340446_145_612 153
627 3300047318 Ga0495636_0374405 Ga0495636_0374405_116_577 153
628 3300047323 Ga0495683_0006861 Ga0495683_0006861_1818_2285 153
629 3300047445 Ga0495677_0002863 Ga0495677_0002863_1487_1954 153
630 3300047445 Ga0495677_0174596 Ga0495677_0174596_99_560 153
631 3300047447 Ga0495685_002965 Ga0495685_002965_4420_4887 153
632 3300047470 Ga0495681_0054613 Ga0495681_0054613_1013_1480 153
633 3300048903 Ga0496100_0015643 Ga0496100_0015643_2525_3064 153
634 3300048903 Ga0496100_0045550 Ga0496100_0045550_35_523 153
635 3300048903 Ga0496100_0361909 Ga0496100_0361909_467_928 153
636 3300048904 Ga0496101_0056655 Ga0496101_0056655_2301_2762 153
637 3300048905 Ga0496102_0273956 Ga0496102_0273956_572_1036 153
638 3300048908 Ga0496105_1079276 Ga0496105_1079276_86_547 153
639 3300048909 Ga0496106_0506613 Ga0496106_0506613_35_496 153
640 3300048911 Ga0496108_0623182 Ga0496108_0623182_126_587 153
641 3300048912 Ga0496109_0109654 Ga0496109_0109654_2036_2497 153
642 3300048915 Ga0496112_0222889 Ga0496112_0222889_1114_1575 153
643 3300048917 Ga0496114_0559175 Ga0496114_0559175_389_850 153
644 3300048917 Ga0496114_0641134 Ga0496114_0641134_265_726 153
645 3300048919 Ga0496116_0012102 Ga0496116_0012102_791_1252 153
646 3300048920 Ga0496117_0004884 Ga0496117_0004884_12277_12738 153
647 3300048920 Ga0496117_0074458 Ga0496117_0074458_803_1264 153
648 3300048920 Ga0496117_0187571 Ga0496117_0187571_70_564 153
649 3300048921 Ga0496118_0001630 Ga0496118_0001630_27147_27608 153
650 3300048921 Ga0496118_0016606 Ga0496118_0016606_5575_6036 153
651 3300048922 Ga0496119_0010064 Ga0496119_0010064_1632_2096 153
652 3300048922 Ga0496119_0054595 Ga0496119_0054595_1047_1511 153
653 3300048922 Ga0496119_0107977 Ga0496119_0107977_260_799 153
654 3300048923 Ga0496120_0000412 Ga0496120_0000412_1814_2278 153
655 3300048923 Ga0496120_0033194 Ga0496120_0033194_2385_2924 153
656 3300048924 Ga0496121_0017037 Ga0496121_0017037_1514_1975 153
657 3300048924 Ga0496121_0150403 Ga0496121_0150403_848_1336 153
658 3300048924 Ga0496121_0245394 Ga0496121_0245394_691_1152 153
659 3300048925 Ga0496122_0010791 Ga0496122_0010791_1568_2029 153
660 3300048926 Ga0496123_0014951 Ga0496123_0014951_4465_4926 153
661 3300048927 Ga0496124_0004910 Ga0496124_0004910_12740_13201 153
662 3300048928 Ga0496125_0001826 Ga0496125_0001826_9010_9498 153
663 3300048929 Ga0496126_0747691 Ga0496126_0747691_11_499 153
664 3300048929 Ga0496126_0839104 Ga0496126_0839104_111_575 153
665 3300049460 Ga0495682_0005529 Ga0495682_0005529_2546_3013 153
666 3300049575 Ga0501039_0875531 Ga0501039_0875531_140_601 153
667 3300049587 Ga0501071_0488857 Ga0501071_0488857_410_871 153
668 3300049588 Ga0501072_0725121 Ga0501072_0725121_204_665 153
669 3300049589 Ga0501073_0352755 Ga0501073_0352755_94_555 153
670 3300049589 Ga0501073_0770026 Ga0501073_0770026_156_626 153
671 3300049592 Ga0501076_0174180 Ga0501076_0174180_1201_1671 153
672 3300049593 Ga0501077_0240515 Ga0501077_0240515_91_561 153
673 3300049742 Ga0501080_0971015 Ga0501080_0971015_224_685 153
674 3300049824 Ga0501045_0121553 Ga0501045_0121553_403_873 153
675 3300050492 nmdc:mga0yw44_23265_c1 nmdc:mga0yw44_23265_c1_350_814 153
676 3300050494 nmdc:mga06z11_17996_c1 nmdc:mga06z11_17996_c1_1823_2284 153
677 3300050495 nmdc:mga04h51_47616_c1 nmdc:mga04h51_47616_c1_259_720 153
678 3300050509 nmdc:mga0qj67_114907_c1 nmdc:mga0qj67_114907_c1_933_1394 153
679 3300050509 nmdc:mga0qj67_217374_c1 nmdc:mga0qj67_217374_c1_858_1319 153
680 3300050509 nmdc:mga0qj67_256711_c1 nmdc:mga0qj67_256711_c1_334_795 153
681 3300050510 nmdc:mga06r32_42563_c1 nmdc:mga06r32_42563_c1_2699_3160 153
682 3300050511 nmdc:mga08y16_556831_c1 nmdc:mga08y16_556831_c1_413_874 153
683 3300050512 nmdc:mga0n895_763360_c1 nmdc:mga0n895_763360_c1_137_598 153
684 3300050515 nmdc:mga0a205_1169474_c1 nmdc:mga0a205_1169474_c1_12_473 153
685 3300053148 Ga0500590_126666 Ga0500590_126666_67_528 153
686 3300053153 Ga0500616_0048408 Ga0500616_0048408_1481_1942 153
687 3300053158 Ga0500627_0345838 Ga0500627_0345838_82_543 153
688 3300055283 Ga0500661_020008 Ga0500661_020008_78_539 153
689 3300060353 Ga0501082_0544786 Ga0501082_0544786_110_571 153
690 3300061734 Ga0530510_0332034 Ga0530510_0332034_389_859 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

45

111

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9328 2 152
3h8u-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.9276 41 119
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9154 2 152
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.8996 1 120
2phd-assembly1.cif.gz_B crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8982 41 119
ID Description Score Start End Superfamily
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9159 2 152 2.60.120.10
3h8uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9048 41 119 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9005 41 120 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8957 40 121 2.60.120.10
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8941 41 119 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0A0D1V7-F1-model_v4 Transcriptional regulator 0.9976 1 150 GO:0046872
AF-A0A1I1CL46-F1-model_v4 Uncharacterized conserved protein, cupin superfamily 0.9975 1 150 GO:0046872
AF-A0A3S3F3Z2-F1-model_v4 Cupin domain-containing protein 0.997 1 150 GO:0046872
AF-A0A434VWL6-F1-model_v4 Cupin domain-containing protein 0.9968 18 153 GO:0046872
AF-A0A1C3VQV0-F1-model_v4 Uncharacterized conserved protein, cupin superfamily 0.9967 1 150 GO:0046872

Feature Viewer

pLDDT pTM Quality
96.56 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map