F475460
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 386 | 619 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300031595|Ga0265313_10030601|Ga0265313_100306012 |
| Length | 144 |
| Sequence | MPKIDVAAVPERKGTGYPPQFNAPCAERVRQRLGNAGGLTDFGVNLMRLPPGNWSSQRHWHSHEDEFVYVLEGELTLIEDGGDCAAFPKGTGNGHHMVNRSDAMAVYLEVGSRQPADLTTCSDIDMMSANADGRFVHKDGTPYP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 4 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 5 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 6 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 7 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 8 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 9 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 10 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 11 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 12 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 13 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 14 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 15 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 16 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 17 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 18 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 19 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 20 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 21 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 22 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 23 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 24 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 25 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 26 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 27 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 28 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 29 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 30 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 31 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 32 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 33 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 34 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 35 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 36 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 37 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 38 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 39 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 40 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 41 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 42 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 43 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 44 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 45 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 46 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 47 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 48 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 49 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 50 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 51 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 52 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 53 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 54 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 55 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 56 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 57 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 58 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 59 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 60 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 61 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 62 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 63 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 64 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 65 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 66 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 67 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 68 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 69 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 70 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 71 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 72 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 73 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 74 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 75 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 79 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 81 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 84 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 106 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 111 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 112 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 119 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 121 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 122 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 124 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 125 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 126 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 127 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 128 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 129 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 130 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 131 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 132 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 133 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 134 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 135 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 137 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 138 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 139 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 140 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 142 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 143 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 144 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 145 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 146 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 147 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 148 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 149 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 151 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 152 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 177 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 179 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 243 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 246 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 248 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 252 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 253 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 254 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 256 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 257 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 258 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 261 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 262 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 278 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 328 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 329 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 330 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 331 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 374 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 375 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 376 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 377 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 378 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 381 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 382 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 383 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 386 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.71 |
| Metatranscriptomes | 0 |
| Isolates | 10.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.91 |
| Nodule | 7.25 |
| Rhizoplane | 4.06 |
| Rhizosphere | 76.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_8759762 | 2162886011 | Bacteria | 1048 |
| 2 | rootH1_10089477 | 3300003316 | Bacteria | 3853 |
| 3 | rootH1_10187089 | 3300003323 | Bacteria | 1946 |
| 4 | Ga0065712_10086956 | 3300005290 | Bacteria | 2607 |
| 5 | Ga0065707_10014405 | 3300005295 | Bacteria | 1888 |
| 6 | Ga0070658_10018443 | 3300005327 | Bacteria | 5586 |
| 7 | Ga0070658_10053478 | 3300005327 | Bacteria | 3277 |
| 8 | Ga0070658_10179056 | 3300005327 | Bacteria | 1784 |
| 9 | Ga0070658_10607732 | 3300005327 | Bacteria | 948 |
| 10 | Ga0070658_11095568 | 3300005327 | Bacteria | 693 |
| 11 | Ga0070683_100975968 | 3300005329 | Bacteria | 813 |
| 12 | Ga0070690_100001207 | 3300005330 | Bacteria | 13352 |
| 13 | Ga0070690_101309311 | 3300005330 | Bacteria | 581 |
| 14 | Ga0070670_100160687 | 3300005331 | Bacteria | 1947 |
| 15 | Ga0070670_100182808 | 3300005331 | Bacteria | 1820 |
| 16 | Ga0068869_100001173 | 3300005334 | Bacteria | 15377 |
| 17 | Ga0068869_100041558 | 3300005334 | Bacteria | 3294 |
| 18 | Ga0070666_10006559 | 3300005335 | Bacteria | 7150 |
| 19 | Ga0070666_10107266 | 3300005335 | Bacteria | 1930 |
| 20 | Ga0070666_10178562 | 3300005335 | Bacteria | 1488 |
| 21 | Ga0070680_100000100 | 3300005336 | Bacteria | 49540 |
| 22 | Ga0070680_100031230 | 3300005336 | Bacteria | 4282 |
| 23 | Ga0068868_100030920 | 3300005338 | Bacteria | 4108 |
| 24 | Ga0070660_100026765 | 3300005339 | Bacteria | 4297 |
| 25 | Ga0070660_100060488 | 3300005339 | Bacteria | 2940 |
| 26 | Ga0070660_100492611 | 3300005339 | Bacteria | 1019 |
| 27 | Ga0070689_100004919 | 3300005340 | Bacteria | 9067 |
| 28 | Ga0070687_100001063 | 3300005343 | Bacteria | 9398 |
| 29 | Ga0070668_100595548 | 3300005347 | Bacteria | 966 |
| 30 | Ga0070668_101198339 | 3300005347 | Bacteria | 688 |
| 31 | Ga0070675_100004592 | 3300005354 | Bacteria | 10544 |
| 32 | Ga0070671_100013931 | 3300005355 | Bacteria | 6489 |
| 33 | Ga0070671_100025224 | 3300005355 | Bacteria | 4877 |
| 34 | Ga0070671_100570320 | 3300005355 | Bacteria | 977 |
| 35 | Ga0070674_100048580 | 3300005356 | Bacteria | 2913 |
| 36 | Ga0070674_100078461 | 3300005356 | Bacteria | 2353 |
| 37 | Ga0070673_100017107 | 3300005364 | Bacteria | 5146 |
| 38 | Ga0070688_100011830 | 3300005365 | Bacteria | 4866 |
| 39 | Ga0070688_101139585 | 3300005365 | Bacteria | 625 |
| 40 | Ga0070659_100004294 | 3300005366 | Bacteria | 10174 |
| 41 | Ga0070667_100071415 | 3300005367 | Bacteria | 2956 |
| 42 | Ga0070667_100198212 | 3300005367 | Bacteria | 1781 |
| 43 | Ga0070667_100316524 | 3300005367 | Bacteria | 1408 |
| 44 | Ga0070667_100567637 | 3300005367 | Bacteria | 1044 |
| 45 | Ga0070703_10330955 | 3300005406 | Bacteria | 644 |
| 46 | Ga0070713_100106481 | 3300005436 | Bacteria | 2438 |
| 47 | Ga0070701_10083096 | 3300005438 | Bacteria | 1738 |
| 48 | Ga0070701_11244441 | 3300005438 | Bacteria | 530 |
| 49 | Ga0070711_100110907 | 3300005439 | Bacteria | 2014 |
| 50 | Ga0070700_100635299 | 3300005441 | Bacteria | 841 |
| 51 | Ga0070694_100074610 | 3300005444 | Bacteria | 2345 |
| 52 | Ga0070694_100245939 | 3300005444 | Bacteria | 1351 |
| 53 | Ga0070663_100344216 | 3300005455 | Bacteria | 1205 |
| 54 | Ga0070663_100521898 | 3300005455 | Bacteria | 989 |
| 55 | Ga0070663_100946631 | 3300005455 | Bacteria | 746 |
| 56 | Ga0070678_100359171 | 3300005456 | Bacteria | 1255 |
| 57 | Ga0070678_100488187 | 3300005456 | Bacteria | 1085 |
| 58 | Ga0070662_100002203 | 3300005457 | Bacteria | 11957 |
| 59 | Ga0070662_100205085 | 3300005457 | Bacteria | 1566 |
| 60 | Ga0070662_101321290 | 3300005457 | Bacteria | 621 |
| 61 | Ga0070681_10000003 | 3300005458 | Bacteria | 252785 |
| 62 | Ga0070681_10011899 | 3300005458 | Bacteria | 8627 |
| 63 | Ga0070681_10012589 | 3300005458 | Bacteria | 8394 |
| 64 | Ga0070681_10572466 | 3300005458 | Bacteria | 1043 |
| 65 | Ga0068867_100009429 | 3300005459 | Bacteria | 6885 |
| 66 | Ga0070685_10144993 | 3300005466 | Bacteria | 1499 |
| 67 | Ga0070706_100256157 | 3300005467 | Bacteria | 1634 |
| 68 | Ga0070706_101062470 | 3300005467 | Bacteria | 746 |
| 69 | Ga0070707_100962154 | 3300005468 | Bacteria | 819 |
| 70 | Ga0070679_100000617 | 3300005530 | Bacteria | 30256 |
| 71 | Ga0070679_100002859 | 3300005530 | Bacteria | 15691 |
| 72 | Ga0070679_100134472 | 3300005530 | Bacteria | 2454 |
| 73 | Ga0070679_100306407 | 3300005530 | Bacteria | 1539 |
| 74 | Ga0070684_100074972 | 3300005535 | Bacteria | 2983 |
| 75 | Ga0068853_100004867 | 3300005539 | Bacteria | 10441 |
| 76 | Ga0068853_100746552 | 3300005539 | Bacteria | 935 |
| 77 | Ga0068853_101258851 | 3300005539 | Bacteria | 715 |
| 78 | Ga0070672_100005409 | 3300005543 | Bacteria | 8460 |
| 79 | Ga0070672_100315141 | 3300005543 | Bacteria | 1329 |
| 80 | Ga0070686_100000293 | 3300005544 | Bacteria | 33629 |
| 81 | Ga0070695_100028477 | 3300005545 | Bacteria | 3467 |
| 82 | Ga0070693_100215841 | 3300005547 | Bacteria | 1254 |
| 83 | Ga0070665_100012379 | 3300005548 | Bacteria | 8598 |
| 84 | Ga0070665_100029685 | 3300005548 | Bacteria | 5502 |
| 85 | Ga0070665_100043223 | 3300005548 | Bacteria | 4529 |
| 86 | Ga0070665_100076443 | 3300005548 | Bacteria | 3355 |
| 87 | Ga0070665_100111711 | 3300005548 | Bacteria | 2735 |
| 88 | Ga0070665_100261818 | 3300005548 | Bacteria | 1731 |
| 89 | Ga0070665_101361359 | 3300005548 | Bacteria | 719 |
| 90 | Ga0070704_100541308 | 3300005549 | Bacteria | 1016 |
| 91 | Ga0068855_100000010 | 3300005563 | Bacteria | 246022 |
| 92 | Ga0068855_100008942 | 3300005563 | Bacteria | 12108 |
| 93 | Ga0068855_101441640 | 3300005563 | Bacteria | 708 |
| 94 | Ga0070664_100110535 | 3300005564 | Bacteria | 2398 |
| 95 | Ga0070664_100496083 | 3300005564 | Bacteria | 1125 |
| 96 | Ga0068857_100040969 | 3300005577 | Bacteria | 4106 |
| 97 | Ga0068857_100059009 | 3300005577 | Bacteria | 3408 |
| 98 | Ga0068857_100372171 | 3300005577 | Bacteria | 1325 |
| 99 | Ga0068857_100556346 | 3300005577 | Bacteria | 1081 |
| 100 | Ga0068856_100246583 | 3300005614 | Bacteria | 1801 |
| 101 | Ga0070702_100000359 | 3300005615 | Bacteria | 15921 |
| 102 | Ga0068852_100158317 | 3300005616 | Bacteria | 2112 |
| 103 | Ga0068859_100001219 | 3300005617 | Bacteria | 26247 |
| 104 | Ga0068859_100011800 | 3300005617 | Bacteria | 8780 |
| 105 | Ga0068859_101729843 | 3300005617 | Bacteria | 691 |
| 106 | Ga0068864_100008319 | 3300005618 | Bacteria | 8558 |
| 107 | Ga0068864_100241518 | 3300005618 | Bacteria | 1674 |
| 108 | Ga0068866_10236126 | 3300005718 | Bacteria | 1111 |
| 109 | Ga0068861_100001118 | 3300005719 | Bacteria | 16634 |
| 110 | Ga0068861_100091884 | 3300005719 | Bacteria | 2397 |
| 111 | Ga0068861_100126498 | 3300005719 | Bacteria | 2068 |
| 112 | Ga0068861_100348850 | 3300005719 | Bacteria | 1298 |
| 113 | Ga0068870_10127249 | 3300005840 | Bacteria | 1475 |
| 114 | Ga0068863_100013717 | 3300005841 | Bacteria | 7812 |
| 115 | Ga0068863_100052578 | 3300005841 | Bacteria | 3860 |
| 116 | Ga0068863_101424819 | 3300005841 | Bacteria | 701 |
| 117 | Ga0068858_100003828 | 3300005842 | Bacteria | 14879 |
| 118 | Ga0068858_100073512 | 3300005842 | Bacteria | 3173 |
| 119 | Ga0068860_100000274 | 3300005843 | Bacteria | 75310 |
| 120 | Ga0068860_100029840 | 3300005843 | Bacteria | 5246 |
| 121 | Ga0068860_100418628 | 3300005843 | Bacteria | 1328 |
| 122 | Ga0068862_100018205 | 3300005844 | Bacteria | 5848 |
| 123 | Ga0068862_100020732 | 3300005844 | Bacteria | 5490 |
| 124 | Ga0068862_100045872 | 3300005844 | Bacteria | 3730 |
| 125 | Ga0068862_100439597 | 3300005844 | Bacteria | 1227 |
| 126 | Ga0081455_10054938 | 3300005937 | Bacteria | 3390 |
| 127 | Ga0081455_10258515 | 3300005937 | Bacteria | 1269 |
| 128 | Ga0081540_1000213 | 3300005983 | Bacteria | 61164 |
| 129 | Ga0081540_1163641 | 3300005983 | Bacteria | 859 |
| 130 | Ga0070717_10076467 | 3300006028 | Bacteria | 2802 |
| 131 | Ga0075363_100443865 | 3300006048 | Bacteria | 766 |
| 132 | Ga0075364_10031574 | 3300006051 | Bacteria | 3403 |
| 133 | Ga0070712_100715148 | 3300006175 | Bacteria | 855 |
| 134 | Ga0075367_10036025 | 3300006178 | Bacteria | 2867 |
| 135 | Ga0075367_10126195 | 3300006178 | Bacteria | 1579 |
| 136 | Ga0075367_10626924 | 3300006178 | Bacteria | 683 |
| 137 | Ga0097621_100000341 | 3300006237 | Bacteria | 31966 |
| 138 | Ga0097621_100099829 | 3300006237 | Bacteria | 2441 |
| 139 | Ga0097621_100252420 | 3300006237 | Bacteria | 1545 |
| 140 | Ga0097621_100302987 | 3300006237 | Bacteria | 1412 |
| 141 | Ga0068871_100000340 | 3300006358 | Bacteria | 32379 |
| 142 | Ga0068871_100052366 | 3300006358 | Bacteria | 3306 |
| 143 | Ga0075428_100041639 | 3300006844 | Bacteria | 5050 |
| 144 | Ga0075428_100127042 | 3300006844 | Bacteria | 2774 |
| 145 | Ga0075428_100279966 | 3300006844 | Bacteria | 1795 |
| 146 | Ga0075430_100004465 | 3300006846 | Bacteria | 11801 |
| 147 | Ga0075430_100024970 | 3300006846 | Bacteria | 5083 |
| 148 | Ga0075430_100026810 | 3300006846 | Bacteria | 4901 |
| 149 | Ga0075430_100274244 | 3300006846 | Bacteria | 1396 |
| 150 | Ga0075431_100008217 | 3300006847 | Bacteria | 10430 |
| 151 | Ga0075431_100270157 | 3300006847 | Bacteria | 1723 |
| 152 | Ga0075431_100323820 | 3300006847 | Bacteria | 1554 |
| 153 | Ga0075434_100316477 | 3300006871 | Bacteria | 1581 |
| 154 | Ga0075429_100048877 | 3300006880 | Bacteria | 3678 |
| 155 | Ga0075429_100854497 | 3300006880 | Bacteria | 797 |
| 156 | Ga0068865_100039024 | 3300006881 | Bacteria | 3219 |
| 157 | Ga0068865_100046840 | 3300006881 | Bacteria | 2968 |
| 158 | Ga0068865_100287014 | 3300006881 | Bacteria | 1312 |
| 159 | Ga0075436_101278117 | 3300006914 | Bacteria | 555 |
| 160 | Ga0097620_100001219 | 3300006931 | Bacteria | 26247 |
| 161 | Ga0097620_100011800 | 3300006931 | Bacteria | 8780 |
| 162 | Ga0097620_101729808 | 3300006931 | Bacteria | 691 |
| 163 | Ga0075435_100925174 | 3300007076 | Bacteria | 761 |
| 164 | Ga0099795_10319566 | 3300007788 | Bacteria | 687 |
| 165 | Ga0105240_10004725 | 3300009093 | Bacteria | 20555 |
| 166 | Ga0105240_10209355 | 3300009093 | Bacteria | 2280 |
| 167 | Ga0105240_10329580 | 3300009093 | Bacteria | 1738 |
| 168 | Ga0111539_10119717 | 3300009094 | Bacteria | 3085 |
| 169 | Ga0111539_10131475 | 3300009094 | Bacteria | 2931 |
| 170 | Ga0111539_10184948 | 3300009094 | Bacteria | 2433 |
| 171 | Ga0111539_10727918 | 3300009094 | Bacteria | 1155 |
| 172 | Ga0105245_10648350 | 3300009098 | Bacteria | 1086 |
| 173 | Ga0105245_11170708 | 3300009098 | Bacteria | 816 |
| 174 | Ga0105247_10074249 | 3300009101 | Bacteria | 2132 |
| 175 | Ga0105247_10141377 | 3300009101 | Bacteria | 1578 |
| 176 | Ga0114129_10020069 | 3300009147 | Bacteria | 9512 |
| 177 | Ga0114129_10651127 | 3300009147 | Bacteria | 1360 |
| 178 | Ga0105241_10920612 | 3300009174 | Bacteria | 813 |
| 179 | Ga0105242_10235070 | 3300009176 | Bacteria | 1644 |
| 180 | Ga0105248_10002894 | 3300009177 | Bacteria | 19051 |
| 181 | Ga0105248_10121436 | 3300009177 | Bacteria | 2947 |
| 182 | Ga0105248_10304272 | 3300009177 | Bacteria | 1795 |
| 183 | Ga0105248_10329928 | 3300009177 | Bacteria | 1718 |
| 184 | Ga0105248_10421296 | 3300009177 | Bacteria | 1504 |
| 185 | Ga0105248_11630474 | 3300009177 | Bacteria | 731 |
| 186 | Ga0105238_10011351 | 3300009551 | Bacteria | 8964 |
| 187 | Ga0105238_10126632 | 3300009551 | Bacteria | 2532 |
| 188 | Ga0105238_10182225 | 3300009551 | Bacteria | 2077 |
| 189 | Ga0105238_10211660 | 3300009551 | Bacteria | 1915 |
| 190 | Ga0105238_10298174 | 3300009551 | Bacteria | 1595 |
| 191 | Ga0105238_10599671 | 3300009551 | Bacteria | 1109 |
| 192 | Ga0105238_10884063 | 3300009551 | Bacteria | 911 |
| 193 | Ga0105249_10025505 | 3300009553 | Bacteria | 5322 |
| 194 | Ga0105249_10290638 | 3300009553 | Bacteria | 1636 |
| 195 | Ga0105249_10473084 | 3300009553 | Bacteria | 1295 |
| 196 | Ga0105249_10874250 | 3300009553 | Bacteria | 965 |
| 197 | Ga0105239_10012604 | 3300010375 | Bacteria | 9407 |
| 198 | Ga0105239_10094436 | 3300010375 | Bacteria | 3304 |
| 199 | Ga0105239_10328803 | 3300010375 | Bacteria | 1724 |
| 200 | Ga0105239_10335653 | 3300010375 | Bacteria | 1705 |
| 201 | Ga0105246_10610098 | 3300011119 | Bacteria | 944 |
| 202 | Ga0157370_10193841 | 3300013104 | Bacteria | 1886 |
| 203 | Ga0157370_10286872 | 3300013104 | Bacteria | 1521 |
| 204 | Ga0157369_10084640 | 3300013105 | Bacteria | 3389 |
| 205 | Ga0157374_10049581 | 3300013296 | Bacteria | 3900 |
| 206 | Ga0157374_11173703 | 3300013296 | Bacteria | 789 |
| 207 | Ga0157378_10076390 | 3300013297 | Bacteria | 3018 |
| 208 | Ga0163162_10013049 | 3300013306 | Bacteria | 8110 |
| 209 | Ga0163162_10062320 | 3300013306 | Bacteria | 3769 |
| 210 | Ga0157372_10376723 | 3300013307 | Bacteria | 1654 |
| 211 | Ga0157372_10813557 | 3300013307 | Bacteria | 1085 |
| 212 | Ga0157375_10785046 | 3300013308 | Bacteria | 1102 |
| 213 | Ga0157375_10921739 | 3300013308 | Bacteria | 1017 |
| 214 | Ga0163163_10000548 | 3300014325 | Bacteria | 32947 |
| 215 | Ga0163163_10181871 | 3300014325 | Bacteria | 2150 |
| 216 | Ga0163163_10267305 | 3300014325 | Bacteria | 1761 |
| 217 | Ga0163163_10274437 | 3300014325 | Bacteria | 1737 |
| 218 | Ga0163163_11401241 | 3300014325 | Bacteria | 761 |
| 219 | Ga0157380_10008474 | 3300014326 | Bacteria | 7343 |
| 220 | Ga0157380_10015389 | 3300014326 | Bacteria | 5622 |
| 221 | Ga0157380_10173711 | 3300014326 | Bacteria | 1886 |
| 222 | Ga0157380_10654123 | 3300014326 | Bacteria | 1049 |
| 223 | Ga0157377_10020163 | 3300014745 | Bacteria | 3490 |
| 224 | Ga0157379_10002565 | 3300014968 | Bacteria | 15242 |
| 225 | Ga0157379_10062422 | 3300014968 | Bacteria | 3332 |
| 226 | Ga0157379_10104112 | 3300014968 | Bacteria | 2547 |
| 227 | Ga0157379_11395960 | 3300014968 | Bacteria | 679 |
| 228 | Ga0157376_10187475 | 3300014969 | Bacteria | 1895 |
| 229 | Ga0157376_10829731 | 3300014969 | Bacteria | 939 |
| 230 | Ga0183361_10019 | 3300016635 | Bacteria | 129849 |
| 231 | Ga0163161_10024154 | 3300017792 | Bacteria | 4293 |
| 232 | Ga0163161_10504879 | 3300017792 | Bacteria | 985 |
| 233 | Ga0213876_10000199 | 3300021384 | Bacteria | 61562 |
| 234 | Ga0207697_10181202 | 3300025315 | Bacteria | 923 |
| 235 | Ga0207692_10595713 | 3300025898 | Bacteria | 710 |
| 236 | Ga0207642_10244627 | 3300025899 | Bacteria | 1015 |
| 237 | Ga0207642_10278944 | 3300025899 | Bacteria | 960 |
| 238 | Ga0207710_10229939 | 3300025900 | Bacteria | 923 |
| 239 | Ga0207680_10088475 | 3300025903 | Bacteria | 1964 |
| 240 | Ga0207680_10235683 | 3300025903 | Bacteria | 1259 |
| 241 | Ga0207680_10302089 | 3300025903 | Bacteria | 1116 |
| 242 | Ga0207647_10160107 | 3300025904 | Bacteria | 1313 |
| 243 | Ga0207699_10325280 | 3300025906 | Bacteria | 1080 |
| 244 | Ga0207643_10222552 | 3300025908 | Bacteria | 1155 |
| 245 | Ga0207705_10000629 | 3300025909 | Bacteria | 29508 |
| 246 | Ga0207705_10058035 | 3300025909 | Bacteria | 2792 |
| 247 | Ga0207705_10325429 | 3300025909 | Bacteria | 1182 |
| 248 | Ga0207684_10203249 | 3300025910 | Bacteria | 1709 |
| 249 | Ga0207654_10221975 | 3300025911 | Bacteria | 1254 |
| 250 | Ga0207654_10911827 | 3300025911 | Bacteria | 637 |
| 251 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 252 | Ga0207707_10002401 | 3300025912 | Bacteria | 16856 |
| 253 | Ga0207707_10005879 | 3300025912 | Bacteria | 10725 |
| 254 | Ga0207707_10466337 | 3300025912 | Bacteria | 1080 |
| 255 | Ga0207707_10560057 | 3300025912 | Bacteria | 970 |
| 256 | Ga0207695_10029064 | 3300025913 | Bacteria | 6117 |
| 257 | Ga0207695_10167457 | 3300025913 | Bacteria | 2125 |
| 258 | Ga0207695_10576283 | 3300025913 | Bacteria | 1007 |
| 259 | Ga0207671_10164666 | 3300025914 | Bacteria | 1719 |
| 260 | Ga0207671_10201689 | 3300025914 | Bacteria | 1554 |
| 261 | Ga0207671_10367040 | 3300025914 | Bacteria | 1143 |
| 262 | Ga0207660_10000896 | 3300025917 | Bacteria | 19600 |
| 263 | Ga0207660_10006202 | 3300025917 | Bacteria | 7764 |
| 264 | Ga0207662_10002950 | 3300025918 | Bacteria | 8646 |
| 265 | Ga0207657_10000704 | 3300025919 | Bacteria | 35496 |
| 266 | Ga0207657_10021074 | 3300025919 | Bacteria | 6143 |
| 267 | Ga0207649_10043363 | 3300025920 | Bacteria | 2750 |
| 268 | Ga0207649_10119173 | 3300025920 | Bacteria | 1777 |
| 269 | Ga0207649_11373267 | 3300025920 | Bacteria | 559 |
| 270 | Ga0207652_10000413 | 3300025921 | Bacteria | 44358 |
| 271 | Ga0207652_10023321 | 3300025921 | Bacteria | 5125 |
| 272 | Ga0207652_10028700 | 3300025921 | Bacteria | 4645 |
| 273 | Ga0207652_10856262 | 3300025921 | Bacteria | 805 |
| 274 | Ga0207681_10122713 | 3300025923 | Bacteria | 1908 |
| 275 | Ga0207681_10624552 | 3300025923 | Bacteria | 892 |
| 276 | Ga0207694_10000011 | 3300025924 | Bacteria | 417640 |
| 277 | Ga0207694_10254856 | 3300025924 | Bacteria | 1436 |
| 278 | Ga0207694_10367244 | 3300025924 | Bacteria | 1193 |
| 279 | Ga0207650_10119176 | 3300025925 | Bacteria | 2052 |
| 280 | Ga0207659_10066296 | 3300025926 | Bacteria | 2620 |
| 281 | Ga0207659_10651928 | 3300025926 | Bacteria | 900 |
| 282 | Ga0207687_10789665 | 3300025927 | Bacteria | 809 |
| 283 | Ga0207700_10030609 | 3300025928 | Bacteria | 3813 |
| 284 | Ga0207644_10051159 | 3300025931 | Bacteria | 2964 |
| 285 | Ga0207690_10003837 | 3300025932 | Bacteria | 8896 |
| 286 | Ga0207706_10003404 | 3300025933 | Bacteria | 15195 |
| 287 | Ga0207706_10173125 | 3300025933 | Bacteria | 1897 |
| 288 | Ga0207706_10860108 | 3300025933 | Bacteria | 768 |
| 289 | Ga0207686_10035895 | 3300025934 | Bacteria | 2979 |
| 290 | Ga0207686_10047226 | 3300025934 | Bacteria | 2661 |
| 291 | Ga0207670_10004061 | 3300025936 | Bacteria | 7836 |
| 292 | Ga0207669_10027195 | 3300025937 | Bacteria | 3127 |
| 293 | Ga0207669_10058927 | 3300025937 | Bacteria | 2346 |
| 294 | Ga0207669_10266878 | 3300025937 | Bacteria | 1283 |
| 295 | Ga0207704_10022596 | 3300025938 | Bacteria | 3374 |
| 296 | Ga0207704_10139647 | 3300025938 | Bacteria | 1693 |
| 297 | Ga0207704_10254216 | 3300025938 | Bacteria | 1321 |
| 298 | Ga0207665_10192047 | 3300025939 | Bacteria | 1484 |
| 299 | Ga0207691_10035234 | 3300025940 | Bacteria | 4647 |
| 300 | Ga0207711_10094029 | 3300025941 | Bacteria | 2641 |
| 301 | Ga0207711_10164032 | 3300025941 | Bacteria | 2013 |
| 302 | Ga0207711_10853675 | 3300025941 | Bacteria | 847 |
| 303 | Ga0207689_10005748 | 3300025942 | Bacteria | 11016 |
| 304 | Ga0207689_10567411 | 3300025942 | Bacteria | 954 |
| 305 | Ga0207661_10432669 | 3300025944 | Bacteria | 1196 |
| 306 | Ga0207679_10007930 | 3300025945 | Bacteria | 6750 |
| 307 | Ga0207679_10289559 | 3300025945 | Bacteria | 1407 |
| 308 | Ga0207679_10536715 | 3300025945 | Bacteria | 1048 |
| 309 | Ga0207667_10000093 | 3300025949 | Bacteria | 145814 |
| 310 | Ga0207667_10001457 | 3300025949 | Bacteria | 29683 |
| 311 | Ga0207667_10512953 | 3300025949 | Bacteria | 1215 |
| 312 | Ga0207667_11503743 | 3300025949 | Bacteria | 644 |
| 313 | Ga0207651_10053897 | 3300025960 | Bacteria | 2752 |
| 314 | Ga0207712_10137029 | 3300025961 | Bacteria | 1873 |
| 315 | Ga0207712_10197782 | 3300025961 | Bacteria | 1591 |
| 316 | Ga0207712_10318710 | 3300025961 | Bacteria | 1282 |
| 317 | Ga0207712_10399597 | 3300025961 | Bacteria | 1155 |
| 318 | Ga0207712_11268081 | 3300025961 | Bacteria | 658 |
| 319 | Ga0207668_10332320 | 3300025972 | Bacteria | 1265 |
| 320 | Ga0207668_11088671 | 3300025972 | Bacteria | 716 |
| 321 | Ga0207640_10304524 | 3300025981 | Bacteria | 1262 |
| 322 | Ga0207640_10505077 | 3300025981 | Bacteria | 1008 |
| 323 | Ga0207658_10052026 | 3300025986 | Bacteria | 3021 |
| 324 | Ga0207658_10480778 | 3300025986 | Bacteria | 1104 |
| 325 | Ga0207677_10056319 | 3300026023 | Bacteria | 2693 |
| 326 | Ga0207677_10070969 | 3300026023 | Bacteria | 2457 |
| 327 | Ga0207703_10000667 | 3300026035 | Bacteria | 34257 |
| 328 | Ga0207703_10054479 | 3300026035 | Bacteria | 3252 |
| 329 | Ga0207703_10061260 | 3300026035 | Bacteria | 3080 |
| 330 | Ga0207703_10545256 | 3300026035 | Bacteria | 1093 |
| 331 | Ga0207639_10008663 | 3300026041 | Bacteria | 6981 |
| 332 | Ga0207678_10017343 | 3300026067 | Bacteria | 6321 |
| 333 | Ga0207678_10142098 | 3300026067 | Bacteria | 2049 |
| 334 | Ga0207678_10143698 | 3300026067 | Bacteria | 2036 |
| 335 | Ga0207678_11183120 | 3300026067 | Bacteria | 677 |
| 336 | Ga0207708_10082817 | 3300026075 | Bacteria | 2467 |
| 337 | Ga0207708_10740723 | 3300026075 | Bacteria | 843 |
| 338 | Ga0207702_10229681 | 3300026078 | Bacteria | 1733 |
| 339 | Ga0207641_10021368 | 3300026088 | Bacteria | 5319 |
| 340 | Ga0207641_10047015 | 3300026088 | Bacteria | 3638 |
| 341 | Ga0207641_10056202 | 3300026088 | Bacteria | 3344 |
| 342 | Ga0207641_11284295 | 3300026088 | Bacteria | 732 |
| 343 | Ga0207641_11582747 | 3300026088 | Bacteria | 657 |
| 344 | Ga0207648_10004593 | 3300026089 | Bacteria | 14152 |
| 345 | Ga0207676_10574828 | 3300026095 | Bacteria | 1079 |
| 346 | Ga0207676_11076634 | 3300026095 | Bacteria | 794 |
| 347 | Ga0207676_11344747 | 3300026095 | Bacteria | 710 |
| 348 | Ga0207674_10052832 | 3300026116 | Bacteria | 4143 |
| 349 | Ga0207674_10081965 | 3300026116 | Bacteria | 3228 |
| 350 | Ga0207674_10094452 | 3300026116 | Bacteria | 2977 |
| 351 | Ga0207674_10128744 | 3300026116 | Bacteria | 2496 |
| 352 | Ga0207674_11885381 | 3300026116 | Bacteria | 564 |
| 353 | Ga0207675_100001315 | 3300026118 | Bacteria | 24901 |
| 354 | Ga0207675_100053500 | 3300026118 | Bacteria | 3766 |
| 355 | Ga0207675_100162290 | 3300026118 | Bacteria | 2132 |
| 356 | Ga0207675_100170388 | 3300026118 | Bacteria | 2081 |
| 357 | Ga0207675_100667563 | 3300026118 | Bacteria | 1046 |
| 358 | Ga0207683_10009296 | 3300026121 | Bacteria | 8374 |
| 359 | Ga0207683_10024431 | 3300026121 | Bacteria | 5205 |
| 360 | Ga0207683_10078454 | 3300026121 | Bacteria | 2926 |
| 361 | Ga0207683_10095227 | 3300026121 | Bacteria | 2654 |
| 362 | Ga0207698_10280834 | 3300026142 | Bacteria | 1540 |
| 363 | Ga0209813_10054981 | 3300027866 | Bacteria | 1256 |
| 364 | Ga0207428_10281415 | 3300027907 | Bacteria | 1234 |
| 365 | Ga0268266_10000676 | 3300028379 | Bacteria | 46038 |
| 366 | Ga0268266_10010435 | 3300028379 | Bacteria | 8116 |
| 367 | Ga0268266_10014221 | 3300028379 | Bacteria | 6846 |
| 368 | Ga0268266_10054459 | 3300028379 | Bacteria | 3437 |
| 369 | Ga0268266_10136022 | 3300028379 | Bacteria | 2201 |
| 370 | Ga0268266_10199282 | 3300028379 | Bacteria | 1831 |
| 371 | Ga0268266_10215399 | 3300028379 | Bacteria | 1763 |
| 372 | Ga0268265_10002175 | 3300028380 | Bacteria | 15165 |
| 373 | Ga0268265_10024790 | 3300028380 | Bacteria | 4249 |
| 374 | Ga0268265_10276364 | 3300028380 | Bacteria | 1501 |
| 375 | Ga0268265_10462639 | 3300028380 | Bacteria | 1187 |
| 376 | Ga0268264_10000058 | 3300028381 | Bacteria | 308956 |
| 377 | Ga0268264_10000060 | 3300028381 | Bacteria | 305056 |
| 378 | Ga0268264_10072503 | 3300028381 | Bacteria | 2920 |
| 379 | Ga0268264_10365408 | 3300028381 | Bacteria | 1378 |
| 380 | Ga0268264_10857576 | 3300028381 | Bacteria | 910 |
| 381 | Ga0265334_10030844 | 3300028573 | Bacteria | 2144 |
| 382 | Ga0307517_10243806 | 3300028786 | Bacteria | 1063 |
| 383 | Ga0307517_10571011 | 3300028786 | Bacteria | 562 |
| 384 | Ga0265338_10001143 | 3300028800 | Bacteria | 43898 |
| 385 | Ga0265338_10166873 | 3300028800 | Bacteria | 1694 |
| 386 | Ga0265330_10343531 | 3300031235 | Bacteria | 630 |
| 387 | Ga0265325_10000003 | 3300031241 | Bacteria | 370490 |
| 388 | Ga0265325_10093846 | 3300031241 | Bacteria | 1476 |
| 389 | Ga0265329_10016878 | 3300031242 | Bacteria | 2524 |
| 390 | Ga0265340_10018857 | 3300031247 | Bacteria | 3555 |
| 391 | Ga0265340_10054101 | 3300031247 | Bacteria | 1937 |
| 392 | Ga0265339_10008231 | 3300031249 | Bacteria | 6650 |
| 393 | Ga0265331_10007890 | 3300031250 | Bacteria | 6103 |
| 394 | Ga0265331_10018523 | 3300031250 | Bacteria | 3608 |
| 395 | Ga0265331_10027595 | 3300031250 | Bacteria | 2845 |
| 396 | Ga0265316_10042338 | 3300031344 | Bacteria | 3641 |
| 397 | Ga0307513_10029913 | 3300031456 | Bacteria | 6194 |
| 398 | Ga0307513_10034926 | 3300031456 | Bacteria | 5633 |
| 399 | Ga0307513_10098957 | 3300031456 | Bacteria | 2946 |
| 400 | Ga0307509_10015345 | 3300031507 | Bacteria | 8942 |
| 401 | Ga0307408_100200972 | 3300031548 | Bacteria | 1613 |
| 402 | Ga0265313_10002034 | 3300031595 | Bacteria | 18144 |
| 403 | Ga0265313_10003018 | 3300031595 | Bacteria | 14000 |
| 404 | Ga0265313_10030601 | 3300031595 | Bacteria | 2769 |
| 405 | Ga0265314_10097202 | 3300031711 | Bacteria | 1903 |
| 406 | Ga0265314_10614199 | 3300031711 | Bacteria | 558 |
| 407 | Ga0265342_10002356 | 3300031712 | Bacteria | 16385 |
| 408 | Ga0265342_10012225 | 3300031712 | Bacteria | 5822 |
| 409 | Ga0307516_10084087 | 3300031730 | Bacteria | 3022 |
| 410 | Ga0307516_10094375 | 3300031730 | Bacteria | 2816 |
| 411 | Ga0307405_10838922 | 3300031731 | Bacteria | 773 |
| 412 | Ga0307412_10004387 | 3300031911 | Bacteria | 7866 |
| 413 | Ga0307412_10143484 | 3300031911 | Bacteria | 1752 |
| 414 | Ga0307409_101962692 | 3300031995 | Bacteria | 615 |
| 415 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 416 | Ga0307510_10045389 | 3300033180 | Bacteria | 4745 |
| 417 | Ga0373940_0079961 | 3300035088 | Bacteria | 965 |
| 418 | Ga0373936_0013587 | 3300035113 | Bacteria | 3107 |
| 419 | Ga0373936_0263960 | 3300035113 | Bacteria | 771 |
| 420 | Ga0373939_0108628 | 3300035114 | Bacteria | 963 |
| 421 | Ga0373943_0564476 | 3300035170 | Bacteria | 669 |
| 422 | Ga0373955_0242971 | 3300035172 | Bacteria | 1079 |
| 423 | Ga0373924_0114098 | 3300035410 | Bacteria | 1170 |
| 424 | Ga0373935_0705821 | 3300035692 | Bacteria | 742 |
| 425 | Ga0373927_0583788 | 3300035695 | Bacteria | 739 |
| 426 | Ga0395899_0000016 | 3300037312 | Bacteria | 468322 |
| 427 | Ga0395899_0118364 | 3300037312 | Bacteria | 1899 |
| 428 | Ga0395900_0009659 | 3300037418 | Bacteria | 9892 |
| 429 | Ga0395900_0207890 | 3300037418 | Bacteria | 1977 |
| 430 | Ga0395900_0472200 | 3300037418 | Bacteria | 1208 |
| 431 | Ga0395898_0265652 | 3300037466 | Bacteria | 1636 |
| 432 | Ga0395898_0303336 | 3300037466 | Bacteria | 1523 |
| 433 | Ga0395905_0000069 | 3300037471 | Bacteria | 176869 |
| 434 | Ga0395905_0090129 | 3300037471 | Bacteria | 2875 |
| 435 | Ga0395905_0132645 | 3300037471 | Bacteria | 2343 |
| 436 | Ga0395905_0337074 | 3300037471 | Bacteria | 1399 |
| 437 | Ga0395905_0477196 | 3300037471 | Bacteria | 1146 |
| 438 | Ga0395905_0511984 | 3300037471 | Bacteria | 1100 |
| 439 | Ga0395901_0069562 | 3300038443 | Bacteria | 3666 |
| 440 | Ga0395901_0209533 | 3300038443 | Bacteria | 2040 |
| 441 | Ga0395901_0262273 | 3300038443 | Bacteria | 1798 |
| 442 | Ga0436365_1372975 | 3300039437 | Bacteria | 5412 |
| 443 | Ga0436365_1490174 | 3300039437 | Bacteria | 54443 |
| 444 | Ga0436361_0664527 | 3300039447 | Bacteria | 1449 |
| 445 | Ga0436363_1145957 | 3300039450 | Bacteria | 1982 |
| 446 | Ga0439464_0150334 | 3300042439 | Bacteria | 728 |
| 447 | Ga0451576_0054973 | 3300045051 | Bacteria | 4166 |
| 448 | Ga0451576_1195248 | 3300045051 | Bacteria | 794 |
| 449 | Ga0466958_0032020 | 3300045836 | Bacteria | 3126 |
| 450 | Ga0495603_0102725 | 3300046455 | Bacteria | 1669 |
| 451 | Ga0495638_0062154 | 3300046460 | Bacteria | 2306 |
| 452 | Ga0495638_0071417 | 3300046460 | Bacteria | 2123 |
| 453 | Ga0495641_0297233 | 3300046461 | Bacteria | 728 |
| 454 | Ga0495650_0107466 | 3300046471 | Bacteria | 1040 |
| 455 | Ga0495650_0269057 | 3300046471 | Bacteria | 576 |
| 456 | Ga0495605_0010891 | 3300046474 | Bacteria | 5081 |
| 457 | Ga0495584_0066387 | 3300046491 | Bacteria | 1814 |
| 458 | Ga0495585_0011902 | 3300046492 | Bacteria | 5138 |
| 459 | Ga0495596_0079222 | 3300046500 | Bacteria | 1275 |
| 460 | Ga0495607_0089028 | 3300046501 | Bacteria | 1676 |
| 461 | Ga0495583_0044568 | 3300046506 | Bacteria | 2056 |
| 462 | Ga0495606_0001322 | 3300046507 | Bacteria | 33851 |
| 463 | Ga0495606_0065099 | 3300046507 | Bacteria | 2317 |
| 464 | Ga0495616_0104150 | 3300046513 | Bacteria | 1326 |
| 465 | Ga0495631_0029015 | 3300046518 | Bacteria | 2520 |
| 466 | Ga0495632_0008560 | 3300046519 | Bacteria | 6260 |
| 467 | Ga0495632_0096025 | 3300046519 | Bacteria | 1400 |
| 468 | Ga0495643_0039959 | 3300046522 | Bacteria | 2563 |
| 469 | Ga0495644_0019674 | 3300046523 | Bacteria | 2578 |
| 470 | Ga0495648_0060366 | 3300046524 | Bacteria | 2256 |
| 471 | Ga0495642_0007283 | 3300046528 | Bacteria | 4247 |
| 472 | Ga0495642_0023925 | 3300046528 | Bacteria | 2414 |
| 473 | Ga0495642_0032391 | 3300046528 | Bacteria | 2097 |
| 474 | Ga0495609_0072871 | 3300046538 | Bacteria | 1507 |
| 475 | Ga0495597_0024058 | 3300046542 | Bacteria | 2813 |
| 476 | Ga0495668_0022559 | 3300046616 | Bacteria | 3598 |
| 477 | Ga0495668_0050954 | 3300046616 | Bacteria | 2293 |
| 478 | Ga0495668_0183060 | 3300046616 | Bacteria | 1147 |
| 479 | Ga0495668_0393483 | 3300046616 | Bacteria | 761 |
| 480 | Ga0495611_0002895 | 3300046648 | Bacteria | 7656 |
| 481 | Ga0495625_0113821 | 3300046660 | Bacteria | 1847 |
| 482 | Ga0495625_0251596 | 3300046660 | Bacteria | 1147 |
| 483 | Ga0495589_0016469 | 3300046794 | Bacteria | 3800 |
| 484 | Ga0495660_0340446 | 3300046810 | Bacteria | 669 |
| 485 | Ga0495636_0374405 | 3300047318 | Bacteria | 675 |
| 486 | Ga0495674_0019683 | 3300047319 | Bacteria | 6261 |
| 487 | Ga0495683_0006861 | 3300047323 | Bacteria | 6188 |
| 488 | Ga0495677_0002863 | 3300047445 | Bacteria | 6723 |
| 489 | Ga0495677_0174596 | 3300047445 | Bacteria | 832 |
| 490 | Ga0495677_0255876 | 3300047445 | Bacteria | 685 |
| 491 | Ga0495685_002965 | 3300047447 | Bacteria | 5373 |
| 492 | Ga0495685_131461 | 3300047447 | Bacteria | 818 |
| 493 | Ga0495681_0054613 | 3300047470 | Bacteria | 1866 |
| 494 | Ga0495686_0005875 | 3300047472 | Bacteria | 9568 |
| 495 | Ga0496100_0015643 | 3300048903 | Bacteria | 4433 |
| 496 | Ga0496100_0045550 | 3300048903 | Bacteria | 2816 |
| 497 | Ga0496100_0361909 | 3300048903 | Bacteria | 1098 |
| 498 | Ga0496101_0056655 | 3300048904 | Bacteria | 2834 |
| 499 | Ga0496101_0491896 | 3300048904 | Bacteria | 969 |
| 500 | Ga0496102_0273956 | 3300048905 | Bacteria | 1591 |
| 501 | Ga0496104_0001121 | 3300048907 | Bacteria | 22928 |
| 502 | Ga0496105_0296556 | 3300048908 | Bacteria | 1300 |
| 503 | Ga0496105_1079276 | 3300048908 | Bacteria | 597 |
| 504 | Ga0496106_0506613 | 3300048909 | Bacteria | 969 |
| 505 | Ga0496107_0577437 | 3300048910 | Bacteria | 832 |
| 506 | Ga0496108_0049676 | 3300048911 | Bacteria | 3508 |
| 507 | Ga0496108_0623182 | 3300048911 | Bacteria | 939 |
| 508 | Ga0496109_0021712 | 3300048912 | Bacteria | 5681 |
| 509 | Ga0496109_0109654 | 3300048912 | Bacteria | 2566 |
| 510 | Ga0496110_0054366 | 3300048913 | Bacteria | 3522 |
| 511 | Ga0496110_0391515 | 3300048913 | Bacteria | 1267 |
| 512 | Ga0496111_0036443 | 3300048914 | Bacteria | 3517 |
| 513 | Ga0496112_0069837 | 3300048915 | Bacteria | 3470 |
| 514 | Ga0496112_0222889 | 3300048915 | Bacteria | 1841 |
| 515 | Ga0496112_0861435 | 3300048915 | Bacteria | 829 |
| 516 | Ga0496112_1221463 | 3300048915 | Bacteria | 668 |
| 517 | Ga0496113_0088614 | 3300048916 | Bacteria | 2380 |
| 518 | Ga0496114_0042505 | 3300048917 | Bacteria | 3768 |
| 519 | Ga0496114_0059861 | 3300048917 | Bacteria | 3182 |
| 520 | Ga0496114_0293527 | 3300048917 | Unclassified | 1435 |
| 521 | Ga0496114_0559175 | 3300048917 | Bacteria | 1010 |
| 522 | Ga0496114_0641134 | 3300048917 | Bacteria | 935 |
| 523 | Ga0496116_0012102 | 3300048919 | Bacteria | 7068 |
| 524 | Ga0496117_0004884 | 3300048920 | Bacteria | 14455 |
| 525 | Ga0496117_0074458 | 3300048920 | Bacteria | 2260 |
| 526 | Ga0496117_0187571 | 3300048920 | Bacteria | 1182 |
| 527 | Ga0496118_0001630 | 3300048921 | Bacteria | 33114 |
| 528 | Ga0496118_0016606 | 3300048921 | Bacteria | 6746 |
| 529 | Ga0496119_0010064 | 3300048922 | Bacteria | 7996 |
| 530 | Ga0496119_0054595 | 3300048922 | Bacteria | 2432 |
| 531 | Ga0496119_0107977 | 3300048922 | Bacteria | 1550 |
| 532 | Ga0496120_0000412 | 3300048923 | Bacteria | 68157 |
| 533 | Ga0496120_0033194 | 3300048923 | Bacteria | 3103 |
| 534 | Ga0496121_0007495 | 3300048924 | Bacteria | 13174 |
| 535 | Ga0496121_0017037 | 3300048924 | Bacteria | 7454 |
| 536 | Ga0496121_0024062 | 3300048924 | Bacteria | 5836 |
| 537 | Ga0496121_0150403 | 3300048924 | Bacteria | 1714 |
| 538 | Ga0496121_0245394 | 3300048924 | Bacteria | 1245 |
| 539 | Ga0496122_0010791 | 3300048925 | Bacteria | 9361 |
| 540 | Ga0496123_0014951 | 3300048926 | Bacteria | 6398 |
| 541 | Ga0496124_0004910 | 3300048927 | Bacteria | 15361 |
| 542 | Ga0496125_0001826 | 3300048928 | Bacteria | 29381 |
| 543 | Ga0496126_0327021 | 3300048929 | Bacteria | 1259 |
| 544 | Ga0496126_0747691 | 3300048929 | Bacteria | 755 |
| 545 | Ga0496126_0839104 | 3300048929 | Bacteria | 702 |
| 546 | Ga0495682_0005529 | 3300049460 | Bacteria | 5235 |
| 547 | Ga0495682_0210090 | 3300049460 | Bacteria | 690 |
| 548 | Ga0501032_0531808 | 3300049569 | Bacteria | 750 |
| 549 | Ga0501036_0455004 | 3300049572 | Bacteria | 1066 |
| 550 | Ga0501036_0498463 | 3300049572 | Bacteria | 1013 |
| 551 | Ga0501037_0544197 | 3300049573 | Bacteria | 784 |
| 552 | Ga0501038_0879840 | 3300049574 | Bacteria | 662 |
| 553 | Ga0501039_0875531 | 3300049575 | Bacteria | 700 |
| 554 | Ga0501039_1529254 | 3300049575 | Unclassified | 513 |
| 555 | Ga0501041_0146184 | 3300049577 | Bacteria | 1475 |
| 556 | Ga0501041_0474816 | 3300049577 | Bacteria | 795 |
| 557 | Ga0501041_0769723 | 3300049577 | Bacteria | 617 |
| 558 | Ga0501042_0129862 | 3300049578 | Bacteria | 1816 |
| 559 | Ga0501042_0366626 | 3300049578 | Bacteria | 1042 |
| 560 | Ga0501046_0462795 | 3300049580 | Bacteria | 911 |
| 561 | Ga0501071_0040460 | 3300049587 | Bacteria | 3335 |
| 562 | Ga0501071_0488857 | 3300049587 | Bacteria | 944 |
| 563 | Ga0501072_0183838 | 3300049588 | Bacteria | 1668 |
| 564 | Ga0501072_0725121 | 3300049588 | Bacteria | 781 |
| 565 | Ga0501072_0790817 | 3300049588 | Bacteria | 743 |
| 566 | Ga0501073_0352755 | 3300049589 | Bacteria | 1016 |
| 567 | Ga0501073_0770026 | 3300049589 | Bacteria | 664 |
| 568 | Ga0501075_1141726 | 3300049591 | Bacteria | 591 |
| 569 | Ga0501076_0174180 | 3300049592 | Bacteria | 1754 |
| 570 | Ga0501076_0293315 | 3300049592 | Bacteria | 1332 |
| 571 | Ga0501076_1564974 | 3300049592 | Bacteria | 541 |
| 572 | Ga0501077_0240515 | 3300049593 | Bacteria | 1151 |
| 573 | Ga0501080_0624361 | 3300049742 | Bacteria | 955 |
| 574 | Ga0501080_0971015 | 3300049742 | Bacteria | 738 |
| 575 | Ga0501081_0430257 | 3300049743 | Bacteria | 979 |
| 576 | Ga0501081_0729605 | 3300049743 | Bacteria | 744 |
| 577 | Ga0501083_0317378 | 3300049744 | Bacteria | 1013 |
| 578 | Ga0501035_0271002 | 3300049822 | Unclassified | 1437 |
| 579 | Ga0501044_0008139 | 3300049823 | Bacteria | 11507 |
| 580 | Ga0501045_0121553 | 3300049824 | Bacteria | 1939 |
| 581 | Ga0501045_0987447 | 3300049824 | Bacteria | 617 |
| 582 | nmdc:mga03683_20631_c1 | 3300050489 | Bacteria | 2531 |
| 583 | nmdc:mga03n38_26439_c1 | 3300050490 | Bacteria | 2396 |
| 584 | nmdc:mga0yw44_23265_c1 | 3300050492 | Bacteria | 3488 |
| 585 | nmdc:mga06z11_164882_c1 | 3300050494 | Bacteria | 1269 |
| 586 | nmdc:mga06z11_17996_c1 | 3300050494 | Bacteria | 3219 |
| 587 | nmdc:mga04h51_47616_c1 | 3300050495 | Bacteria | 1425 |
| 588 | nmdc:mga05p37_101701_c1 | 3300050507 | Bacteria | 3539 |
| 589 | nmdc:mga05p37_270572_c1 | 3300050507 | Bacteria | 2030 |
| 590 | nmdc:mga09592_796195_c1 | 3300050508 | Bacteria | 800 |
| 591 | nmdc:mga0qj67_114907_c1 | 3300050509 | Bacteria | 2174 |
| 592 | nmdc:mga0qj67_217374_c1 | 3300050509 | Bacteria | 1552 |
| 593 | nmdc:mga0qj67_234921_c1 | 3300050509 | Bacteria | 1488 |
| 594 | nmdc:mga0qj67_256711_c1 | 3300050509 | Bacteria | 1418 |
| 595 | nmdc:mga06r32_41095_c1 | 3300050510 | Archaea | 4393 |
| 596 | nmdc:mga06r32_42563_c1 | 3300050510 | Bacteria | 4319 |
| 597 | nmdc:mga08y16_121478_c1 | 3300050511 | Bacteria | 2718 |
| 598 | nmdc:mga08y16_556831_c1 | 3300050511 | Bacteria | 1160 |
| 599 | nmdc:mga0n895_763360_c1 | 3300050512 | Bacteria | 959 |
| 600 | nmdc:mga0n895_813131_c1 | 3300050512 | Bacteria | 924 |
| 601 | nmdc:mga0a205_1169474_c1 | 3300050515 | Bacteria | 617 |
| 602 | nmdc:mga0sz30_498_c1 | 3300050516 | Bacteria | 14575 |
| 603 | Ga0500555_113367 | 3300053103 | Bacteria | 681 |
| 604 | Ga0500591_021093 | 3300053115 | Bacteria | 3158 |
| 605 | Ga0500595_096907 | 3300053119 | Bacteria | 849 |
| 606 | Ga0500642_0085365 | 3300053130 | Bacteria | 1454 |
| 607 | Ga0500652_144470 | 3300053131 | Bacteria | 989 |
| 608 | Ga0500590_126666 | 3300053148 | Bacteria | 1188 |
| 609 | Ga0500590_263529 | 3300053148 | Bacteria | 675 |
| 610 | Ga0500616_0048408 | 3300053153 | Bacteria | 2254 |
| 611 | Ga0500616_0098604 | 3300053153 | Bacteria | 1433 |
| 612 | Ga0500627_0345838 | 3300053158 | Bacteria | 642 |
| 613 | Ga0500630_079480 | 3300053159 | Bacteria | 1537 |
| 614 | Ga0500639_082373 | 3300053163 | Bacteria | 1619 |
| 615 | Ga0500601_000289 | 3300053737 | Bacteria | 9554 |
| 616 | Ga0500661_020008 | 3300055283 | Bacteria | 1190 |
| 617 | Ga0501082_0544786 | 3300060353 | Bacteria | 1015 |
| 618 | Ga0501082_1306347 | 3300060353 | Bacteria | 634 |
| 619 | Ga0530510_0332034 | 3300061734 | Bacteria | 1141 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031595 | Ga0265313_10030601 | Ga0265313_100306012 | 144 |
| 2 | 3300049569 | Ga0501032_0531808 | Ga0501032_0531808_259_699 | 145 |
| 3 | 3300026116 | Ga0207674_11885381 | Ga0207674_118853811 | 147 |
| 4 | iso_pu_bacteria | 2921643360 | 2921643623 | 147 |
| 5 | 3300031548 | Ga0307408_100200972 | Ga0307408_1002009722 | 148 |
| 6 | 3300031731 | Ga0307405_10838922 | Ga0307405_108389222 | 148 |
| 7 | 3300031911 | Ga0307412_10143484 | Ga0307412_101434842 | 148 |
| 8 | iso_pu_bacteria | 2528768022 | 2528852430 | 148 |
| 9 | iso_pu_bacteria | 2824671348 | 2824672428 | 148 |
| 10 | iso_pu_bacteria | 2824687955 | 2824689017 | 148 |
| 11 | iso_pu_bacteria | 2824773399 | 2824775438 | 148 |
| 12 | iso_pu_bacteria | 2838122688 | 2838123532 | 148 |
| 13 | iso_pu_bacteria | 2841949485 | 2841949632 | 148 |
| 14 | iso_pu_bacteria | 2841957949 | 2841958867 | 148 |
| 15 | iso_pu_bacteria | 2841966195 | 2841971860 | 148 |
| 16 | iso_pu_bacteria | 2841983080 | 2841983644 | 148 |
| 17 | iso_pu_bacteria | 2929615660 | 2929618282 | 148 |
| 18 | iso_pu_bacteria | 2929624759 | 2929632470 | 148 |
| 19 | iso_pu_bacteria | 2933577622 | 2933580210 | 148 |
| 20 | iso_pu_bacteria | 8055742211 | 8055746129 | 148 |
| 21 | 3300037471 | Ga0395905_0090129 | Ga0395905_0090129_358_807 | 149 |
| 22 | iso_pu_bacteria | 2503198000 | 2503200437 | 149 |
| 23 | iso_pu_bacteria | 2512875016 | 2512932195 | 149 |
| 24 | iso_pu_bacteria | 2512875024 | 2512960199 | 149 |
| 25 | iso_pu_bacteria | 2513237098 | 2513679132 | 149 |
| 26 | iso_pu_bacteria | 2562617112 | 2563063639 | 149 |
| 27 | iso_pu_bacteria | 2582581316 | 2585331131 | 149 |
| 28 | iso_pu_bacteria | 2643221595 | 2643988020 | 149 |
| 29 | iso_pu_bacteria | 2643221627 | 2644158187 | 149 |
| 30 | iso_pu_bacteria | 2643221736 | 2644745370 | 149 |
| 31 | iso_pu_bacteria | 2711768613 | 2713474519 | 149 |
| 32 | iso_pu_bacteria | 2738541293 | 2738800831 | 149 |
| 33 | iso_pu_bacteria | 2756170246 | 2756671897 | 149 |
| 34 | iso_pu_bacteria | 2791355123 | 2792752089 | 149 |
| 35 | iso_pu_bacteria | 2841760612 | 2841760880 | 149 |
| 36 | iso_pu_bacteria | 2844002411 | 2844008162 | 149 |
| 37 | iso_pu_bacteria | 2844104063 | 2844106537 | 149 |
| 38 | iso_pu_bacteria | 2847670302 | 2847675301 | 149 |
| 39 | iso_pu_bacteria | 2851246043 | 2851246893 | 149 |
| 40 | iso_pu_bacteria | 2856314179 | 2856314893 | 149 |
| 41 | iso_pu_bacteria | 2871466892 | 2871470247 | 149 |
| 42 | iso_pu_bacteria | 2871495908 | 2871502614 | 149 |
| 43 | iso_pu_bacteria | 2876363079 | 2876367776 | 149 |
| 44 | iso_pu_bacteria | 2876392853 | 2876394040 | 149 |
| 45 | iso_pu_bacteria | 2878035449 | 2878042136 | 149 |
| 46 | iso_pu_bacteria | 2878760144 | 2878766506 | 149 |
| 47 | iso_pu_bacteria | 2878767105 | 2878773702 | 149 |
| 48 | iso_pu_bacteria | 2881161766 | 2881167156 | 149 |
| 49 | iso_pu_bacteria | 2881364244 | 2881368644 | 149 |
| 50 | iso_pu_bacteria | 2882632389 | 2882640636 | 149 |
| 51 | iso_pu_bacteria | 2885305155 | 2885308662 | 149 |
| 52 | iso_pu_bacteria | 2885326080 | 2885327597 | 149 |
| 53 | iso_pu_bacteria | 2885383462 | 2885389287 | 149 |
| 54 | iso_pu_bacteria | 2903521522 | 2903521707 | 149 |
| 55 | iso_pu_bacteria | 2903528002 | 2903528084 | 149 |
| 56 | iso_pu_bacteria | 2903540706 | 2903547655 | 149 |
| 57 | iso_pu_bacteria | 2903768456 | 2903771057 | 149 |
| 58 | iso_pu_bacteria | 2904659560 | 2904660371 | 149 |
| 59 | iso_pu_bacteria | 2906378014 | 2906380421 | 149 |
| 60 | iso_pu_bacteria | 2906414383 | 2906419537 | 149 |
| 61 | iso_pu_bacteria | 2906626472 | 2906633970 | 149 |
| 62 | iso_pu_bacteria | 2909042592 | 2909045762 | 149 |
| 63 | iso_pu_bacteria | 2937994558 | 2938001530 | 149 |
| 64 | iso_pu_bacteria | 2958165035 | 2958171684 | 149 |
| 65 | iso_pu_bacteria | 2961114664 | 2961115696 | 149 |
| 66 | iso_pu_bacteria | 2961163497 | 2961170125 | 149 |
| 67 | iso_pu_bacteria | 2963644680 | 2963647012 | 149 |
| 68 | iso_pu_bacteria | 2965018300 | 2965024876 | 149 |
| 69 | iso_pu_bacteria | 2968110612 | 2968111429 | 149 |
| 70 | iso_pu_bacteria | 2968171901 | 2968178517 | 149 |
| 71 | iso_pu_bacteria | 2970554993 | 2970561362 | 149 |
| 72 | iso_pu_bacteria | 2977922695 | 2977928201 | 149 |
| 73 | iso_pu_bacteria | 2987659509 | 2987666366 | 149 |
| 74 | iso_pu_bacteria | 3000135777 | 3000139969 | 149 |
| 75 | iso_pu_bacteria | 3004188549 | 3004195372 | 149 |
| 76 | iso_pu_bacteria | 3004211236 | 3004215407 | 149 |
| 77 | iso_pu_bacteria | 3004218560 | 3004225750 | 149 |
| 78 | iso_pu_bacteria | 3004334049 | 3004335310 | 149 |
| 79 | 3300003316 | rootH1_10089477 | rootH1_100894772 | 150 |
| 80 | 3300005327 | Ga0070658_10607732 | Ga0070658_106077322 | 150 |
| 81 | 3300005336 | Ga0070680_100000100 | Ga0070680_10000010035 | 150 |
| 82 | 3300005347 | Ga0070668_100595548 | Ga0070668_1005955481 | 150 |
| 83 | 3300005355 | Ga0070671_100570320 | Ga0070671_1005703202 | 150 |
| 84 | 3300005439 | Ga0070711_100110907 | Ga0070711_1001109073 | 150 |
| 85 | 3300005457 | Ga0070662_101321290 | Ga0070662_1013212901 | 150 |
| 86 | 3300005458 | Ga0070681_10000003 | Ga0070681_1000000382 | 150 |
| 87 | 3300005530 | Ga0070679_100000617 | Ga0070679_10000061718 | 150 |
| 88 | 3300005543 | Ga0070672_100315141 | Ga0070672_1003151413 | 150 |
| 89 | 3300005548 | Ga0070665_101361359 | Ga0070665_1013613592 | 150 |
| 90 | 3300005564 | Ga0070664_100496083 | Ga0070664_1004960831 | 150 |
| 91 | 3300006178 | Ga0075367_10126195 | Ga0075367_101261951 | 150 |
| 92 | 3300006881 | Ga0068865_100287014 | Ga0068865_1002870142 | 150 |
| 93 | 3300009177 | Ga0105248_11630474 | Ga0105248_116304741 | 150 |
| 94 | 3300009551 | Ga0105238_10884063 | Ga0105238_108840631 | 150 |
| 95 | 3300013104 | Ga0157370_10286872 | Ga0157370_102868723 | 150 |
| 96 | 3300014325 | Ga0163163_11401241 | Ga0163163_114012411 | 150 |
| 97 | 3300014969 | Ga0157376_10829731 | Ga0157376_108297312 | 150 |
| 98 | 3300016635 | Ga0183361_10019 | Ga0183361_1001937 | 150 |
| 99 | 3300021384 | Ga0213876_10000199 | Ga0213876_1000019923 | 150 |
| 100 | 3300025898 | Ga0207692_10595713 | Ga0207692_105957131 | 150 |
| 101 | 3300025909 | Ga0207705_10325429 | Ga0207705_103254291 | 150 |
| 102 | 3300025912 | Ga0207707_10000001 | Ga0207707_10000001969 | 150 |
| 103 | 3300025917 | Ga0207660_10006202 | Ga0207660_100062021 | 150 |
| 104 | 3300025921 | Ga0207652_10000413 | Ga0207652_1000041341 | 150 |
| 105 | 3300025923 | Ga0207681_10624552 | Ga0207681_106245522 | 150 |
| 106 | 3300025933 | Ga0207706_10860108 | Ga0207706_108601082 | 150 |
| 107 | 3300025934 | Ga0207686_10047226 | Ga0207686_100472262 | 150 |
| 108 | 3300025938 | Ga0207704_10254216 | Ga0207704_102542162 | 150 |
| 109 | 3300025981 | Ga0207640_10304524 | Ga0207640_103045243 | 150 |
| 110 | 3300026023 | Ga0207677_10056319 | Ga0207677_100563195 | 150 |
| 111 | 3300026067 | Ga0207678_10143698 | Ga0207678_101436983 | 150 |
| 112 | 3300026118 | Ga0207675_100053500 | Ga0207675_1000535003 | 150 |
| 113 | 3300026118 | Ga0207675_100162290 | Ga0207675_1001622902 | 150 |
| 114 | 3300028573 | Ga0265334_10030844 | Ga0265334_100308442 | 150 |
| 115 | 3300028786 | Ga0307517_10571011 | Ga0307517_105710111 | 150 |
| 116 | 3300028800 | Ga0265338_10001143 | Ga0265338_1000114329 | 150 |
| 117 | 3300031235 | Ga0265330_10343531 | Ga0265330_103435312 | 150 |
| 118 | 3300031241 | Ga0265325_10000003 | Ga0265325_10000003257 | 150 |
| 119 | 3300031249 | Ga0265339_10008231 | Ga0265339_100082313 | 150 |
| 120 | 3300031250 | Ga0265331_10007890 | Ga0265331_100078906 | 150 |
| 121 | 3300031456 | Ga0307513_10098957 | Ga0307513_100989572 | 150 |
| 122 | 3300031507 | Ga0307509_10015345 | Ga0307509_100153457 | 150 |
| 123 | 3300031595 | Ga0265313_10002034 | Ga0265313_100020346 | 150 |
| 124 | 3300031711 | Ga0265314_10097202 | Ga0265314_100972023 | 150 |
| 125 | 3300031712 | Ga0265342_10002356 | Ga0265342_1000235613 | 150 |
| 126 | 3300035410 | Ga0373924_0114098 | Ga0373924_0114098_465_917 | 150 |
| 127 | 3300035692 | Ga0373935_0705821 | Ga0373935_0705821_260_712 | 150 |
| 128 | 3300037471 | Ga0395905_0511984 | Ga0395905_0511984_58_510 | 150 |
| 129 | 3300039437 | Ga0436365_1490174 | Ga0436365_1490174_40195_40647 | 150 |
| 130 | 3300046461 | Ga0495641_0297233 | Ga0495641_0297233_261_713 | 150 |
| 131 | 3300046471 | Ga0495650_0107466 | Ga0495650_0107466_395_847 | 150 |
| 132 | 3300046660 | Ga0495625_0251596 | Ga0495625_0251596_652_1104 | 150 |
| 133 | 3300047472 | Ga0495686_0005875 | Ga0495686_0005875_6910_7362 | 150 |
| 134 | 3300048917 | Ga0496114_0059861 | Ga0496114_0059861_1736_2188 | 150 |
| 135 | 3300049460 | Ga0495682_0210090 | Ga0495682_0210090_124_576 | 150 |
| 136 | 3300049572 | Ga0501036_0455004 | Ga0501036_0455004_374_829 | 150 |
| 137 | 3300049572 | Ga0501036_0498463 | Ga0501036_0498463_413_868 | 150 |
| 138 | 3300049573 | Ga0501037_0544197 | Ga0501037_0544197_138_593 | 150 |
| 139 | 3300049574 | Ga0501038_0879840 | Ga0501038_0879840_88_543 | 150 |
| 140 | 3300049577 | Ga0501041_0146184 | Ga0501041_0146184_321_776 | 150 |
| 141 | 3300049577 | Ga0501041_0474816 | Ga0501041_0474816_118_570 | 150 |
| 142 | 3300049577 | Ga0501041_0769723 | Ga0501041_0769723_74_529 | 150 |
| 143 | 3300049578 | Ga0501042_0129862 | Ga0501042_0129862_1195_1650 | 150 |
| 144 | 3300049578 | Ga0501042_0366626 | Ga0501042_0366626_58_513 | 150 |
| 145 | 3300049580 | Ga0501046_0462795 | Ga0501046_0462795_132_587 | 150 |
| 146 | 3300049587 | Ga0501071_0040460 | Ga0501071_0040460_346_801 | 150 |
| 147 | 3300049588 | Ga0501072_0183838 | Ga0501072_0183838_720_1175 | 150 |
| 148 | 3300049588 | Ga0501072_0790817 | Ga0501072_0790817_10_465 | 150 |
| 149 | 3300049591 | Ga0501075_1141726 | Ga0501075_1141726_38_493 | 150 |
| 150 | 3300049592 | Ga0501076_0293315 | Ga0501076_0293315_541_996 | 150 |
| 151 | 3300049592 | Ga0501076_1564974 | Ga0501076_1564974_64_519 | 150 |
| 152 | 3300049743 | Ga0501081_0430257 | Ga0501081_0430257_211_666 | 150 |
| 153 | 3300049743 | Ga0501081_0729605 | Ga0501081_0729605_46_501 | 150 |
| 154 | 3300049744 | Ga0501083_0317378 | Ga0501083_0317378_270_722 | 150 |
| 155 | 3300049824 | Ga0501045_0987447 | Ga0501045_0987447_20_475 | 150 |
| 156 | 3300050489 | nmdc:mga03683_20631_c1 | nmdc:mga03683_20631_c1_1581_2033 | 150 |
| 157 | 3300050490 | nmdc:mga03n38_26439_c1 | nmdc:mga03n38_26439_c1_32_484 | 150 |
| 158 | 3300050494 | nmdc:mga06z11_164882_c1 | nmdc:mga06z11_164882_c1_141_593 | 150 |
| 159 | 3300050516 | nmdc:mga0sz30_498_c1 | nmdc:mga0sz30_498_c1_13006_13458 | 150 |
| 160 | 3300053115 | Ga0500591_021093 | Ga0500591_021093_2127_2579 | 150 |
| 161 | 3300053159 | Ga0500630_079480 | Ga0500630_079480_826_1278 | 150 |
| 162 | 3300053163 | Ga0500639_082373 | Ga0500639_082373_945_1397 | 150 |
| 163 | 3300060353 | Ga0501082_1306347 | Ga0501082_1306347_41_493 | 150 |
| 164 | 3300005327 | Ga0070658_10179056 | Ga0070658_101790562 | 151 |
| 165 | 3300005327 | Ga0070658_11095568 | Ga0070658_110955682 | 151 |
| 166 | 3300005330 | Ga0070690_101309311 | Ga0070690_1013093111 | 151 |
| 167 | 3300005334 | Ga0068869_100041558 | Ga0068869_1000415584 | 151 |
| 168 | 3300005335 | Ga0070666_10107266 | Ga0070666_101072662 | 151 |
| 169 | 3300005367 | Ga0070667_100316524 | Ga0070667_1003165242 | 151 |
| 170 | 3300005367 | Ga0070667_100567637 | Ga0070667_1005676372 | 151 |
| 171 | 3300005406 | Ga0070703_10330955 | Ga0070703_103309551 | 151 |
| 172 | 3300005444 | Ga0070694_100245939 | Ga0070694_1002459392 | 151 |
| 173 | 3300005455 | Ga0070663_100344216 | Ga0070663_1003442163 | 151 |
| 174 | 3300005455 | Ga0070663_100946631 | Ga0070663_1009466312 | 151 |
| 175 | 3300005545 | Ga0070695_100028477 | Ga0070695_1000284772 | 151 |
| 176 | 3300005548 | Ga0070665_100012379 | Ga0070665_1000123798 | 151 |
| 177 | 3300005548 | Ga0070665_100111711 | Ga0070665_1001117112 | 151 |
| 178 | 3300005577 | Ga0068857_100556346 | Ga0068857_1005563462 | 151 |
| 179 | 3300005617 | Ga0068859_101729843 | Ga0068859_1017298432 | 151 |
| 180 | 3300005719 | Ga0068861_100348850 | Ga0068861_1003488502 | 151 |
| 181 | 3300005843 | Ga0068860_100418628 | Ga0068860_1004186282 | 151 |
| 182 | 3300005844 | Ga0068862_100018205 | Ga0068862_1000182055 | 151 |
| 183 | 3300006844 | Ga0075428_100041639 | Ga0075428_1000416398 | 151 |
| 184 | 3300006846 | Ga0075430_100026810 | Ga0075430_1000268106 | 151 |
| 185 | 3300006847 | Ga0075431_100270157 | Ga0075431_1002701572 | 151 |
| 186 | 3300006880 | Ga0075429_100048877 | Ga0075429_1000488772 | 151 |
| 187 | 3300006931 | Ga0097620_101729808 | Ga0097620_1017298081 | 151 |
| 188 | 3300009093 | Ga0105240_10209355 | Ga0105240_102093552 | 151 |
| 189 | 3300009093 | Ga0105240_10329580 | Ga0105240_103295802 | 151 |
| 190 | 3300009094 | Ga0111539_10131475 | Ga0111539_101314752 | 151 |
| 191 | 3300009098 | Ga0105245_11170708 | Ga0105245_111707082 | 151 |
| 192 | 3300009147 | Ga0114129_10020069 | Ga0114129_100200694 | 151 |
| 193 | 3300009174 | Ga0105241_10920612 | Ga0105241_109206122 | 151 |
| 194 | 3300009177 | Ga0105248_10329928 | Ga0105248_103299282 | 151 |
| 195 | 3300009551 | Ga0105238_10599671 | Ga0105238_105996712 | 151 |
| 196 | 3300009553 | Ga0105249_10025505 | Ga0105249_100255053 | 151 |
| 197 | 3300009553 | Ga0105249_10473084 | Ga0105249_104730842 | 151 |
| 198 | 3300010375 | Ga0105239_10094436 | Ga0105239_100944362 | 151 |
| 199 | 3300014325 | Ga0163163_10274437 | Ga0163163_102744372 | 151 |
| 200 | 3300014968 | Ga0157379_10002565 | Ga0157379_100025653 | 151 |
| 201 | 3300017792 | Ga0163161_10024154 | Ga0163161_100241542 | 151 |
| 202 | 3300017792 | Ga0163161_10504879 | Ga0163161_105048792 | 151 |
| 203 | 3300025911 | Ga0207654_10221975 | Ga0207654_102219752 | 151 |
| 204 | 3300025911 | Ga0207654_10911827 | Ga0207654_109118272 | 151 |
| 205 | 3300025913 | Ga0207695_10576283 | Ga0207695_105762832 | 151 |
| 206 | 3300025914 | Ga0207671_10367040 | Ga0207671_103670401 | 151 |
| 207 | 3300025926 | Ga0207659_10651928 | Ga0207659_106519282 | 151 |
| 208 | 3300025927 | Ga0207687_10789665 | Ga0207687_107896651 | 151 |
| 209 | 3300025937 | Ga0207669_10027195 | Ga0207669_100271955 | 151 |
| 210 | 3300025941 | Ga0207711_10164032 | Ga0207711_101640322 | 151 |
| 211 | 3300025945 | Ga0207679_10536715 | Ga0207679_105367152 | 151 |
| 212 | 3300025961 | Ga0207712_10137029 | Ga0207712_101370292 | 151 |
| 213 | 3300025961 | Ga0207712_10197782 | Ga0207712_101977822 | 151 |
| 214 | 3300025972 | Ga0207668_10332320 | Ga0207668_103323201 | 151 |
| 215 | 3300025986 | Ga0207658_10480778 | Ga0207658_104807782 | 151 |
| 216 | 3300026035 | Ga0207703_10054479 | Ga0207703_100544792 | 151 |
| 217 | 3300026035 | Ga0207703_10545256 | Ga0207703_105452561 | 151 |
| 218 | 3300026067 | Ga0207678_10142098 | Ga0207678_101420983 | 151 |
| 219 | 3300026067 | Ga0207678_11183120 | Ga0207678_111831202 | 151 |
| 220 | 3300026088 | Ga0207641_10056202 | Ga0207641_100562022 | 151 |
| 221 | 3300026121 | Ga0207683_10009296 | Ga0207683_1000929617 | 151 |
| 222 | 3300027907 | Ga0207428_10281415 | Ga0207428_102814152 | 151 |
| 223 | 3300028379 | Ga0268266_10014221 | Ga0268266_100142215 | 151 |
| 224 | 3300028379 | Ga0268266_10199282 | Ga0268266_101992822 | 151 |
| 225 | 3300028380 | Ga0268265_10462639 | Ga0268265_104626392 | 151 |
| 226 | 3300028381 | Ga0268264_10365408 | Ga0268264_103654082 | 151 |
| 227 | 3300028800 | Ga0265338_10166873 | Ga0265338_101668732 | 151 |
| 228 | 3300031241 | Ga0265325_10093846 | Ga0265325_100938462 | 151 |
| 229 | 3300031247 | Ga0265340_10054101 | Ga0265340_100541013 | 151 |
| 230 | 3300031250 | Ga0265331_10027595 | Ga0265331_100275952 | 151 |
| 231 | 3300031344 | Ga0265316_10042338 | Ga0265316_100423382 | 151 |
| 232 | 3300046507 | Ga0495606_0001322 | Ga0495606_0001322_12429_12890 | 151 |
| 233 | 3300046524 | Ga0495648_0060366 | Ga0495648_0060366_1221_1676 | 151 |
| 234 | 3300047319 | Ga0495674_0019683 | Ga0495674_0019683_3317_3772 | 151 |
| 235 | 3300047445 | Ga0495677_0255876 | Ga0495677_0255876_156_611 | 151 |
| 236 | 3300048913 | Ga0496110_0391515 | Ga0496110_0391515_773_1228 | 151 |
| 237 | 3300048917 | Ga0496114_0293527 | Ga0496114_0293527_457_912 | 151 |
| 238 | 3300048924 | Ga0496121_0024062 | Ga0496121_0024062_4475_4936 | 151 |
| 239 | 3300048929 | Ga0496126_0327021 | Ga0496126_0327021_525_980 | 151 |
| 240 | 3300049575 | Ga0501039_1529254 | Ga0501039_1529254_30_485 | 151 |
| 241 | 3300049822 | Ga0501035_0271002 | Ga0501035_0271002_841_1296 | 151 |
| 242 | 3300050507 | nmdc:mga05p37_101701_c1 | nmdc:mga05p37_101701_c1_1531_1986 | 151 |
| 243 | 3300050509 | nmdc:mga0qj67_234921_c1 | nmdc:mga0qj67_234921_c1_465_920 | 151 |
| 244 | 3300050510 | nmdc:mga06r32_41095_c1 | nmdc:mga06r32_41095_c1_2778_3233 | 151 |
| 245 | 3300050511 | nmdc:mga08y16_121478_c1 | nmdc:mga08y16_121478_c1_1641_2096 | 151 |
| 246 | 3300053103 | Ga0500555_113367 | Ga0500555_113367_169_624 | 151 |
| 247 | 3300053119 | Ga0500595_096907 | Ga0500595_096907_346_825 | 151 |
| 248 | 3300053130 | Ga0500642_0085365 | Ga0500642_0085365_552_1007 | 151 |
| 249 | 3300053153 | Ga0500616_0098604 | Ga0500616_0098604_421_876 | 151 |
| 250 | 3300005295 | Ga0065707_10014405 | Ga0065707_100144052 | 152 |
| 251 | 3300005329 | Ga0070683_100975968 | Ga0070683_1009759682 | 152 |
| 252 | 3300005355 | Ga0070671_100013931 | Ga0070671_1000139315 | 152 |
| 253 | 3300005458 | Ga0070681_10012589 | Ga0070681_100125893 | 152 |
| 254 | 3300005530 | Ga0070679_100134472 | Ga0070679_1001344723 | 152 |
| 255 | 3300005841 | Ga0068863_101424819 | Ga0068863_1014248192 | 152 |
| 256 | 3300005937 | Ga0081455_10054938 | Ga0081455_100549383 | 152 |
| 257 | 3300006880 | Ga0075429_100854497 | Ga0075429_1008544971 | 152 |
| 258 | 3300007076 | Ga0075435_100925174 | Ga0075435_1009251741 | 152 |
| 259 | 3300009093 | Ga0105240_10004725 | Ga0105240_1000472514 | 152 |
| 260 | 3300009176 | Ga0105242_10235070 | Ga0105242_102350702 | 152 |
| 261 | 3300009177 | Ga0105248_10304272 | Ga0105248_103042722 | 152 |
| 262 | 3300009551 | Ga0105238_10298174 | Ga0105238_102981742 | 152 |
| 263 | 3300011119 | Ga0105246_10610098 | Ga0105246_106100982 | 152 |
| 264 | 3300013104 | Ga0157370_10193841 | Ga0157370_101938413 | 152 |
| 265 | 3300013105 | Ga0157369_10084640 | Ga0157369_100846405 | 152 |
| 266 | 3300025912 | Ga0207707_10002401 | Ga0207707_1000240111 | 152 |
| 267 | 3300025913 | Ga0207695_10029064 | Ga0207695_100290648 | 152 |
| 268 | 3300025934 | Ga0207686_10035895 | Ga0207686_100358954 | 152 |
| 269 | 3300025945 | Ga0207679_10289559 | Ga0207679_102895592 | 152 |
| 270 | 3300025949 | Ga0207667_10512953 | Ga0207667_105129532 | 152 |
| 271 | 3300026088 | Ga0207641_11284295 | Ga0207641_112842952 | 152 |
| 272 | 3300026095 | Ga0207676_11076634 | Ga0207676_110766342 | 152 |
| 273 | 3300028381 | Ga0268264_10857576 | Ga0268264_108575761 | 152 |
| 274 | 3300035088 | Ga0373940_0079961 | Ga0373940_0079961_471_938 | 152 |
| 275 | 3300038443 | Ga0395901_0069562 | Ga0395901_0069562_2638_3099 | 152 |
| 276 | 3300045051 | Ga0451576_1195248 | Ga0451576_1195248_90_548 | 152 |
| 277 | 3300046471 | Ga0495650_0269057 | Ga0495650_0269057_105_563 | 152 |
| 278 | 3300046528 | Ga0495642_0032391 | Ga0495642_0032391_32_490 | 152 |
| 279 | 3300046616 | Ga0495668_0022559 | Ga0495668_0022559_1711_2169 | 152 |
| 280 | 3300046616 | Ga0495668_0393483 | Ga0495668_0393483_76_549 | 152 |
| 281 | 3300047447 | Ga0495685_131461 | Ga0495685_131461_147_605 | 152 |
| 282 | 3300048904 | Ga0496101_0491896 | Ga0496101_0491896_425_883 | 152 |
| 283 | 3300048907 | Ga0496104_0001121 | Ga0496104_0001121_19392_19853 | 152 |
| 284 | 3300048908 | Ga0496105_0296556 | Ga0496105_0296556_730_1191 | 152 |
| 285 | 3300048910 | Ga0496107_0577437 | Ga0496107_0577437_330_797 | 152 |
| 286 | 3300048911 | Ga0496108_0049676 | Ga0496108_0049676_1760_2221 | 152 |
| 287 | 3300048912 | Ga0496109_0021712 | Ga0496109_0021712_1202_1663 | 152 |
| 288 | 3300048913 | Ga0496110_0054366 | Ga0496110_0054366_2918_3379 | 152 |
| 289 | 3300048914 | Ga0496111_0036443 | Ga0496111_0036443_3031_3492 | 152 |
| 290 | 3300048915 | Ga0496112_0069837 | Ga0496112_0069837_2586_3047 | 152 |
| 291 | 3300048915 | Ga0496112_0861435 | Ga0496112_0861435_327_785 | 152 |
| 292 | 3300048915 | Ga0496112_1221463 | Ga0496112_1221463_62_520 | 152 |
| 293 | 3300048916 | Ga0496113_0088614 | Ga0496113_0088614_1454_1915 | 152 |
| 294 | 3300048917 | Ga0496114_0042505 | Ga0496114_0042505_3261_3719 | 152 |
| 295 | 3300048924 | Ga0496121_0007495 | Ga0496121_0007495_2065_2679 | 152 |
| 296 | 3300049742 | Ga0501080_0624361 | Ga0501080_0624361_425_883 | 152 |
| 297 | 3300049823 | Ga0501044_0008139 | Ga0501044_0008139_10936_11394 | 152 |
| 298 | 3300050507 | nmdc:mga05p37_270572_c1 | nmdc:mga05p37_270572_c1_1029_1487 | 152 |
| 299 | 3300050508 | nmdc:mga09592_796195_c1 | nmdc:mga09592_796195_c1_156_614 | 152 |
| 300 | 3300050512 | nmdc:mga0n895_813131_c1 | nmdc:mga0n895_813131_c1_297_758 | 152 |
| 301 | 3300053131 | Ga0500652_144470 | Ga0500652_144470_451_912 | 152 |
| 302 | 3300053148 | Ga0500590_263529 | Ga0500590_263529_110_568 | 152 |
| 303 | 3300053737 | Ga0500601_000289 | Ga0500601_000289_7414_7872 | 152 |
| 304 | 2162886011 | MRS1b_contig_8759762 | MRS1b_0523.00001910 | 153 |
| 305 | 3300003323 | rootH1_10187089 | rootH1_101870892 | 153 |
| 306 | 3300005290 | Ga0065712_10086956 | Ga0065712_100869566 | 153 |
| 307 | 3300005327 | Ga0070658_10018443 | Ga0070658_100184435 | 153 |
| 308 | 3300005327 | Ga0070658_10053478 | Ga0070658_100534782 | 153 |
| 309 | 3300005330 | Ga0070690_100001207 | Ga0070690_1000012079 | 153 |
| 310 | 3300005331 | Ga0070670_100160687 | Ga0070670_1001606871 | 153 |
| 311 | 3300005331 | Ga0070670_100182808 | Ga0070670_1001828083 | 153 |
| 312 | 3300005334 | Ga0068869_100001173 | Ga0068869_10000117313 | 153 |
| 313 | 3300005335 | Ga0070666_10006559 | Ga0070666_100065594 | 153 |
| 314 | 3300005335 | Ga0070666_10178562 | Ga0070666_101785622 | 153 |
| 315 | 3300005336 | Ga0070680_100031230 | Ga0070680_1000312301 | 153 |
| 316 | 3300005338 | Ga0068868_100030920 | Ga0068868_1000309209 | 153 |
| 317 | 3300005339 | Ga0070660_100026765 | Ga0070660_1000267655 | 153 |
| 318 | 3300005339 | Ga0070660_100060488 | Ga0070660_1000604882 | 153 |
| 319 | 3300005339 | Ga0070660_100492611 | Ga0070660_1004926112 | 153 |
| 320 | 3300005340 | Ga0070689_100004919 | Ga0070689_1000049199 | 153 |
| 321 | 3300005343 | Ga0070687_100001063 | Ga0070687_1000010633 | 153 |
| 322 | 3300005347 | Ga0070668_101198339 | Ga0070668_1011983391 | 153 |
| 323 | 3300005354 | Ga0070675_100004592 | Ga0070675_1000045929 | 153 |
| 324 | 3300005355 | Ga0070671_100025224 | Ga0070671_10002522410 | 153 |
| 325 | 3300005356 | Ga0070674_100048580 | Ga0070674_1000485804 | 153 |
| 326 | 3300005356 | Ga0070674_100078461 | Ga0070674_1000784612 | 153 |
| 327 | 3300005364 | Ga0070673_100017107 | Ga0070673_1000171077 | 153 |
| 328 | 3300005365 | Ga0070688_100011830 | Ga0070688_1000118306 | 153 |
| 329 | 3300005365 | Ga0070688_101139585 | Ga0070688_1011395851 | 153 |
| 330 | 3300005366 | Ga0070659_100004294 | Ga0070659_1000042944 | 153 |
| 331 | 3300005367 | Ga0070667_100071415 | Ga0070667_1000714154 | 153 |
| 332 | 3300005367 | Ga0070667_100198212 | Ga0070667_1001982124 | 153 |
| 333 | 3300005436 | Ga0070713_100106481 | Ga0070713_1001064812 | 153 |
| 334 | 3300005438 | Ga0070701_10083096 | Ga0070701_100830962 | 153 |
| 335 | 3300005438 | Ga0070701_11244441 | Ga0070701_112444411 | 153 |
| 336 | 3300005441 | Ga0070700_100635299 | Ga0070700_1006352992 | 153 |
| 337 | 3300005444 | Ga0070694_100074610 | Ga0070694_1000746102 | 153 |
| 338 | 3300005455 | Ga0070663_100521898 | Ga0070663_1005218982 | 153 |
| 339 | 3300005456 | Ga0070678_100359171 | Ga0070678_1003591713 | 153 |
| 340 | 3300005456 | Ga0070678_100488187 | Ga0070678_1004881872 | 153 |
| 341 | 3300005457 | Ga0070662_100002203 | Ga0070662_10000220312 | 153 |
| 342 | 3300005457 | Ga0070662_100205085 | Ga0070662_1002050853 | 153 |
| 343 | 3300005458 | Ga0070681_10011899 | Ga0070681_100118993 | 153 |
| 344 | 3300005458 | Ga0070681_10572466 | Ga0070681_105724662 | 153 |
| 345 | 3300005459 | Ga0068867_100009429 | Ga0068867_1000094299 | 153 |
| 346 | 3300005466 | Ga0070685_10144993 | Ga0070685_101449933 | 153 |
| 347 | 3300005467 | Ga0070706_100256157 | Ga0070706_1002561571 | 153 |
| 348 | 3300005467 | Ga0070706_101062470 | Ga0070706_1010624702 | 153 |
| 349 | 3300005468 | Ga0070707_100962154 | Ga0070707_1009621541 | 153 |
| 350 | 3300005530 | Ga0070679_100002859 | Ga0070679_10000285913 | 153 |
| 351 | 3300005530 | Ga0070679_100306407 | Ga0070679_1003064073 | 153 |
| 352 | 3300005535 | Ga0070684_100074972 | Ga0070684_1000749722 | 153 |
| 353 | 3300005539 | Ga0068853_100004867 | Ga0068853_1000048673 | 153 |
| 354 | 3300005539 | Ga0068853_100746552 | Ga0068853_1007465522 | 153 |
| 355 | 3300005539 | Ga0068853_101258851 | Ga0068853_1012588511 | 153 |
| 356 | 3300005543 | Ga0070672_100005409 | Ga0070672_1000054093 | 153 |
| 357 | 3300005544 | Ga0070686_100000293 | Ga0070686_10000029310 | 153 |
| 358 | 3300005547 | Ga0070693_100215841 | Ga0070693_1002158412 | 153 |
| 359 | 3300005548 | Ga0070665_100029685 | Ga0070665_1000296859 | 153 |
| 360 | 3300005548 | Ga0070665_100043223 | Ga0070665_1000432232 | 153 |
| 361 | 3300005548 | Ga0070665_100076443 | Ga0070665_1000764434 | 153 |
| 362 | 3300005548 | Ga0070665_100261818 | Ga0070665_1002618183 | 153 |
| 363 | 3300005549 | Ga0070704_100541308 | Ga0070704_1005413082 | 153 |
| 364 | 3300005563 | Ga0068855_100000010 | Ga0068855_10000001040 | 153 |
| 365 | 3300005563 | Ga0068855_100008942 | Ga0068855_1000089428 | 153 |
| 366 | 3300005563 | Ga0068855_101441640 | Ga0068855_1014416401 | 153 |
| 367 | 3300005564 | Ga0070664_100110535 | Ga0070664_1001105353 | 153 |
| 368 | 3300005577 | Ga0068857_100040969 | Ga0068857_1000409693 | 153 |
| 369 | 3300005577 | Ga0068857_100059009 | Ga0068857_1000590098 | 153 |
| 370 | 3300005577 | Ga0068857_100372171 | Ga0068857_1003721712 | 153 |
| 371 | 3300005614 | Ga0068856_100246583 | Ga0068856_1002465834 | 153 |
| 372 | 3300005615 | Ga0070702_100000359 | Ga0070702_1000003594 | 153 |
| 373 | 3300005616 | Ga0068852_100158317 | Ga0068852_1001583175 | 153 |
| 374 | 3300005617 | Ga0068859_100001219 | Ga0068859_10000121924 | 153 |
| 375 | 3300005617 | Ga0068859_100011800 | Ga0068859_1000118008 | 153 |
| 376 | 3300005618 | Ga0068864_100008319 | Ga0068864_10000831910 | 153 |
| 377 | 3300005618 | Ga0068864_100241518 | Ga0068864_1002415183 | 153 |
| 378 | 3300005718 | Ga0068866_10236126 | Ga0068866_102361262 | 153 |
| 379 | 3300005719 | Ga0068861_100001118 | Ga0068861_1000011189 | 153 |
| 380 | 3300005719 | Ga0068861_100091884 | Ga0068861_1000918843 | 153 |
| 381 | 3300005719 | Ga0068861_100126498 | Ga0068861_1001264982 | 153 |
| 382 | 3300005840 | Ga0068870_10127249 | Ga0068870_101272492 | 153 |
| 383 | 3300005841 | Ga0068863_100013717 | Ga0068863_1000137176 | 153 |
| 384 | 3300005841 | Ga0068863_100052578 | Ga0068863_1000525782 | 153 |
| 385 | 3300005842 | Ga0068858_100003828 | Ga0068858_1000038284 | 153 |
| 386 | 3300005842 | Ga0068858_100073512 | Ga0068858_1000735125 | 153 |
| 387 | 3300005843 | Ga0068860_100000274 | Ga0068860_10000027410 | 153 |
| 388 | 3300005843 | Ga0068860_100029840 | Ga0068860_1000298403 | 153 |
| 389 | 3300005844 | Ga0068862_100020732 | Ga0068862_1000207322 | 153 |
| 390 | 3300005844 | Ga0068862_100045872 | Ga0068862_1000458724 | 153 |
| 391 | 3300005844 | Ga0068862_100439597 | Ga0068862_1004395971 | 153 |
| 392 | 3300005937 | Ga0081455_10258515 | Ga0081455_102585152 | 153 |
| 393 | 3300005983 | Ga0081540_1000213 | Ga0081540_100021359 | 153 |
| 394 | 3300005983 | Ga0081540_1163641 | Ga0081540_11636412 | 153 |
| 395 | 3300006028 | Ga0070717_10076467 | Ga0070717_100764672 | 153 |
| 396 | 3300006048 | Ga0075363_100443865 | Ga0075363_1004438652 | 153 |
| 397 | 3300006051 | Ga0075364_10031574 | Ga0075364_100315745 | 153 |
| 398 | 3300006175 | Ga0070712_100715148 | Ga0070712_1007151482 | 153 |
| 399 | 3300006178 | Ga0075367_10036025 | Ga0075367_100360253 | 153 |
| 400 | 3300006178 | Ga0075367_10626924 | Ga0075367_106269241 | 153 |
| 401 | 3300006237 | Ga0097621_100000341 | Ga0097621_10000034123 | 153 |
| 402 | 3300006237 | Ga0097621_100099829 | Ga0097621_1000998293 | 153 |
| 403 | 3300006237 | Ga0097621_100252420 | Ga0097621_1002524203 | 153 |
| 404 | 3300006237 | Ga0097621_100302987 | Ga0097621_1003029873 | 153 |
| 405 | 3300006358 | Ga0068871_100000340 | Ga0068871_1000003409 | 153 |
| 406 | 3300006358 | Ga0068871_100052366 | Ga0068871_1000523663 | 153 |
| 407 | 3300006844 | Ga0075428_100127042 | Ga0075428_1001270422 | 153 |
| 408 | 3300006844 | Ga0075428_100279966 | Ga0075428_1002799662 | 153 |
| 409 | 3300006846 | Ga0075430_100004465 | Ga0075430_1000044659 | 153 |
| 410 | 3300006846 | Ga0075430_100024970 | Ga0075430_1000249705 | 153 |
| 411 | 3300006846 | Ga0075430_100274244 | Ga0075430_1002742442 | 153 |
| 412 | 3300006847 | Ga0075431_100008217 | Ga0075431_1000082174 | 153 |
| 413 | 3300006847 | Ga0075431_100323820 | Ga0075431_1003238202 | 153 |
| 414 | 3300006871 | Ga0075434_100316477 | Ga0075434_1003164773 | 153 |
| 415 | 3300006881 | Ga0068865_100039024 | Ga0068865_1000390242 | 153 |
| 416 | 3300006881 | Ga0068865_100046840 | Ga0068865_1000468402 | 153 |
| 417 | 3300006914 | Ga0075436_101278117 | Ga0075436_1012781171 | 153 |
| 418 | 3300006931 | Ga0097620_100001219 | Ga0097620_10000121924 | 153 |
| 419 | 3300006931 | Ga0097620_100011800 | Ga0097620_1000118005 | 153 |
| 420 | 3300007788 | Ga0099795_10319566 | Ga0099795_103195661 | 153 |
| 421 | 3300009094 | Ga0111539_10119717 | Ga0111539_101197175 | 153 |
| 422 | 3300009094 | Ga0111539_10184948 | Ga0111539_101849484 | 153 |
| 423 | 3300009094 | Ga0111539_10727918 | Ga0111539_107279181 | 153 |
| 424 | 3300009098 | Ga0105245_10648350 | Ga0105245_106483502 | 153 |
| 425 | 3300009101 | Ga0105247_10074249 | Ga0105247_100742491 | 153 |
| 426 | 3300009101 | Ga0105247_10141377 | Ga0105247_101413772 | 153 |
| 427 | 3300009147 | Ga0114129_10651127 | Ga0114129_106511272 | 153 |
| 428 | 3300009177 | Ga0105248_10002894 | Ga0105248_1000289419 | 153 |
| 429 | 3300009177 | Ga0105248_10121436 | Ga0105248_101214362 | 153 |
| 430 | 3300009177 | Ga0105248_10421296 | Ga0105248_104212962 | 153 |
| 431 | 3300009551 | Ga0105238_10011351 | Ga0105238_100113519 | 153 |
| 432 | 3300009551 | Ga0105238_10126632 | Ga0105238_101266322 | 153 |
| 433 | 3300009551 | Ga0105238_10182225 | Ga0105238_101822252 | 153 |
| 434 | 3300009551 | Ga0105238_10211660 | Ga0105238_102116601 | 153 |
| 435 | 3300009553 | Ga0105249_10290638 | Ga0105249_102906383 | 153 |
| 436 | 3300009553 | Ga0105249_10874250 | Ga0105249_108742501 | 153 |
| 437 | 3300010375 | Ga0105239_10012604 | Ga0105239_100126046 | 153 |
| 438 | 3300010375 | Ga0105239_10328803 | Ga0105239_103288034 | 153 |
| 439 | 3300010375 | Ga0105239_10335653 | Ga0105239_103356532 | 153 |
| 440 | 3300013296 | Ga0157374_10049581 | Ga0157374_100495816 | 153 |
| 441 | 3300013296 | Ga0157374_11173703 | Ga0157374_111737032 | 153 |
| 442 | 3300013297 | Ga0157378_10076390 | Ga0157378_100763907 | 153 |
| 443 | 3300013306 | Ga0163162_10013049 | Ga0163162_1001304910 | 153 |
| 444 | 3300013306 | Ga0163162_10062320 | Ga0163162_100623202 | 153 |
| 445 | 3300013307 | Ga0157372_10376723 | Ga0157372_103767232 | 153 |
| 446 | 3300013307 | Ga0157372_10813557 | Ga0157372_108135573 | 153 |
| 447 | 3300013308 | Ga0157375_10785046 | Ga0157375_107850461 | 153 |
| 448 | 3300013308 | Ga0157375_10921739 | Ga0157375_109217392 | 153 |
| 449 | 3300014325 | Ga0163163_10000548 | Ga0163163_1000054832 | 153 |
| 450 | 3300014325 | Ga0163163_10181871 | Ga0163163_101818712 | 153 |
| 451 | 3300014325 | Ga0163163_10267305 | Ga0163163_102673052 | 153 |
| 452 | 3300014326 | Ga0157380_10008474 | Ga0157380_100084748 | 153 |
| 453 | 3300014326 | Ga0157380_10015389 | Ga0157380_100153895 | 153 |
| 454 | 3300014326 | Ga0157380_10173711 | Ga0157380_101737112 | 153 |
| 455 | 3300014326 | Ga0157380_10654123 | Ga0157380_106541232 | 153 |
| 456 | 3300014745 | Ga0157377_10020163 | Ga0157377_100201632 | 153 |
| 457 | 3300014968 | Ga0157379_10062422 | Ga0157379_100624223 | 153 |
| 458 | 3300014968 | Ga0157379_10104112 | Ga0157379_101041126 | 153 |
| 459 | 3300014968 | Ga0157379_11395960 | Ga0157379_113959601 | 153 |
| 460 | 3300014969 | Ga0157376_10187475 | Ga0157376_101874752 | 153 |
| 461 | 3300025315 | Ga0207697_10181202 | Ga0207697_101812022 | 153 |
| 462 | 3300025899 | Ga0207642_10244627 | Ga0207642_102446272 | 153 |
| 463 | 3300025899 | Ga0207642_10278944 | Ga0207642_102789442 | 153 |
| 464 | 3300025900 | Ga0207710_10229939 | Ga0207710_102299391 | 153 |
| 465 | 3300025903 | Ga0207680_10088475 | Ga0207680_100884753 | 153 |
| 466 | 3300025903 | Ga0207680_10235683 | Ga0207680_102356831 | 153 |
| 467 | 3300025903 | Ga0207680_10302089 | Ga0207680_103020892 | 153 |
| 468 | 3300025904 | Ga0207647_10160107 | Ga0207647_101601072 | 153 |
| 469 | 3300025906 | Ga0207699_10325280 | Ga0207699_103252802 | 153 |
| 470 | 3300025908 | Ga0207643_10222552 | Ga0207643_102225522 | 153 |
| 471 | 3300025909 | Ga0207705_10000629 | Ga0207705_100006296 | 153 |
| 472 | 3300025909 | Ga0207705_10058035 | Ga0207705_100580353 | 153 |
| 473 | 3300025910 | Ga0207684_10203249 | Ga0207684_102032492 | 153 |
| 474 | 3300025912 | Ga0207707_10005879 | Ga0207707_100058798 | 153 |
| 475 | 3300025912 | Ga0207707_10466337 | Ga0207707_104663372 | 153 |
| 476 | 3300025912 | Ga0207707_10560057 | Ga0207707_105600572 | 153 |
| 477 | 3300025913 | Ga0207695_10167457 | Ga0207695_101674571 | 153 |
| 478 | 3300025914 | Ga0207671_10164666 | Ga0207671_101646662 | 153 |
| 479 | 3300025914 | Ga0207671_10201689 | Ga0207671_102016893 | 153 |
| 480 | 3300025917 | Ga0207660_10000896 | Ga0207660_100008963 | 153 |
| 481 | 3300025918 | Ga0207662_10002950 | Ga0207662_1000295010 | 153 |
| 482 | 3300025919 | Ga0207657_10000704 | Ga0207657_1000070424 | 153 |
| 483 | 3300025919 | Ga0207657_10021074 | Ga0207657_100210747 | 153 |
| 484 | 3300025920 | Ga0207649_10043363 | Ga0207649_100433634 | 153 |
| 485 | 3300025920 | Ga0207649_10119173 | Ga0207649_101191732 | 153 |
| 486 | 3300025920 | Ga0207649_11373267 | Ga0207649_113732671 | 153 |
| 487 | 3300025921 | Ga0207652_10023321 | Ga0207652_100233215 | 153 |
| 488 | 3300025921 | Ga0207652_10028700 | Ga0207652_100287003 | 153 |
| 489 | 3300025921 | Ga0207652_10856262 | Ga0207652_108562622 | 153 |
| 490 | 3300025923 | Ga0207681_10122713 | Ga0207681_101227132 | 153 |
| 491 | 3300025924 | Ga0207694_10000011 | Ga0207694_10000011346 | 153 |
| 492 | 3300025924 | Ga0207694_10254856 | Ga0207694_102548562 | 153 |
| 493 | 3300025924 | Ga0207694_10367244 | Ga0207694_103672442 | 153 |
| 494 | 3300025925 | Ga0207650_10119176 | Ga0207650_101191762 | 153 |
| 495 | 3300025926 | Ga0207659_10066296 | Ga0207659_100662964 | 153 |
| 496 | 3300025928 | Ga0207700_10030609 | Ga0207700_100306092 | 153 |
| 497 | 3300025931 | Ga0207644_10051159 | Ga0207644_100511595 | 153 |
| 498 | 3300025932 | Ga0207690_10003837 | Ga0207690_100038375 | 153 |
| 499 | 3300025933 | Ga0207706_10003404 | Ga0207706_1000340416 | 153 |
| 500 | 3300025933 | Ga0207706_10173125 | Ga0207706_101731254 | 153 |
| 501 | 3300025936 | Ga0207670_10004061 | Ga0207670_100040619 | 153 |
| 502 | 3300025937 | Ga0207669_10058927 | Ga0207669_100589273 | 153 |
| 503 | 3300025937 | Ga0207669_10266878 | Ga0207669_102668782 | 153 |
| 504 | 3300025938 | Ga0207704_10022596 | Ga0207704_100225962 | 153 |
| 505 | 3300025938 | Ga0207704_10139647 | Ga0207704_101396473 | 153 |
| 506 | 3300025939 | Ga0207665_10192047 | Ga0207665_101920471 | 153 |
| 507 | 3300025940 | Ga0207691_10035234 | Ga0207691_100352345 | 153 |
| 508 | 3300025941 | Ga0207711_10094029 | Ga0207711_100940294 | 153 |
| 509 | 3300025941 | Ga0207711_10853675 | Ga0207711_108536752 | 153 |
| 510 | 3300025942 | Ga0207689_10005748 | Ga0207689_100057485 | 153 |
| 511 | 3300025942 | Ga0207689_10567411 | Ga0207689_105674112 | 153 |
| 512 | 3300025944 | Ga0207661_10432669 | Ga0207661_104326691 | 153 |
| 513 | 3300025945 | Ga0207679_10007930 | Ga0207679_100079307 | 153 |
| 514 | 3300025949 | Ga0207667_10000093 | Ga0207667_1000009328 | 153 |
| 515 | 3300025949 | Ga0207667_10001457 | Ga0207667_1000145724 | 153 |
| 516 | 3300025949 | Ga0207667_11503743 | Ga0207667_115037431 | 153 |
| 517 | 3300025960 | Ga0207651_10053897 | Ga0207651_100538974 | 153 |
| 518 | 3300025961 | Ga0207712_10318710 | Ga0207712_103187103 | 153 |
| 519 | 3300025961 | Ga0207712_10399597 | Ga0207712_103995971 | 153 |
| 520 | 3300025961 | Ga0207712_11268081 | Ga0207712_112680812 | 153 |
| 521 | 3300025972 | Ga0207668_11088671 | Ga0207668_110886712 | 153 |
| 522 | 3300025981 | Ga0207640_10505077 | Ga0207640_105050771 | 153 |
| 523 | 3300025986 | Ga0207658_10052026 | Ga0207658_100520264 | 153 |
| 524 | 3300026023 | Ga0207677_10070969 | Ga0207677_100709692 | 153 |
| 525 | 3300026035 | Ga0207703_10000667 | Ga0207703_1000066721 | 153 |
| 526 | 3300026035 | Ga0207703_10061260 | Ga0207703_100612605 | 153 |
| 527 | 3300026041 | Ga0207639_10008663 | Ga0207639_100086633 | 153 |
| 528 | 3300026067 | Ga0207678_10017343 | Ga0207678_100173437 | 153 |
| 529 | 3300026075 | Ga0207708_10082817 | Ga0207708_100828173 | 153 |
| 530 | 3300026075 | Ga0207708_10740723 | Ga0207708_107407232 | 153 |
| 531 | 3300026078 | Ga0207702_10229681 | Ga0207702_102296812 | 153 |
| 532 | 3300026088 | Ga0207641_10021368 | Ga0207641_100213683 | 153 |
| 533 | 3300026088 | Ga0207641_10047015 | Ga0207641_100470158 | 153 |
| 534 | 3300026088 | Ga0207641_11582747 | Ga0207641_115827472 | 153 |
| 535 | 3300026089 | Ga0207648_10004593 | Ga0207648_100045936 | 153 |
| 536 | 3300026095 | Ga0207676_10574828 | Ga0207676_105748281 | 153 |
| 537 | 3300026095 | Ga0207676_11344747 | Ga0207676_113447471 | 153 |
| 538 | 3300026116 | Ga0207674_10052832 | Ga0207674_100528325 | 153 |
| 539 | 3300026116 | Ga0207674_10081965 | Ga0207674_100819652 | 153 |
| 540 | 3300026116 | Ga0207674_10094452 | Ga0207674_100944525 | 153 |
| 541 | 3300026116 | Ga0207674_10128744 | Ga0207674_101287443 | 153 |
| 542 | 3300026118 | Ga0207675_100001315 | Ga0207675_10000131523 | 153 |
| 543 | 3300026118 | Ga0207675_100170388 | Ga0207675_1001703882 | 153 |
| 544 | 3300026118 | Ga0207675_100667563 | Ga0207675_1006675632 | 153 |
| 545 | 3300026121 | Ga0207683_10024431 | Ga0207683_100244315 | 153 |
| 546 | 3300026121 | Ga0207683_10078454 | Ga0207683_100784542 | 153 |
| 547 | 3300026121 | Ga0207683_10095227 | Ga0207683_100952274 | 153 |
| 548 | 3300026142 | Ga0207698_10280834 | Ga0207698_102808342 | 153 |
| 549 | 3300027866 | Ga0209813_10054981 | Ga0209813_100549812 | 153 |
| 550 | 3300028379 | Ga0268266_10000676 | Ga0268266_1000067642 | 153 |
| 551 | 3300028379 | Ga0268266_10010435 | Ga0268266_100104356 | 153 |
| 552 | 3300028379 | Ga0268266_10054459 | Ga0268266_100544594 | 153 |
| 553 | 3300028379 | Ga0268266_10136022 | Ga0268266_101360222 | 153 |
| 554 | 3300028379 | Ga0268266_10215399 | Ga0268266_102153993 | 153 |
| 555 | 3300028380 | Ga0268265_10002175 | Ga0268265_1000217516 | 153 |
| 556 | 3300028380 | Ga0268265_10024790 | Ga0268265_100247903 | 153 |
| 557 | 3300028380 | Ga0268265_10276364 | Ga0268265_102763642 | 153 |
| 558 | 3300028381 | Ga0268264_10000058 | Ga0268264_10000058261 | 153 |
| 559 | 3300028381 | Ga0268264_10000060 | Ga0268264_10000060255 | 153 |
| 560 | 3300028381 | Ga0268264_10072503 | Ga0268264_100725034 | 153 |
| 561 | 3300028786 | Ga0307517_10243806 | Ga0307517_102438062 | 153 |
| 562 | 3300031242 | Ga0265329_10016878 | Ga0265329_100168786 | 153 |
| 563 | 3300031247 | Ga0265340_10018857 | Ga0265340_100188573 | 153 |
| 564 | 3300031250 | Ga0265331_10018523 | Ga0265331_100185232 | 153 |
| 565 | 3300031456 | Ga0307513_10029913 | Ga0307513_100299136 | 153 |
| 566 | 3300031456 | Ga0307513_10034926 | Ga0307513_100349263 | 153 |
| 567 | 3300031595 | Ga0265313_10003018 | Ga0265313_1000301812 | 153 |
| 568 | 3300031711 | Ga0265314_10614199 | Ga0265314_106141991 | 153 |
| 569 | 3300031712 | Ga0265342_10012225 | Ga0265342_100122254 | 153 |
| 570 | 3300031730 | Ga0307516_10084087 | Ga0307516_100840872 | 153 |
| 571 | 3300031730 | Ga0307516_10094375 | Ga0307516_100943752 | 153 |
| 572 | 3300031911 | Ga0307412_10004387 | Ga0307412_100043872 | 153 |
| 573 | 3300031995 | Ga0307409_101962692 | Ga0307409_1019626921 | 153 |
| 574 | 3300033180 | Ga0307510_10000006 | Ga0307510_10000006236 | 153 |
| 575 | 3300033180 | Ga0307510_10045389 | Ga0307510_100453895 | 153 |
| 576 | 3300035113 | Ga0373936_0013587 | Ga0373936_0013587_989_1450 | 153 |
| 577 | 3300035113 | Ga0373936_0263960 | Ga0373936_0263960_59_520 | 153 |
| 578 | 3300035114 | Ga0373939_0108628 | Ga0373939_0108628_317_778 | 153 |
| 579 | 3300035170 | Ga0373943_0564476 | Ga0373943_0564476_56_517 | 153 |
| 580 | 3300035172 | Ga0373955_0242971 | Ga0373955_0242971_570_1031 | 153 |
| 581 | 3300035695 | Ga0373927_0583788 | Ga0373927_0583788_71_532 | 153 |
| 582 | 3300037312 | Ga0395899_0000016 | Ga0395899_0000016_62882_63343 | 153 |
| 583 | 3300037312 | Ga0395899_0118364 | Ga0395899_0118364_877_1338 | 153 |
| 584 | 3300037418 | Ga0395900_0009659 | Ga0395900_0009659_2053_2514 | 153 |
| 585 | 3300037418 | Ga0395900_0207890 | Ga0395900_0207890_1211_1672 | 153 |
| 586 | 3300037418 | Ga0395900_0472200 | Ga0395900_0472200_649_1110 | 153 |
| 587 | 3300037466 | Ga0395898_0265652 | Ga0395898_0265652_490_951 | 153 |
| 588 | 3300037466 | Ga0395898_0303336 | Ga0395898_0303336_633_1094 | 153 |
| 589 | 3300037471 | Ga0395905_0000069 | Ga0395905_0000069_37481_37987 | 153 |
| 590 | 3300037471 | Ga0395905_0132645 | Ga0395905_0132645_888_1349 | 153 |
| 591 | 3300037471 | Ga0395905_0337074 | Ga0395905_0337074_914_1375 | 153 |
| 592 | 3300037471 | Ga0395905_0477196 | Ga0395905_0477196_333_794 | 153 |
| 593 | 3300038443 | Ga0395901_0209533 | Ga0395901_0209533_366_827 | 153 |
| 594 | 3300038443 | Ga0395901_0262273 | Ga0395901_0262273_996_1457 | 153 |
| 595 | 3300039437 | Ga0436365_1372975 | Ga0436365_1372975_1651_2112 | 153 |
| 596 | 3300039447 | Ga0436361_0664527 | Ga0436361_0664527_966_1427 | 153 |
| 597 | 3300039450 | Ga0436363_1145957 | Ga0436363_1145957_798_1259 | 153 |
| 598 | 3300042439 | Ga0439464_0150334 | Ga0439464_0150334_196_657 | 153 |
| 599 | 3300045051 | Ga0451576_0054973 | Ga0451576_0054973_699_1160 | 153 |
| 600 | 3300045836 | Ga0466958_0032020 | Ga0466958_0032020_2092_2553 | 153 |
| 601 | 3300046455 | Ga0495603_0102725 | Ga0495603_0102725_20_616 | 153 |
| 602 | 3300046460 | Ga0495638_0062154 | Ga0495638_0062154_1449_1910 | 153 |
| 603 | 3300046460 | Ga0495638_0071417 | Ga0495638_0071417_1631_2098 | 153 |
| 604 | 3300046474 | Ga0495605_0010891 | Ga0495605_0010891_3500_3967 | 153 |
| 605 | 3300046491 | Ga0495584_0066387 | Ga0495584_0066387_665_1132 | 153 |
| 606 | 3300046492 | Ga0495585_0011902 | Ga0495585_0011902_3807_4274 | 153 |
| 607 | 3300046500 | Ga0495596_0079222 | Ga0495596_0079222_126_593 | 153 |
| 608 | 3300046501 | Ga0495607_0089028 | Ga0495607_0089028_716_1183 | 153 |
| 609 | 3300046506 | Ga0495583_0044568 | Ga0495583_0044568_475_942 | 153 |
| 610 | 3300046507 | Ga0495606_0065099 | Ga0495606_0065099_1747_2214 | 153 |
| 611 | 3300046513 | Ga0495616_0104150 | Ga0495616_0104150_720_1187 | 153 |
| 612 | 3300046518 | Ga0495631_0029015 | Ga0495631_0029015_255_722 | 153 |
| 613 | 3300046519 | Ga0495632_0008560 | Ga0495632_0008560_3775_4242 | 153 |
| 614 | 3300046519 | Ga0495632_0096025 | Ga0495632_0096025_292_780 | 153 |
| 615 | 3300046522 | Ga0495643_0039959 | Ga0495643_0039959_842_1309 | 153 |
| 616 | 3300046523 | Ga0495644_0019674 | Ga0495644_0019674_905_1372 | 153 |
| 617 | 3300046528 | Ga0495642_0007283 | Ga0495642_0007283_3245_3706 | 153 |
| 618 | 3300046528 | Ga0495642_0023925 | Ga0495642_0023925_1589_2056 | 153 |
| 619 | 3300046538 | Ga0495609_0072871 | Ga0495609_0072871_567_1034 | 153 |
| 620 | 3300046542 | Ga0495597_0024058 | Ga0495597_0024058_941_1408 | 153 |
| 621 | 3300046616 | Ga0495668_0050954 | Ga0495668_0050954_1707_2171 | 153 |
| 622 | 3300046616 | Ga0495668_0183060 | Ga0495668_0183060_337_804 | 153 |
| 623 | 3300046648 | Ga0495611_0002895 | Ga0495611_0002895_841_1308 | 153 |
| 624 | 3300046660 | Ga0495625_0113821 | Ga0495625_0113821_555_1022 | 153 |
| 625 | 3300046794 | Ga0495589_0016469 | Ga0495589_0016469_153_620 | 153 |
| 626 | 3300046810 | Ga0495660_0340446 | Ga0495660_0340446_145_612 | 153 |
| 627 | 3300047318 | Ga0495636_0374405 | Ga0495636_0374405_116_577 | 153 |
| 628 | 3300047323 | Ga0495683_0006861 | Ga0495683_0006861_1818_2285 | 153 |
| 629 | 3300047445 | Ga0495677_0002863 | Ga0495677_0002863_1487_1954 | 153 |
| 630 | 3300047445 | Ga0495677_0174596 | Ga0495677_0174596_99_560 | 153 |
| 631 | 3300047447 | Ga0495685_002965 | Ga0495685_002965_4420_4887 | 153 |
| 632 | 3300047470 | Ga0495681_0054613 | Ga0495681_0054613_1013_1480 | 153 |
| 633 | 3300048903 | Ga0496100_0015643 | Ga0496100_0015643_2525_3064 | 153 |
| 634 | 3300048903 | Ga0496100_0045550 | Ga0496100_0045550_35_523 | 153 |
| 635 | 3300048903 | Ga0496100_0361909 | Ga0496100_0361909_467_928 | 153 |
| 636 | 3300048904 | Ga0496101_0056655 | Ga0496101_0056655_2301_2762 | 153 |
| 637 | 3300048905 | Ga0496102_0273956 | Ga0496102_0273956_572_1036 | 153 |
| 638 | 3300048908 | Ga0496105_1079276 | Ga0496105_1079276_86_547 | 153 |
| 639 | 3300048909 | Ga0496106_0506613 | Ga0496106_0506613_35_496 | 153 |
| 640 | 3300048911 | Ga0496108_0623182 | Ga0496108_0623182_126_587 | 153 |
| 641 | 3300048912 | Ga0496109_0109654 | Ga0496109_0109654_2036_2497 | 153 |
| 642 | 3300048915 | Ga0496112_0222889 | Ga0496112_0222889_1114_1575 | 153 |
| 643 | 3300048917 | Ga0496114_0559175 | Ga0496114_0559175_389_850 | 153 |
| 644 | 3300048917 | Ga0496114_0641134 | Ga0496114_0641134_265_726 | 153 |
| 645 | 3300048919 | Ga0496116_0012102 | Ga0496116_0012102_791_1252 | 153 |
| 646 | 3300048920 | Ga0496117_0004884 | Ga0496117_0004884_12277_12738 | 153 |
| 647 | 3300048920 | Ga0496117_0074458 | Ga0496117_0074458_803_1264 | 153 |
| 648 | 3300048920 | Ga0496117_0187571 | Ga0496117_0187571_70_564 | 153 |
| 649 | 3300048921 | Ga0496118_0001630 | Ga0496118_0001630_27147_27608 | 153 |
| 650 | 3300048921 | Ga0496118_0016606 | Ga0496118_0016606_5575_6036 | 153 |
| 651 | 3300048922 | Ga0496119_0010064 | Ga0496119_0010064_1632_2096 | 153 |
| 652 | 3300048922 | Ga0496119_0054595 | Ga0496119_0054595_1047_1511 | 153 |
| 653 | 3300048922 | Ga0496119_0107977 | Ga0496119_0107977_260_799 | 153 |
| 654 | 3300048923 | Ga0496120_0000412 | Ga0496120_0000412_1814_2278 | 153 |
| 655 | 3300048923 | Ga0496120_0033194 | Ga0496120_0033194_2385_2924 | 153 |
| 656 | 3300048924 | Ga0496121_0017037 | Ga0496121_0017037_1514_1975 | 153 |
| 657 | 3300048924 | Ga0496121_0150403 | Ga0496121_0150403_848_1336 | 153 |
| 658 | 3300048924 | Ga0496121_0245394 | Ga0496121_0245394_691_1152 | 153 |
| 659 | 3300048925 | Ga0496122_0010791 | Ga0496122_0010791_1568_2029 | 153 |
| 660 | 3300048926 | Ga0496123_0014951 | Ga0496123_0014951_4465_4926 | 153 |
| 661 | 3300048927 | Ga0496124_0004910 | Ga0496124_0004910_12740_13201 | 153 |
| 662 | 3300048928 | Ga0496125_0001826 | Ga0496125_0001826_9010_9498 | 153 |
| 663 | 3300048929 | Ga0496126_0747691 | Ga0496126_0747691_11_499 | 153 |
| 664 | 3300048929 | Ga0496126_0839104 | Ga0496126_0839104_111_575 | 153 |
| 665 | 3300049460 | Ga0495682_0005529 | Ga0495682_0005529_2546_3013 | 153 |
| 666 | 3300049575 | Ga0501039_0875531 | Ga0501039_0875531_140_601 | 153 |
| 667 | 3300049587 | Ga0501071_0488857 | Ga0501071_0488857_410_871 | 153 |
| 668 | 3300049588 | Ga0501072_0725121 | Ga0501072_0725121_204_665 | 153 |
| 669 | 3300049589 | Ga0501073_0352755 | Ga0501073_0352755_94_555 | 153 |
| 670 | 3300049589 | Ga0501073_0770026 | Ga0501073_0770026_156_626 | 153 |
| 671 | 3300049592 | Ga0501076_0174180 | Ga0501076_0174180_1201_1671 | 153 |
| 672 | 3300049593 | Ga0501077_0240515 | Ga0501077_0240515_91_561 | 153 |
| 673 | 3300049742 | Ga0501080_0971015 | Ga0501080_0971015_224_685 | 153 |
| 674 | 3300049824 | Ga0501045_0121553 | Ga0501045_0121553_403_873 | 153 |
| 675 | 3300050492 | nmdc:mga0yw44_23265_c1 | nmdc:mga0yw44_23265_c1_350_814 | 153 |
| 676 | 3300050494 | nmdc:mga06z11_17996_c1 | nmdc:mga06z11_17996_c1_1823_2284 | 153 |
| 677 | 3300050495 | nmdc:mga04h51_47616_c1 | nmdc:mga04h51_47616_c1_259_720 | 153 |
| 678 | 3300050509 | nmdc:mga0qj67_114907_c1 | nmdc:mga0qj67_114907_c1_933_1394 | 153 |
| 679 | 3300050509 | nmdc:mga0qj67_217374_c1 | nmdc:mga0qj67_217374_c1_858_1319 | 153 |
| 680 | 3300050509 | nmdc:mga0qj67_256711_c1 | nmdc:mga0qj67_256711_c1_334_795 | 153 |
| 681 | 3300050510 | nmdc:mga06r32_42563_c1 | nmdc:mga06r32_42563_c1_2699_3160 | 153 |
| 682 | 3300050511 | nmdc:mga08y16_556831_c1 | nmdc:mga08y16_556831_c1_413_874 | 153 |
| 683 | 3300050512 | nmdc:mga0n895_763360_c1 | nmdc:mga0n895_763360_c1_137_598 | 153 |
| 684 | 3300050515 | nmdc:mga0a205_1169474_c1 | nmdc:mga0a205_1169474_c1_12_473 | 153 |
| 685 | 3300053148 | Ga0500590_126666 | Ga0500590_126666_67_528 | 153 |
| 686 | 3300053153 | Ga0500616_0048408 | Ga0500616_0048408_1481_1942 | 153 |
| 687 | 3300053158 | Ga0500627_0345838 | Ga0500627_0345838_82_543 | 153 |
| 688 | 3300055283 | Ga0500661_020008 | Ga0500661_020008_78_539 | 153 |
| 689 | 3300060353 | Ga0501082_0544786 | Ga0501082_0544786_110_571 | 153 |
| 690 | 3300061734 | Ga0530510_0332034 | Ga0530510_0332034_389_859 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i7d-assembly1.cif.gz_A | crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution | 0.9328 | 2 | 152 |
| 3h8u-assembly1.cif.gz_B | crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution | 0.9276 | 41 | 119 |
| 3i7d-assembly1.cif.gz_A | crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution | 0.9154 | 2 | 152 |
| 5wsf-assembly1.cif.gz_D | crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii | 0.8996 | 1 | 120 |
| 2phd-assembly1.cif.gz_B | crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans | 0.8982 | 41 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i7dB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9159 | 2 | 152 | 2.60.120.10 |
| 3h8uB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9048 | 41 | 119 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9005 | 41 | 120 | 2.60.120.10 |
| 4i4aA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8957 | 40 | 121 | 2.60.120.10 |
| 3nvcA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8941 | 41 | 119 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A0D1V7-F1-model_v4 | Transcriptional regulator | 0.9976 | 1 | 150 |
GO:0046872
|
| AF-A0A1I1CL46-F1-model_v4 | Uncharacterized conserved protein, cupin superfamily | 0.9975 | 1 | 150 |
GO:0046872
|
| AF-A0A3S3F3Z2-F1-model_v4 | Cupin domain-containing protein | 0.997 | 1 | 150 |
GO:0046872
|
| AF-A0A434VWL6-F1-model_v4 | Cupin domain-containing protein | 0.9968 | 18 | 153 |
GO:0046872
|
| AF-A0A1C3VQV0-F1-model_v4 | Uncharacterized conserved protein, cupin superfamily | 0.9967 | 1 | 150 |
GO:0046872
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar