F475465
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 241 | 690 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300035172|Ga0373955_0144301|Ga0373955_0144301_497_1234 |
| Length | 245 |
| Sequence | MTKVSSARHLQVIGRLCRFTREVGVRILVIEDEARIQAFLARGLEAEGYTVVAAGDGREGLDLATRTRWDLVVLDLLLPGLNGLQVLRELQRTKPELPVVILSARGDVQTKLQGFELGATDYVAKPFSLDELLARIRVRLRGAPTFGDEHVLRGGNVVLDVARRQAGVGERTADLSDREFRLLHHLLVHAGEVLSRERLLAEVWGYDFDPGSNVVDVCVRRLRQKLGPEAPIETVRNAGYRLATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 78 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 79 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 80 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 81 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 82 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 83 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 84 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 86 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 87 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 91 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 92 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 93 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 94 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 95 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 97 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 104 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 105 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 106 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 107 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 108 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 109 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 110 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 111 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 130 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 131 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 132 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 133 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 134 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 135 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 136 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 137 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 138 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 139 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 140 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 141 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 142 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 143 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 241 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.43 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.13 |
| Rhizosphere | 89.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10012569 | 3300005327 | Bacteria | 6790 |
| 2 | Ga0070658_10484514 | 3300005327 | Bacteria | 1067 |
| 3 | Ga0070683_100003106 | 3300005329 | Bacteria | 13377 |
| 4 | Ga0070683_100016847 | 3300005329 | Bacteria | 6447 |
| 5 | Ga0070683_100035125 | 3300005329 | Bacteria | 4582 |
| 6 | Ga0070680_100173474 | 3300005336 | Bacteria | 1815 |
| 7 | Ga0070682_100133301 | 3300005337 | Bacteria | 1684 |
| 8 | Ga0070682_100326510 | 3300005337 | Bacteria | 1135 |
| 9 | Ga0070660_100003251 | 3300005339 | Bacteria | 11151 |
| 10 | Ga0070661_100120135 | 3300005344 | Bacteria | 1968 |
| 11 | Ga0070667_100973408 | 3300005367 | Bacteria | 791 |
| 12 | Ga0070709_10013958 | 3300005434 | Bacteria | 4531 |
| 13 | Ga0070709_10268812 | 3300005434 | Bacteria | 1235 |
| 14 | Ga0070709_10473300 | 3300005434 | Unclassified | 947 |
| 15 | Ga0070714_100010935 | 3300005435 | Bacteria | 7187 |
| 16 | Ga0070714_100021402 | 3300005435 | Bacteria | 5292 |
| 17 | Ga0070714_100027718 | 3300005435 | Bacteria | 4693 |
| 18 | Ga0070714_100053854 | 3300005435 | Bacteria | 3436 |
| 19 | Ga0070714_100072759 | 3300005435 | Bacteria | 2976 |
| 20 | Ga0070714_100088928 | 3300005435 | Bacteria | 2703 |
| 21 | Ga0070714_100184468 | 3300005435 | Bacteria | 1900 |
| 22 | Ga0070714_100458373 | 3300005435 | Bacteria | 1212 |
| 23 | Ga0070714_100722627 | 3300005435 | Bacteria | 962 |
| 24 | Ga0070714_100772534 | 3300005435 | Bacteria | 929 |
| 25 | Ga0070714_100821763 | 3300005435 | Bacteria | 900 |
| 26 | Ga0070714_100898700 | 3300005435 | Bacteria | 860 |
| 27 | Ga0070714_101105522 | 3300005435 | Bacteria | 772 |
| 28 | Ga0070713_100004631 | 3300005436 | Bacteria | 9274 |
| 29 | Ga0070713_100006886 | 3300005436 | Bacteria | 7928 |
| 30 | Ga0070713_100007202 | 3300005436 | Bacteria | 7785 |
| 31 | Ga0070713_100204957 | 3300005436 | Bacteria | 1783 |
| 32 | Ga0070710_10007692 | 3300005437 | Bacteria | 5225 |
| 33 | Ga0070710_10014195 | 3300005437 | Bacteria | 4005 |
| 34 | Ga0070710_10215953 | 3300005437 | Bacteria | 1218 |
| 35 | Ga0070710_10304922 | 3300005437 | Unclassified | 1040 |
| 36 | Ga0070711_100019659 | 3300005439 | Bacteria | 4336 |
| 37 | Ga0070711_100025041 | 3300005439 | Bacteria | 3900 |
| 38 | Ga0070705_100477813 | 3300005440 | Bacteria | 941 |
| 39 | Ga0070694_100332545 | 3300005444 | Bacteria | 1172 |
| 40 | Ga0070678_100249752 | 3300005456 | Bacteria | 1487 |
| 41 | Ga0070681_10027474 | 3300005458 | Bacteria | 5721 |
| 42 | Ga0070681_10051432 | 3300005458 | Bacteria | 4109 |
| 43 | Ga0070681_10213480 | 3300005458 | Bacteria | 1846 |
| 44 | Ga0070681_10225098 | 3300005458 | Bacteria | 1790 |
| 45 | Ga0070706_100066553 | 3300005467 | Bacteria | 3332 |
| 46 | Ga0070707_100000445 | 3300005468 | Bacteria | 40989 |
| 47 | Ga0070698_100002087 | 3300005471 | Bacteria | 22185 |
| 48 | Ga0070698_100072738 | 3300005471 | Bacteria | 3445 |
| 49 | Ga0070698_100401417 | 3300005471 | Bacteria | 1304 |
| 50 | Ga0070679_100027534 | 3300005530 | Bacteria | 5596 |
| 51 | Ga0070679_100116390 | 3300005530 | Bacteria | 2658 |
| 52 | Ga0070679_100623925 | 3300005530 | Bacteria | 1021 |
| 53 | Ga0070684_100008226 | 3300005535 | Bacteria | 8151 |
| 54 | Ga0070684_100026806 | 3300005535 | Bacteria | 4858 |
| 55 | Ga0070684_100404476 | 3300005535 | Bacteria | 1259 |
| 56 | Ga0070697_100123212 | 3300005536 | Bacteria | 2169 |
| 57 | Ga0070697_100339058 | 3300005536 | Bacteria | 1297 |
| 58 | Ga0070695_100000042 | 3300005545 | Bacteria | 48840 |
| 59 | Ga0070696_100196034 | 3300005546 | Bacteria | 1505 |
| 60 | Ga0070696_100208902 | 3300005546 | Bacteria | 1461 |
| 61 | Ga0070693_100211223 | 3300005547 | Bacteria | 1266 |
| 62 | Ga0070704_100418484 | 3300005549 | Unclassified | 1147 |
| 63 | Ga0068855_100015736 | 3300005563 | Bacteria | 9099 |
| 64 | Ga0068855_100046101 | 3300005563 | Bacteria | 5154 |
| 65 | Ga0068855_100557392 | 3300005563 | Bacteria | 1240 |
| 66 | Ga0070664_100085262 | 3300005564 | Bacteria | 2728 |
| 67 | Ga0070664_100527386 | 3300005564 | Bacteria | 1091 |
| 68 | Ga0068856_100009230 | 3300005614 | Bacteria | 9593 |
| 69 | Ga0068856_100101919 | 3300005614 | Bacteria | 2864 |
| 70 | Ga0068856_100297647 | 3300005614 | Bacteria | 1631 |
| 71 | Ga0068852_100185251 | 3300005616 | Bacteria | 1960 |
| 72 | Ga0081455_10016958 | 3300005937 | Bacteria | 7001 |
| 73 | Ga0081455_10153197 | 3300005937 | Bacteria | 1775 |
| 74 | Ga0070717_10001383 | 3300006028 | Bacteria | 16698 |
| 75 | Ga0070717_10016886 | 3300006028 | Bacteria | 5667 |
| 76 | Ga0070717_10035821 | 3300006028 | Bacteria | 4021 |
| 77 | Ga0070717_10191977 | 3300006028 | Bacteria | 1785 |
| 78 | Ga0070715_10000206 | 3300006163 | Bacteria | 13864 |
| 79 | Ga0070716_100001775 | 3300006173 | Bacteria | 9763 |
| 80 | Ga0070716_100199420 | 3300006173 | Bacteria | 1329 |
| 81 | Ga0070712_100008799 | 3300006175 | Bacteria | 6357 |
| 82 | Ga0105240_10018359 | 3300009093 | Bacteria | 9395 |
| 83 | Ga0105240_10085401 | 3300009093 | Bacteria | 3867 |
| 84 | Ga0105240_10199100 | 3300009093 | Bacteria | 2349 |
| 85 | Ga0105240_10364300 | 3300009093 | Bacteria | 1636 |
| 86 | Ga0105245_10031009 | 3300009098 | Bacteria | 4729 |
| 87 | Ga0105242_10205667 | 3300009176 | Bacteria | 1751 |
| 88 | Ga0105248_10093263 | 3300009177 | Bacteria | 3391 |
| 89 | Ga0105237_10006254 | 3300009545 | Bacteria | 13254 |
| 90 | Ga0105237_10056066 | 3300009545 | Bacteria | 3945 |
| 91 | Ga0105238_10018870 | 3300009551 | Bacteria | 7021 |
| 92 | Ga0157370_10210891 | 3300013104 | Bacteria | 1800 |
| 93 | Ga0157369_10003872 | 3300013105 | Bacteria | 17775 |
| 94 | Ga0157369_10027514 | 3300013105 | Bacteria | 6302 |
| 95 | Ga0157369_10183763 | 3300013105 | Bacteria | 2199 |
| 96 | Ga0157369_10657369 | 3300013105 | Bacteria | 1081 |
| 97 | Ga0157374_10070638 | 3300013296 | Bacteria | 3291 |
| 98 | Ga0157372_10034070 | 3300013307 | Bacteria | 5596 |
| 99 | Ga0157375_10007589 | 3300013308 | Bacteria | 9488 |
| 100 | Ga0157379_10298862 | 3300014968 | Bacteria | 1467 |
| 101 | Ga0157376_10093642 | 3300014969 | Bacteria | 2609 |
| 102 | Ga0157376_11169032 | 3300014969 | Bacteria | 797 |
| 103 | Ga0206353_10081752 | 3300020082 | Bacteria | 1858 |
| 104 | Ga0206353_11535591 | 3300020082 | Bacteria | 772 |
| 105 | Ga0206353_11894553 | 3300020082 | Bacteria | 2933 |
| 106 | Ga0207692_10010200 | 3300025898 | Bacteria | 3950 |
| 107 | Ga0207685_10000911 | 3300025905 | Bacteria | 5637 |
| 108 | Ga0207685_10089670 | 3300025905 | Bacteria | 1291 |
| 109 | Ga0207699_10007017 | 3300025906 | Bacteria | 5487 |
| 110 | Ga0207699_10108698 | 3300025906 | Bacteria | 1773 |
| 111 | Ga0207699_10413201 | 3300025906 | Unclassified | 963 |
| 112 | Ga0207705_10028060 | 3300025909 | Bacteria | 4013 |
| 113 | Ga0207705_10159631 | 3300025909 | Bacteria | 1693 |
| 114 | Ga0207684_10274541 | 3300025910 | Bacteria | 1454 |
| 115 | Ga0207707_10016175 | 3300025912 | Bacteria | 6509 |
| 116 | Ga0207707_10641990 | 3300025912 | Bacteria | 895 |
| 117 | Ga0207695_10071188 | 3300025913 | Bacteria | 3552 |
| 118 | Ga0207695_10087217 | 3300025913 | Bacteria | 3144 |
| 119 | Ga0207671_10048740 | 3300025914 | Bacteria | 3135 |
| 120 | Ga0207693_10006828 | 3300025915 | Bacteria | 9428 |
| 121 | Ga0207693_10012766 | 3300025915 | Bacteria | 6779 |
| 122 | Ga0207693_10188236 | 3300025915 | Bacteria | 1625 |
| 123 | Ga0207663_10013810 | 3300025916 | Bacteria | 4401 |
| 124 | Ga0207663_10059772 | 3300025916 | Bacteria | 2413 |
| 125 | Ga0207660_10272134 | 3300025917 | Bacteria | 1342 |
| 126 | Ga0207660_10515235 | 3300025917 | Bacteria | 971 |
| 127 | Ga0207657_10019430 | 3300025919 | Bacteria | 6452 |
| 128 | Ga0207657_10219805 | 3300025919 | Bacteria | 1522 |
| 129 | Ga0207652_10040281 | 3300025921 | Bacteria | 3967 |
| 130 | Ga0207652_10180165 | 3300025921 | Bacteria | 1899 |
| 131 | Ga0207652_10823889 | 3300025921 | Bacteria | 823 |
| 132 | Ga0207646_10001908 | 3300025922 | Bacteria | 25106 |
| 133 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 134 | Ga0207700_10087748 | 3300025928 | Bacteria | 2447 |
| 135 | Ga0207700_10100098 | 3300025928 | Bacteria | 2309 |
| 136 | Ga0207700_10571359 | 3300025928 | Bacteria | 1005 |
| 137 | Ga0207664_10004541 | 3300025929 | Bacteria | 9408 |
| 138 | Ga0207664_10025574 | 3300025929 | Bacteria | 4451 |
| 139 | Ga0207664_10029464 | 3300025929 | Bacteria | 4181 |
| 140 | Ga0207664_10106192 | 3300025929 | Bacteria | 2328 |
| 141 | Ga0207664_10157991 | 3300025929 | Bacteria | 1932 |
| 142 | Ga0207664_10325383 | 3300025929 | Bacteria | 1357 |
| 143 | Ga0207664_10545137 | 3300025929 | Bacteria | 1040 |
| 144 | Ga0207664_10575730 | 3300025929 | Bacteria | 1011 |
| 145 | Ga0207665_10001018 | 3300025939 | Bacteria | 18916 |
| 146 | Ga0207665_10107182 | 3300025939 | Bacteria | 1959 |
| 147 | Ga0207665_10108622 | 3300025939 | Bacteria | 1946 |
| 148 | Ga0207665_10518071 | 3300025939 | Bacteria | 923 |
| 149 | Ga0207711_10357942 | 3300025941 | Bacteria | 1352 |
| 150 | Ga0207661_10021891 | 3300025944 | Bacteria | 4799 |
| 151 | Ga0207661_10172481 | 3300025944 | Bacteria | 1883 |
| 152 | Ga0207679_10098434 | 3300025945 | Bacteria | 2281 |
| 153 | Ga0207679_10209453 | 3300025945 | Bacteria | 1634 |
| 154 | Ga0207667_10509419 | 3300025949 | Bacteria | 1220 |
| 155 | Ga0207668_10974512 | 3300025972 | Bacteria | 757 |
| 156 | Ga0207678_10348179 | 3300026067 | Bacteria | 1278 |
| 157 | Ga0207702_10028533 | 3300026078 | Bacteria | 4639 |
| 158 | Ga0207702_10076814 | 3300026078 | Bacteria | 2887 |
| 159 | Ga0207702_10306057 | 3300026078 | Bacteria | 1509 |
| 160 | Ga0207676_10083544 | 3300026095 | Bacteria | 2601 |
| 161 | Ga0207674_10047966 | 3300026116 | Bacteria | 4375 |
| 162 | Ga0207674_10408791 | 3300026116 | Bacteria | 1312 |
| 163 | Ga0268266_10494191 | 3300028379 | Bacteria | 1168 |
| 164 | Ga0265326_10017432 | 3300028558 | Bacteria | 2071 |
| 165 | Ga0265319_1001496 | 3300028563 | Bacteria | 13916 |
| 166 | Ga0265319_1005383 | 3300028563 | Bacteria | 6131 |
| 167 | Ga0265319_1030077 | 3300028563 | Bacteria | 1902 |
| 168 | Ga0265319_1050291 | 3300028563 | Bacteria | 1377 |
| 169 | Ga0265334_10000492 | 3300028573 | Bacteria | 20354 |
| 170 | Ga0265334_10053732 | 3300028573 | Bacteria | 1538 |
| 171 | Ga0265334_10066750 | 3300028573 | Bacteria | 1345 |
| 172 | Ga0265334_10076889 | 3300028573 | Bacteria | 1235 |
| 173 | Ga0265318_10000429 | 3300028577 | Bacteria | 31981 |
| 174 | Ga0265318_10009230 | 3300028577 | Bacteria | 4350 |
| 175 | Ga0265318_10039303 | 3300028577 | Bacteria | 1806 |
| 176 | Ga0265318_10142557 | 3300028577 | Bacteria | 879 |
| 177 | Ga0265322_10003192 | 3300028654 | Bacteria | 4979 |
| 178 | Ga0265336_10013473 | 3300028666 | Bacteria | 2726 |
| 179 | Ga0265336_10102088 | 3300028666 | Bacteria | 855 |
| 180 | Ga0307515_10000947 | 3300028794 | Bacteria | 66394 |
| 181 | Ga0265338_10002292 | 3300028800 | Bacteria | 29139 |
| 182 | Ga0265338_10003836 | 3300028800 | Bacteria | 20883 |
| 183 | Ga0265338_10010581 | 3300028800 | Bacteria | 10789 |
| 184 | Ga0265338_10010750 | 3300028800 | Bacteria | 10680 |
| 185 | Ga0265338_10140300 | 3300028800 | Bacteria | 1894 |
| 186 | Ga0265338_10174604 | 3300028800 | Unclassified | 1644 |
| 187 | Ga0265338_10348840 | 3300028800 | Bacteria | 1065 |
| 188 | Ga0265324_10035420 | 3300029957 | Bacteria | 1738 |
| 189 | Ga0307511_10045453 | 3300030521 | Bacteria | 3628 |
| 190 | Ga0265330_10000760 | 3300031235 | Bacteria | 20237 |
| 191 | Ga0265332_10003620 | 3300031238 | Bacteria | 7404 |
| 192 | Ga0265332_10031014 | 3300031238 | Bacteria | 2333 |
| 193 | Ga0265328_10000357 | 3300031239 | Bacteria | 21493 |
| 194 | Ga0265320_10005108 | 3300031240 | Bacteria | 8478 |
| 195 | Ga0265320_10010382 | 3300031240 | Bacteria | 5551 |
| 196 | Ga0265325_10001666 | 3300031241 | Bacteria | 15416 |
| 197 | Ga0265325_10027491 | 3300031241 | Bacteria | 3075 |
| 198 | Ga0265329_10003650 | 3300031242 | Bacteria | 6642 |
| 199 | Ga0265329_10051628 | 3300031242 | Bacteria | 1309 |
| 200 | Ga0265340_10011415 | 3300031247 | Bacteria | 4719 |
| 201 | Ga0265340_10040042 | 3300031247 | Unclassified | 2309 |
| 202 | Ga0265340_10104865 | 3300031247 | Bacteria | 1311 |
| 203 | Ga0265339_10012774 | 3300031249 | Bacteria | 5106 |
| 204 | Ga0265339_10014132 | 3300031249 | Bacteria | 4818 |
| 205 | Ga0265339_10026012 | 3300031249 | Bacteria | 3354 |
| 206 | Ga0265339_10073395 | 3300031249 | Bacteria | 1819 |
| 207 | Ga0265331_10015897 | 3300031250 | Bacteria | 3961 |
| 208 | Ga0265331_10079683 | 3300031250 | Bacteria | 1523 |
| 209 | Ga0265331_10120844 | 3300031250 | Bacteria | 1198 |
| 210 | Ga0265327_10005032 | 3300031251 | Bacteria | 11308 |
| 211 | Ga0265316_10023216 | 3300031344 | Bacteria | 5215 |
| 212 | Ga0265316_10026314 | 3300031344 | Bacteria | 4841 |
| 213 | Ga0265316_10027658 | 3300031344 | Bacteria | 4690 |
| 214 | Ga0265316_10169929 | 3300031344 | Bacteria | 1627 |
| 215 | Ga0265313_10002251 | 3300031595 | Bacteria | 16966 |
| 216 | Ga0265313_10055594 | 3300031595 | Bacteria | 1874 |
| 217 | Ga0265314_10011890 | 3300031711 | Bacteria | 7149 |
| 218 | Ga0265314_10017707 | 3300031711 | Bacteria | 5582 |
| 219 | Ga0265314_10047279 | 3300031711 | Bacteria | 3029 |
| 220 | Ga0265342_10003288 | 3300031712 | Bacteria | 13375 |
| 221 | Ga0265342_10011149 | 3300031712 | Bacteria | 6169 |
| 222 | Ga0265342_10032768 | 3300031712 | Bacteria | 3202 |
| 223 | Ga0265342_10121806 | 3300031712 | Bacteria | 1468 |
| 224 | Ga0307516_10006457 | 3300031730 | Bacteria | 13728 |
| 225 | Ga0307416_100205445 | 3300032002 | Bacteria | 1873 |
| 226 | Ga0307415_101188908 | 3300032126 | Bacteria | 718 |
| 227 | Ga0373926_0044449 | 3300035083 | Bacteria | 1591 |
| 228 | Ga0373934_0081066 | 3300035086 | Bacteria | 1304 |
| 229 | Ga0373951_0126699 | 3300035091 | Bacteria | 699 |
| 230 | Ga0373953_0089999 | 3300035117 | Bacteria | 1283 |
| 231 | Ga0373956_0016534 | 3300035119 | Bacteria | 3100 |
| 232 | Ga0373960_0061586 | 3300035121 | Bacteria | 1140 |
| 233 | Ga0373943_0008619 | 3300035170 | Bacteria | 4572 |
| 234 | Ga0373946_0013615 | 3300035171 | Bacteria | 3059 |
| 235 | Ga0373955_0097376 | 3300035172 | Bacteria | 1685 |
| 236 | Ga0373955_0144301 | 3300035172 | Bacteria | 1398 |
| 237 | Ga0373962_0144100 | 3300035242 | Bacteria | 776 |
| 238 | Ga0373931_0015316 | 3300035691 | Bacteria | 3759 |
| 239 | Ga0373933_0077820 | 3300035724 | Bacteria | 2028 |
| 240 | Ga0373933_0115994 | 3300035724 | Bacteria | 1674 |
| 241 | Ga0373933_0271731 | 3300035724 | Bacteria | 1094 |
| 242 | Ga0373947_0004256 | 3300035725 | Bacteria | 8398 |
| 243 | Ga0373937_0000308 | 3300036401 | Bacteria | 46115 |
| 244 | Ga0373937_0193882 | 3300036401 | Bacteria | 1909 |
| 245 | Ga0373925_0001399 | 3300037068 | Bacteria | 20978 |
| 246 | Ga0395899_0020630 | 3300037312 | Bacteria | 4995 |
| 247 | Ga0395899_0053674 | 3300037312 | Bacteria | 2983 |
| 248 | Ga0395899_0344519 | 3300037312 | Bacteria | 998 |
| 249 | Ga0395899_0348603 | 3300037312 | Bacteria | 991 |
| 250 | Ga0395900_0016514 | 3300037418 | Bacteria | 7530 |
| 251 | Ga0395900_0021603 | 3300037418 | Bacteria | 6579 |
| 252 | Ga0395900_0033120 | 3300037418 | Bacteria | 5318 |
| 253 | Ga0395900_0232418 | 3300037418 | Bacteria | 1854 |
| 254 | Ga0395900_0356731 | 3300037418 | Bacteria | 1434 |
| 255 | Ga0395898_0012929 | 3300037466 | Bacteria | 8611 |
| 256 | Ga0395898_0015373 | 3300037466 | Bacteria | 7848 |
| 257 | Ga0395898_0191993 | 3300037466 | Bacteria | 1951 |
| 258 | Ga0395898_0205818 | 3300037466 | Bacteria | 1878 |
| 259 | Ga0395898_0487976 | 3300037466 | Bacteria | 1172 |
| 260 | Ga0395905_0139687 | 3300037471 | Bacteria | 2279 |
| 261 | Ga0395901_0006362 | 3300038443 | Bacteria | 11967 |
| 262 | Ga0395901_0171908 | 3300038443 | Bacteria | 2273 |
| 263 | Ga0395901_0194519 | 3300038443 | Bacteria | 2127 |
| 264 | Ga0451793_1255881 | 3300041452 | Bacteria | 915 |
| 265 | Ga0451800_0303337 | 3300041459 | Bacteria | 1635 |
| 266 | Ga0451800_1012959 | 3300041459 | Bacteria | 1431 |
| 267 | Ga0451800_1023831 | 3300041459 | Bacteria | 1576 |
| 268 | Ga0451802_0172239 | 3300041460 | Bacteria | 3316 |
| 269 | Ga0451802_0814534 | 3300041460 | Bacteria | 1048 |
| 270 | Ga0451804_0658122 | 3300041463 | Bacteria | 2053 |
| 271 | Ga0451807_1714584 | 3300041486 | Bacteria | 1449 |
| 272 | Ga0451807_2357288 | 3300041486 | Bacteria | 3030 |
| 273 | Ga0451845_0119325 | 3300041501 | Bacteria | 2105 |
| 274 | Ga0451849_1417415 | 3300041505 | Bacteria | 1478 |
| 275 | Ga0451851_0655441 | 3300041507 | Bacteria | 2222 |
| 276 | Ga0451853_1443220 | 3300041512 | Bacteria | 2616 |
| 277 | Ga0451853_1678816 | 3300041512 | Bacteria | 3303 |
| 278 | Ga0451853_2071879 | 3300041512 | Bacteria | 8392 |
| 279 | Ga0451853_2743555 | 3300041512 | Bacteria | 2714 |
| 280 | Ga0451853_3617744 | 3300041512 | Bacteria | 2714 |
| 281 | Ga0466969_0002282 | 3300044656 | Bacteria | 10243 |
| 282 | Ga0466969_0031409 | 3300044656 | Bacteria | 2703 |
| 283 | Ga0466969_0090382 | 3300044656 | Bacteria | 1452 |
| 284 | Ga0466965_0047128 | 3300044683 | Bacteria | 2134 |
| 285 | Ga0466965_0105291 | 3300044683 | Bacteria | 1446 |
| 286 | Ga0466966_0008290 | 3300044684 | Bacteria | 6890 |
| 287 | Ga0466966_0018620 | 3300044684 | Bacteria | 4576 |
| 288 | Ga0466966_0023443 | 3300044684 | Bacteria | 4041 |
| 289 | Ga0466966_0034276 | 3300044684 | Bacteria | 3283 |
| 290 | Ga0466966_0072802 | 3300044684 | Bacteria | 2150 |
| 291 | Ga0466966_0142844 | 3300044684 | Bacteria | 1462 |
| 292 | Ga0466961_0006444 | 3300044693 | Bacteria | 7453 |
| 293 | Ga0466961_0031517 | 3300044693 | Bacteria | 3408 |
| 294 | Ga0466961_0032800 | 3300044693 | Bacteria | 3336 |
| 295 | Ga0466961_0039873 | 3300044693 | Bacteria | 3010 |
| 296 | Ga0466961_0047611 | 3300044693 | Bacteria | 2741 |
| 297 | Ga0466961_0048517 | 3300044693 | Bacteria | 2714 |
| 298 | Ga0466961_0109552 | 3300044693 | Bacteria | 1738 |
| 299 | Ga0466961_0112539 | 3300044693 | Bacteria | 1712 |
| 300 | Ga0466961_0124934 | 3300044693 | Bacteria | 1615 |
| 301 | Ga0466963_0000063 | 3300044694 | Bacteria | 36209 |
| 302 | Ga0466963_0000532 | 3300044694 | Bacteria | 17888 |
| 303 | Ga0466963_0001170 | 3300044694 | Bacteria | 13766 |
| 304 | Ga0466963_0001668 | 3300044694 | Bacteria | 12099 |
| 305 | Ga0466963_0003131 | 3300044694 | Bacteria | 9383 |
| 306 | Ga0466963_0003410 | 3300044694 | Bacteria | 9092 |
| 307 | Ga0466963_0004571 | 3300044694 | Bacteria | 8055 |
| 308 | Ga0466963_0004743 | 3300044694 | Bacteria | 7935 |
| 309 | Ga0466963_0007397 | 3300044694 | Bacteria | 6543 |
| 310 | Ga0466963_0012078 | 3300044694 | Bacteria | 5277 |
| 311 | Ga0466963_0018497 | 3300044694 | Bacteria | 4357 |
| 312 | Ga0466963_0018591 | 3300044694 | Bacteria | 4347 |
| 313 | Ga0466963_0022485 | 3300044694 | Bacteria | 3993 |
| 314 | Ga0466963_0061136 | 3300044694 | Bacteria | 2517 |
| 315 | Ga0466963_0084005 | 3300044694 | Bacteria | 2159 |
| 316 | Ga0466963_0147766 | 3300044694 | Bacteria | 1631 |
| 317 | Ga0466963_0154628 | 3300044694 | Bacteria | 1594 |
| 318 | Ga0466963_0210251 | 3300044694 | Bacteria | 1361 |
| 319 | Ga0466963_0338772 | 3300044694 | Bacteria | 1059 |
| 320 | Ga0466964_0005060 | 3300044706 | Bacteria | 4876 |
| 321 | Ga0466964_0010435 | 3300044706 | Bacteria | 3504 |
| 322 | Ga0466964_0014073 | 3300044706 | Bacteria | 3040 |
| 323 | Ga0466964_0016028 | 3300044706 | Bacteria | 2855 |
| 324 | Ga0466964_0061897 | 3300044706 | Bacteria | 1559 |
| 325 | Ga0466964_0071411 | 3300044706 | Bacteria | 1469 |
| 326 | Ga0466964_0181266 | 3300044706 | Bacteria | 999 |
| 327 | Ga0466971_0000840 | 3300044719 | Bacteria | 12499 |
| 328 | Ga0466971_0003605 | 3300044719 | Bacteria | 6616 |
| 329 | Ga0466971_0009517 | 3300044719 | Bacteria | 4243 |
| 330 | Ga0466971_0023522 | 3300044719 | Bacteria | 2747 |
| 331 | Ga0466971_0085144 | 3300044719 | Bacteria | 1444 |
| 332 | Ga0466971_0108675 | 3300044719 | Bacteria | 1278 |
| 333 | Ga0466971_0118338 | 3300044719 | Bacteria | 1225 |
| 334 | Ga0466968_0000944 | 3300044735 | Bacteria | 10230 |
| 335 | Ga0466968_0009575 | 3300044735 | Bacteria | 3729 |
| 336 | Ga0466968_0018611 | 3300044735 | Bacteria | 2788 |
| 337 | Ga0466968_0043696 | 3300044735 | Bacteria | 1898 |
| 338 | Ga0466968_0056623 | 3300044735 | Bacteria | 1684 |
| 339 | Ga0466968_0068640 | 3300044735 | Bacteria | 1539 |
| 340 | Ga0466970_0054110 | 3300044765 | Bacteria | 2143 |
| 341 | Ga0466970_0126007 | 3300044765 | Bacteria | 1404 |
| 342 | Ga0466970_0231341 | 3300044765 | Bacteria | 1033 |
| 343 | Ga0466957_0001577 | 3300044842 | Bacteria | 11997 |
| 344 | Ga0466957_0002652 | 3300044842 | Bacteria | 9652 |
| 345 | Ga0466957_0004191 | 3300044842 | Bacteria | 7991 |
| 346 | Ga0466957_0004835 | 3300044842 | Bacteria | 7536 |
| 347 | Ga0466957_0007463 | 3300044842 | Bacteria | 6175 |
| 348 | Ga0466957_0013568 | 3300044842 | Bacteria | 4729 |
| 349 | Ga0466957_0015401 | 3300044842 | Bacteria | 4467 |
| 350 | Ga0466957_0066509 | 3300044842 | Bacteria | 2222 |
| 351 | Ga0466957_0067764 | 3300044842 | Bacteria | 2202 |
| 352 | Ga0466957_0256935 | 3300044842 | Bacteria | 1163 |
| 353 | Ga0466957_0323344 | 3300044842 | Bacteria | 1041 |
| 354 | Ga0466960_0015030 | 3300044901 | Bacteria | 3330 |
| 355 | Ga0466960_0066391 | 3300044901 | Bacteria | 1784 |
| 356 | Ga0466960_0154748 | 3300044901 | Bacteria | 1227 |
| 357 | Ga0466959_0007814 | 3300045049 | Bacteria | 7526 |
| 358 | Ga0466959_0010769 | 3300045049 | Bacteria | 6552 |
| 359 | Ga0466959_0021405 | 3300045049 | Bacteria | 4768 |
| 360 | Ga0466959_0031708 | 3300045049 | Bacteria | 3911 |
| 361 | Ga0466959_0063445 | 3300045049 | Bacteria | 2683 |
| 362 | Ga0466959_0076233 | 3300045049 | Bacteria | 2421 |
| 363 | Ga0466959_0151383 | 3300045049 | Bacteria | 1635 |
| 364 | Ga0466959_0252697 | 3300045049 | Bacteria | 1215 |
| 365 | Ga0466958_0001030 | 3300045836 | Bacteria | 12726 |
| 366 | Ga0466958_0001870 | 3300045836 | Bacteria | 10285 |
| 367 | Ga0466958_0008049 | 3300045836 | Bacteria | 5829 |
| 368 | Ga0466958_0015206 | 3300045836 | Bacteria | 4406 |
| 369 | Ga0466958_0015349 | 3300045836 | Bacteria | 4388 |
| 370 | Ga0466958_0017512 | 3300045836 | Bacteria | 4144 |
| 371 | Ga0466958_0021892 | 3300045836 | Bacteria | 3738 |
| 372 | Ga0466958_0028315 | 3300045836 | Bacteria | 3322 |
| 373 | Ga0466958_0043820 | 3300045836 | Bacteria | 2695 |
| 374 | Ga0466958_0071955 | 3300045836 | Bacteria | 2117 |
| 375 | Ga0466958_0305958 | 3300045836 | Bacteria | 1021 |
| 376 | Ga0466967_0000058 | 3300045976 | Bacteria | 40166 |
| 377 | Ga0466967_0005902 | 3300045976 | Bacteria | 8583 |
| 378 | Ga0466967_0007306 | 3300045976 | Bacteria | 7955 |
| 379 | Ga0466967_0010600 | 3300045976 | Bacteria | 6924 |
| 380 | Ga0466967_0011156 | 3300045976 | Bacteria | 6788 |
| 381 | Ga0466967_0018957 | 3300045976 | Bacteria | 5519 |
| 382 | Ga0466967_0039152 | 3300045976 | Bacteria | 4073 |
| 383 | Ga0466967_0039367 | 3300045976 | Bacteria | 4063 |
| 384 | Ga0466967_0058945 | 3300045976 | Bacteria | 3395 |
| 385 | Ga0466967_0067806 | 3300045976 | Bacteria | 3183 |
| 386 | Ga0466967_0068222 | 3300045976 | Bacteria | 3175 |
| 387 | Ga0466967_0068774 | 3300045976 | Bacteria | 3163 |
| 388 | Ga0466967_0083047 | 3300045976 | Bacteria | 2896 |
| 389 | Ga0466967_0085431 | 3300045976 | Bacteria | 2857 |
| 390 | Ga0466967_0138683 | 3300045976 | Bacteria | 2263 |
| 391 | Ga0466967_0140998 | 3300045976 | Bacteria | 2245 |
| 392 | Ga0466967_0147096 | 3300045976 | Bacteria | 2198 |
| 393 | Ga0466967_0158044 | 3300045976 | Bacteria | 2125 |
| 394 | Ga0466967_0175536 | 3300045976 | Bacteria | 2018 |
| 395 | Ga0466967_0214732 | 3300045976 | Bacteria | 1825 |
| 396 | Ga0466967_0298546 | 3300045976 | Bacteria | 1549 |
| 397 | Ga0466967_0313729 | 3300045976 | Bacteria | 1511 |
| 398 | Ga0466967_0644371 | 3300045976 | Bacteria | 1047 |
| 399 | Ga0466967_0819592 | 3300045976 | Bacteria | 924 |
| 400 | Ga0495617_080559 | 3300046452 | Bacteria | 1067 |
| 401 | Ga0495592_0000410 | 3300046454 | Bacteria | 32753 |
| 402 | Ga0495592_0004998 | 3300046454 | Bacteria | 9763 |
| 403 | Ga0495592_0008445 | 3300046454 | Bacteria | 7726 |
| 404 | Ga0495592_0027012 | 3300046454 | Bacteria | 4351 |
| 405 | Ga0495592_0351882 | 3300046454 | Bacteria | 944 |
| 406 | Ga0495603_0000002 | 3300046455 | Bacteria | 86858 |
| 407 | Ga0495603_0025944 | 3300046455 | Bacteria | 3543 |
| 408 | Ga0495629_0062410 | 3300046459 | Bacteria | 2603 |
| 409 | Ga0495629_0082168 | 3300046459 | Bacteria | 2248 |
| 410 | Ga0495629_0177491 | 3300046459 | Bacteria | 1477 |
| 411 | Ga0495629_0191436 | 3300046459 | Bacteria | 1416 |
| 412 | Ga0495629_0361411 | 3300046459 | Bacteria | 989 |
| 413 | Ga0495641_0023968 | 3300046461 | Bacteria | 3020 |
| 414 | Ga0495641_0066530 | 3300046461 | Bacteria | 1621 |
| 415 | Ga0495651_0000034 | 3300046462 | Bacteria | 99213 |
| 416 | Ga0495651_0001012 | 3300046462 | Bacteria | 21756 |
| 417 | Ga0495651_0001663 | 3300046462 | Bacteria | 17191 |
| 418 | Ga0495651_0091036 | 3300046462 | Bacteria | 2287 |
| 419 | Ga0495651_0106335 | 3300046462 | Bacteria | 2080 |
| 420 | Ga0495653_0027281 | 3300046463 | Bacteria | 4571 |
| 421 | Ga0495653_0034260 | 3300046463 | Bacteria | 4018 |
| 422 | Ga0495653_0034515 | 3300046463 | Bacteria | 4000 |
| 423 | Ga0495653_0056787 | 3300046463 | Bacteria | 2982 |
| 424 | Ga0495653_0124254 | 3300046463 | Bacteria | 1834 |
| 425 | Ga0495580_0025275 | 3300046472 | Bacteria | 4342 |
| 426 | Ga0495580_0084445 | 3300046472 | Bacteria | 2212 |
| 427 | Ga0495582_0010406 | 3300046473 | Bacteria | 5116 |
| 428 | Ga0495582_0015104 | 3300046473 | Bacteria | 4247 |
| 429 | Ga0495582_0157569 | 3300046473 | Bacteria | 1290 |
| 430 | Ga0495605_0128346 | 3300046474 | Bacteria | 1145 |
| 431 | Ga0495639_0004561 | 3300046475 | Bacteria | 5938 |
| 432 | Ga0495662_0015377 | 3300046476 | Bacteria | 3717 |
| 433 | Ga0495662_0025982 | 3300046476 | Bacteria | 2828 |
| 434 | Ga0495662_0149537 | 3300046476 | Bacteria | 1150 |
| 435 | Ga0495664_0007988 | 3300046477 | Bacteria | 5889 |
| 436 | Ga0495664_0037454 | 3300046477 | Bacteria | 2862 |
| 437 | Ga0495664_0047482 | 3300046477 | Bacteria | 2548 |
| 438 | Ga0495664_0164255 | 3300046477 | Bacteria | 1347 |
| 439 | Ga0495584_0021268 | 3300046491 | Bacteria | 3296 |
| 440 | Ga0495596_0071924 | 3300046500 | Bacteria | 1343 |
| 441 | Ga0495596_0145037 | 3300046500 | Bacteria | 922 |
| 442 | Ga0495607_0222490 | 3300046501 | Bacteria | 922 |
| 443 | Ga0495608_0000638 | 3300046511 | Bacteria | 24128 |
| 444 | Ga0495608_0009815 | 3300046511 | Bacteria | 6682 |
| 445 | Ga0495608_0018469 | 3300046511 | Bacteria | 4809 |
| 446 | Ga0495608_0040572 | 3300046511 | Bacteria | 3118 |
| 447 | Ga0495608_0105641 | 3300046511 | Bacteria | 1813 |
| 448 | Ga0495608_0145303 | 3300046511 | Bacteria | 1513 |
| 449 | Ga0495618_0002873 | 3300046514 | Bacteria | 10921 |
| 450 | Ga0495618_0005628 | 3300046514 | Bacteria | 7617 |
| 451 | Ga0495618_0018284 | 3300046514 | Bacteria | 4304 |
| 452 | Ga0495618_0171924 | 3300046514 | Bacteria | 1378 |
| 453 | Ga0495618_0395402 | 3300046514 | Bacteria | 846 |
| 454 | Ga0495628_0000184 | 3300046516 | Bacteria | 54832 |
| 455 | Ga0495628_0066449 | 3300046516 | Bacteria | 2819 |
| 456 | Ga0495628_0095275 | 3300046516 | Bacteria | 2300 |
| 457 | Ga0495628_0153783 | 3300046516 | Bacteria | 1751 |
| 458 | Ga0495628_0293934 | 3300046516 | Bacteria | 1204 |
| 459 | Ga0495630_0016688 | 3300046517 | Bacteria | 5369 |
| 460 | Ga0495630_0067712 | 3300046517 | Bacteria | 2684 |
| 461 | Ga0495630_0124664 | 3300046517 | Bacteria | 1954 |
| 462 | Ga0495630_0186274 | 3300046517 | Bacteria | 1583 |
| 463 | Ga0495637_0114693 | 3300046520 | Unclassified | 1041 |
| 464 | Ga0495663_0010351 | 3300046525 | Bacteria | 2593 |
| 465 | Ga0495666_0005883 | 3300046526 | Bacteria | 6177 |
| 466 | Ga0495666_0144375 | 3300046526 | Bacteria | 1108 |
| 467 | Ga0495642_0228442 | 3300046528 | Bacteria | 813 |
| 468 | Ga0495652_0000018 | 3300046529 | Bacteria | 201634 |
| 469 | Ga0495652_0000319 | 3300046529 | Bacteria | 56845 |
| 470 | Ga0495652_0012982 | 3300046529 | Bacteria | 7507 |
| 471 | Ga0495652_0018727 | 3300046529 | Bacteria | 6171 |
| 472 | Ga0495652_0040512 | 3300046529 | Bacteria | 4026 |
| 473 | Ga0495652_0303383 | 3300046529 | Bacteria | 1160 |
| 474 | Ga0495652_0610148 | 3300046529 | Bacteria | 743 |
| 475 | Ga0495665_0003054 | 3300046531 | Bacteria | 9046 |
| 476 | Ga0495640_0007089 | 3300046533 | Bacteria | 8819 |
| 477 | Ga0495640_0018293 | 3300046533 | Bacteria | 5200 |
| 478 | Ga0495640_0064539 | 3300046533 | Bacteria | 2475 |
| 479 | Ga0495640_0070391 | 3300046533 | Bacteria | 2350 |
| 480 | Ga0495586_0006570 | 3300046535 | Bacteria | 6213 |
| 481 | Ga0495586_0031302 | 3300046535 | Bacteria | 2849 |
| 482 | Ga0495586_0093838 | 3300046535 | Bacteria | 1660 |
| 483 | Ga0495586_0166511 | 3300046535 | Bacteria | 1244 |
| 484 | Ga0495587_0000055 | 3300046536 | Bacteria | 97024 |
| 485 | Ga0495587_0002592 | 3300046536 | Bacteria | 12074 |
| 486 | Ga0495587_0179243 | 3300046536 | Bacteria | 1202 |
| 487 | Ga0495587_0309048 | 3300046536 | Bacteria | 883 |
| 488 | Ga0495609_0010667 | 3300046538 | Bacteria | 4398 |
| 489 | Ga0495609_0132281 | 3300046538 | Bacteria | 1068 |
| 490 | Ga0495645_0000170 | 3300046543 | Bacteria | 45455 |
| 491 | Ga0495645_0003745 | 3300046543 | Bacteria | 10334 |
| 492 | Ga0495645_0040286 | 3300046543 | Bacteria | 3408 |
| 493 | Ga0495667_0001359 | 3300046559 | Bacteria | 16070 |
| 494 | Ga0495667_0024084 | 3300046559 | Bacteria | 4100 |
| 495 | Ga0495667_0030639 | 3300046559 | Bacteria | 3614 |
| 496 | Ga0495667_0036127 | 3300046559 | Bacteria | 3299 |
| 497 | Ga0495667_0456729 | 3300046559 | Bacteria | 802 |
| 498 | Ga0495656_0014532 | 3300046615 | Bacteria | 2953 |
| 499 | Ga0495656_0014707 | 3300046615 | Bacteria | 2939 |
| 500 | Ga0495656_0100521 | 3300046615 | Bacteria | 1337 |
| 501 | Ga0495634_0002851 | 3300046642 | Bacteria | 14199 |
| 502 | Ga0495634_0024046 | 3300046642 | Bacteria | 4278 |
| 503 | Ga0495634_0034030 | 3300046642 | Bacteria | 3497 |
| 504 | Ga0495634_0101062 | 3300046642 | Bacteria | 1863 |
| 505 | Ga0495634_0178773 | 3300046642 | Bacteria | 1329 |
| 506 | Ga0495634_0195754 | 3300046642 | Bacteria | 1258 |
| 507 | Ga0495635_0005146 | 3300046663 | Bacteria | 9104 |
| 508 | Ga0495635_0026307 | 3300046663 | Bacteria | 4050 |
| 509 | Ga0495635_0075977 | 3300046663 | Bacteria | 2302 |
| 510 | Ga0495635_0185457 | 3300046663 | Bacteria | 1413 |
| 511 | Ga0495635_0573113 | 3300046663 | Bacteria | 739 |
| 512 | Ga0495588_0212725 | 3300046674 | Bacteria | 1021 |
| 513 | Ga0495657_0008362 | 3300046675 | Bacteria | 7925 |
| 514 | Ga0495657_0026041 | 3300046675 | Bacteria | 4147 |
| 515 | Ga0495657_0028353 | 3300046675 | Bacteria | 3940 |
| 516 | Ga0495657_0055604 | 3300046675 | Bacteria | 2639 |
| 517 | Ga0495657_0075310 | 3300046675 | Bacteria | 2194 |
| 518 | Ga0495657_0088258 | 3300046675 | Bacteria | 1994 |
| 519 | Ga0495599_0000227 | 3300046678 | Bacteria | 35652 |
| 520 | Ga0495599_0075134 | 3300046678 | Bacteria | 2110 |
| 521 | Ga0495599_0487806 | 3300046678 | Bacteria | 726 |
| 522 | Ga0495623_0000149 | 3300046679 | Bacteria | 42958 |
| 523 | Ga0495623_0024677 | 3300046679 | Bacteria | 3871 |
| 524 | Ga0495646_0008095 | 3300046680 | Bacteria | 6684 |
| 525 | Ga0495646_0059895 | 3300046680 | Bacteria | 2272 |
| 526 | Ga0495646_0086558 | 3300046680 | Bacteria | 1817 |
| 527 | Ga0495647_0003022 | 3300046681 | Bacteria | 5355 |
| 528 | Ga0495647_0105101 | 3300046681 | Bacteria | 1172 |
| 529 | Ga0495658_0017571 | 3300046683 | Bacteria | 3698 |
| 530 | Ga0495658_0050975 | 3300046683 | Bacteria | 2343 |
| 531 | Ga0495658_0066811 | 3300046683 | Bacteria | 2078 |
| 532 | Ga0495613_0007620 | 3300046689 | Bacteria | 8050 |
| 533 | Ga0495613_0011331 | 3300046689 | Bacteria | 6625 |
| 534 | Ga0495613_0400639 | 3300046689 | Bacteria | 936 |
| 535 | Ga0495624_0044075 | 3300046690 | Bacteria | 2845 |
| 536 | Ga0495624_0068338 | 3300046690 | Bacteria | 2215 |
| 537 | Ga0495624_0181478 | 3300046690 | Bacteria | 1282 |
| 538 | Ga0495670_0135443 | 3300046691 | Bacteria | 1286 |
| 539 | Ga0495671_0036146 | 3300046692 | Bacteria | 2504 |
| 540 | Ga0495589_0179953 | 3300046794 | Unclassified | 1003 |
| 541 | Ga0495600_0061743 | 3300046809 | Bacteria | 2448 |
| 542 | Ga0495600_0138290 | 3300046809 | Bacteria | 1581 |
| 543 | Ga0495600_0161643 | 3300046809 | Bacteria | 1447 |
| 544 | Ga0495600_0177910 | 3300046809 | Bacteria | 1371 |
| 545 | Ga0495660_0126159 | 3300046810 | Unclassified | 1289 |
| 546 | Ga0495581_0000841 | 3300047315 | Bacteria | 16355 |
| 547 | Ga0495581_0021505 | 3300047315 | Bacteria | 3738 |
| 548 | Ga0495581_0216160 | 3300047315 | Bacteria | 1121 |
| 549 | Ga0495604_0000194 | 3300047317 | Bacteria | 54877 |
| 550 | Ga0495604_0022634 | 3300047317 | Bacteria | 5018 |
| 551 | Ga0495604_0023034 | 3300047317 | Bacteria | 4970 |
| 552 | Ga0495604_0158522 | 3300047317 | Bacteria | 1601 |
| 553 | Ga0495636_0135668 | 3300047318 | Bacteria | 1097 |
| 554 | Ga0495674_0001118 | 3300047319 | Bacteria | 25782 |
| 555 | Ga0495674_0019031 | 3300047319 | Bacteria | 6384 |
| 556 | Ga0495674_0024937 | 3300047319 | Bacteria | 5488 |
| 557 | Ga0495674_0103016 | 3300047319 | Bacteria | 2427 |
| 558 | Ga0495674_0105138 | 3300047319 | Bacteria | 2399 |
| 559 | Ga0495674_0211448 | 3300047319 | Bacteria | 1606 |
| 560 | Ga0495672_0020217 | 3300047320 | Bacteria | 4370 |
| 561 | Ga0495676_0038375 | 3300047321 | Bacteria | 3978 |
| 562 | Ga0495676_0114233 | 3300047321 | Bacteria | 1976 |
| 563 | Ga0495676_0143234 | 3300047321 | Bacteria | 1710 |
| 564 | Ga0495676_0330414 | 3300047321 | Bacteria | 1022 |
| 565 | Ga0495680_0001661 | 3300047322 | Bacteria | 23654 |
| 566 | Ga0495680_0005838 | 3300047322 | Bacteria | 11521 |
| 567 | Ga0495680_0027260 | 3300047322 | Bacteria | 4696 |
| 568 | Ga0495680_0056570 | 3300047322 | Bacteria | 3036 |
| 569 | Ga0495680_0064483 | 3300047322 | Bacteria | 2809 |
| 570 | Ga0495680_0075140 | 3300047322 | Bacteria | 2564 |
| 571 | Ga0495680_0161960 | 3300047322 | Bacteria | 1624 |
| 572 | Ga0495680_0307152 | 3300047322 | Unclassified | 1113 |
| 573 | Ga0495675_0000029 | 3300047444 | Bacteria | 105305 |
| 574 | Ga0495675_0023279 | 3300047444 | Bacteria | 3947 |
| 575 | Ga0495675_0256667 | 3300047444 | Bacteria | 1048 |
| 576 | Ga0495684_0005978 | 3300047471 | Bacteria | 9455 |
| 577 | Ga0495684_0010365 | 3300047471 | Bacteria | 7210 |
| 578 | Ga0495684_0047784 | 3300047471 | Bacteria | 3272 |
| 579 | Ga0495684_0060194 | 3300047471 | Bacteria | 2891 |
| 580 | Ga0495684_0104901 | 3300047471 | Bacteria | 2136 |
| 581 | Ga0495684_0157964 | 3300047471 | Bacteria | 1693 |
| 582 | Ga0495684_0324658 | 3300047471 | Bacteria | 1099 |
| 583 | Ga0495593_0000750 | 3300047673 | Bacteria | 18855 |
| 584 | Ga0495602_0000741 | 3300048088 | Bacteria | 30911 |
| 585 | Ga0495602_0044523 | 3300048088 | Bacteria | 4025 |
| 586 | Ga0495602_0077464 | 3300048088 | Bacteria | 2813 |
| 587 | Ga0495614_0001705 | 3300048089 | Bacteria | 9587 |
| 588 | Ga0495614_0108431 | 3300048089 | Bacteria | 1218 |
| 589 | Ga0496100_0022876 | 3300048903 | Bacteria | 3787 |
| 590 | Ga0496100_0081379 | 3300048903 | Bacteria | 2188 |
| 591 | Ga0496100_0791091 | 3300048903 | Bacteria | 743 |
| 592 | Ga0496101_0046600 | 3300048904 | Bacteria | 3109 |
| 593 | Ga0496101_0147262 | 3300048904 | Bacteria | 1799 |
| 594 | Ga0496101_0429762 | 3300048904 | Bacteria | 1041 |
| 595 | Ga0496101_0543266 | 3300048904 | Bacteria | 919 |
| 596 | Ga0496102_0054721 | 3300048905 | Bacteria | 3639 |
| 597 | Ga0496103_0037070 | 3300048906 | Bacteria | 2988 |
| 598 | Ga0496103_0052413 | 3300048906 | Bacteria | 2527 |
| 599 | Ga0496104_0025508 | 3300048907 | Bacteria | 5449 |
| 600 | Ga0496104_0118817 | 3300048907 | Bacteria | 2538 |
| 601 | Ga0496104_0228354 | 3300048907 | Bacteria | 1773 |
| 602 | Ga0496105_0002189 | 3300048908 | Bacteria | 14153 |
| 603 | Ga0496105_0046395 | 3300048908 | Bacteria | 3586 |
| 604 | Ga0496106_0012986 | 3300048909 | Bacteria | 6145 |
| 605 | Ga0496107_0152341 | 3300048910 | Bacteria | 1711 |
| 606 | Ga0496107_0166603 | 3300048910 | Bacteria | 1634 |
| 607 | Ga0496108_0006809 | 3300048911 | Bacteria | 9249 |
| 608 | Ga0496108_0014135 | 3300048911 | Bacteria | 6513 |
| 609 | Ga0496108_0030189 | 3300048911 | Bacteria | 4492 |
| 610 | Ga0496108_0172167 | 3300048911 | Bacteria | 1873 |
| 611 | Ga0496109_0004307 | 3300048912 | Bacteria | 11885 |
| 612 | Ga0496109_0020876 | 3300048912 | Bacteria | 5789 |
| 613 | Ga0496109_0171370 | 3300048912 | Bacteria | 2036 |
| 614 | Ga0496109_0193873 | 3300048912 | Bacteria | 1909 |
| 615 | Ga0496109_0274399 | 3300048912 | Bacteria | 1589 |
| 616 | Ga0496110_0052905 | 3300048913 | Bacteria | 3568 |
| 617 | Ga0496110_0073940 | 3300048913 | Bacteria | 3025 |
| 618 | Ga0496110_0237246 | 3300048913 | Bacteria | 1659 |
| 619 | Ga0496110_0265346 | 3300048913 | Bacteria | 1563 |
| 620 | Ga0496110_0348880 | 3300048913 | Bacteria | 1348 |
| 621 | Ga0496111_0012332 | 3300048914 | Bacteria | 5782 |
| 622 | Ga0496111_0025587 | 3300048914 | Bacteria | 4165 |
| 623 | Ga0496111_0031648 | 3300048914 | Bacteria | 3769 |
| 624 | Ga0496111_0187345 | 3300048914 | Bacteria | 1538 |
| 625 | Ga0496111_0203715 | 3300048914 | Bacteria | 1470 |
| 626 | Ga0496112_0006882 | 3300048915 | Bacteria | 10027 |
| 627 | Ga0496112_0068703 | 3300048915 | Bacteria | 3499 |
| 628 | Ga0496112_0090106 | 3300048915 | Bacteria | 3036 |
| 629 | Ga0496112_0105244 | 3300048915 | Bacteria | 2791 |
| 630 | Ga0496112_0367965 | 3300048915 | Bacteria | 1379 |
| 631 | Ga0496113_0008476 | 3300048916 | Bacteria | 6700 |
| 632 | Ga0496113_0050750 | 3300048916 | Bacteria | 3094 |
| 633 | Ga0496113_0059994 | 3300048916 | Bacteria | 2866 |
| 634 | Ga0496113_0226609 | 3300048916 | Bacteria | 1490 |
| 635 | Ga0496113_0454619 | 3300048916 | Bacteria | 1029 |
| 636 | Ga0496114_0005225 | 3300048917 | Bacteria | 10144 |
| 637 | Ga0496114_0012744 | 3300048917 | Bacteria | 6734 |
| 638 | Ga0496114_0323000 | 3300048917 | Bacteria | 1364 |
| 639 | Ga0496114_0452156 | 3300048917 | Bacteria | 1137 |
| 640 | Ga0496115_0009386 | 3300048918 | Bacteria | 7270 |
| 641 | Ga0496115_0134297 | 3300048918 | Bacteria | 2040 |
| 642 | Ga0496115_0136240 | 3300048918 | Bacteria | 2024 |
| 643 | Ga0501046_0247857 | 3300049580 | Bacteria | 1312 |
| 644 | Ga0501067_0001961 | 3300049583 | Bacteria | 11330 |
| 645 | Ga0501067_0011371 | 3300049583 | Bacteria | 4929 |
| 646 | Ga0501069_0002930 | 3300049585 | Bacteria | 8758 |
| 647 | Ga0501069_0007840 | 3300049585 | Bacteria | 5605 |
| 648 | Ga0501069_0208935 | 3300049585 | Bacteria | 1133 |
| 649 | Ga0501069_0215897 | 3300049585 | Bacteria | 1114 |
| 650 | Ga0501072_0003796 | 3300049588 | Bacteria | 11406 |
| 651 | Ga0501073_0041383 | 3300049589 | Bacteria | 3256 |
| 652 | Ga0501074_0003122 | 3300049590 | Bacteria | 11682 |
| 653 | Ga0501079_0185371 | 3300049741 | Bacteria | 1624 |
| 654 | Ga0501080_0019295 | 3300049742 | Bacteria | 6317 |
| 655 | Ga0501080_0175585 | 3300049742 | Bacteria | 1974 |
| 656 | Ga0501083_0000442 | 3300049744 | Bacteria | 26662 |
| 657 | Ga0495601_0000082 | 3300053077 | Bacteria | 51242 |
| 658 | Ga0495601_0006082 | 3300053077 | Bacteria | 7041 |
| 659 | Ga0495601_0007828 | 3300053077 | Bacteria | 6287 |
| 660 | Ga0495601_0042730 | 3300053077 | Bacteria | 2845 |
| 661 | Ga0495601_0053280 | 3300053077 | Bacteria | 2557 |
| 662 | Ga0495601_0071523 | 3300053077 | Bacteria | 2215 |
| 663 | Ga0495601_0440087 | 3300053077 | Bacteria | 843 |
| 664 | Ga0495612_0000129 | 3300053078 | Bacteria | 31866 |
| 665 | Ga0495612_0009834 | 3300053078 | Bacteria | 3873 |
| 666 | Ga0495612_0012566 | 3300053078 | Bacteria | 3413 |
| 667 | Ga0495612_0292991 | 3300053078 | Bacteria | 729 |
| 668 | Ga0495655_0006206 | 3300053083 | Bacteria | 2159 |
| 669 | Ga0495595_0006938 | 3300053084 | Bacteria | 4624 |
| 670 | Ga0495595_0009298 | 3300053084 | Bacteria | 4060 |
| 671 | Ga0495595_0014501 | 3300053084 | Bacteria | 3346 |
| 672 | Ga0495595_0019068 | 3300053084 | Bacteria | 2972 |
| 673 | Ga0495595_0129721 | 3300053084 | Unclassified | 1232 |
| 674 | Ga0495619_0004401 | 3300053085 | Bacteria | 8985 |
| 675 | Ga0495619_0023764 | 3300053085 | Bacteria | 3929 |
| 676 | Ga0495619_0054388 | 3300053085 | Bacteria | 2649 |
| 677 | Ga0495619_0059351 | 3300053085 | Bacteria | 2541 |
| 678 | Ga0495619_0086729 | 3300053085 | Bacteria | 2116 |
| 679 | Ga0495619_0200484 | 3300053085 | Bacteria | 1381 |
| 680 | Ga0495619_0351819 | 3300053085 | Bacteria | 1019 |
| 681 | Ga0495619_0600530 | 3300053085 | Unclassified | 753 |
| 682 | Ga0501084_0170305 | 3300054114 | Bacteria | 1838 |
| 683 | Ga0501082_0189722 | 3300060353 | Bacteria | 1788 |
| 684 | Ga0466962_0000979 | 3300061719 | Bacteria | 12991 |
| 685 | Ga0466962_0001028 | 3300061719 | Bacteria | 12768 |
| 686 | Ga0466962_0005923 | 3300061719 | Bacteria | 5875 |
| 687 | Ga0466962_0025537 | 3300061719 | Bacteria | 2836 |
| 688 | Ga0466962_0088428 | 3300061719 | Bacteria | 1484 |
| 689 | Ga0466962_0091444 | 3300061719 | Bacteria | 1458 |
| 690 | Ga0530510_0009441 | 3300061734 | Bacteria | 6841 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053077 | Ga0495601_0053280 | Ga0495601_0053280_595_1257 | 189 |
| 2 | 3300037418 | Ga0395900_0021603 | Ga0395900_0021603_5540_6205 | 200 |
| 3 | 3300037466 | Ga0395898_0191993 | Ga0395898_0191993_831_1496 | 200 |
| 4 | 3300037471 | Ga0395905_0139687 | Ga0395905_0139687_736_1401 | 200 |
| 5 | 3300038443 | Ga0395901_0006362 | Ga0395901_0006362_1073_1738 | 200 |
| 6 | 3300046663 | Ga0495635_0573113 | Ga0495635_0573113_29_694 | 202 |
| 7 | 3300047317 | Ga0495604_0158522 | Ga0495604_0158522_668_1333 | 202 |
| 8 | 3300047471 | Ga0495684_0104901 | Ga0495684_0104901_769_1434 | 202 |
| 9 | 3300048907 | Ga0496104_0118817 | Ga0496104_0118817_1200_1808 | 202 |
| 10 | 3300048915 | Ga0496112_0006882 | Ga0496112_0006882_6273_6938 | 202 |
| 11 | 3300028558 | Ga0265326_10017432 | Ga0265326_100174322 | 203 |
| 12 | 3300028563 | Ga0265319_1005383 | Ga0265319_10053834 | 203 |
| 13 | 3300028563 | Ga0265319_1030077 | Ga0265319_10300772 | 203 |
| 14 | 3300028563 | Ga0265319_1050291 | Ga0265319_10502912 | 203 |
| 15 | 3300028573 | Ga0265334_10000492 | Ga0265334_1000049210 | 203 |
| 16 | 3300028577 | Ga0265318_10000429 | Ga0265318_100004298 | 203 |
| 17 | 3300028654 | Ga0265322_10003192 | Ga0265322_100031922 | 203 |
| 18 | 3300028666 | Ga0265336_10013473 | Ga0265336_100134732 | 203 |
| 19 | 3300028800 | Ga0265338_10003836 | Ga0265338_1000383615 | 203 |
| 20 | 3300029957 | Ga0265324_10035420 | Ga0265324_100354202 | 203 |
| 21 | 3300031235 | Ga0265330_10000760 | Ga0265330_1000076017 | 203 |
| 22 | 3300031238 | Ga0265332_10003620 | Ga0265332_100036205 | 203 |
| 23 | 3300031239 | Ga0265328_10000357 | Ga0265328_1000035716 | 203 |
| 24 | 3300031240 | Ga0265320_10005108 | Ga0265320_100051084 | 203 |
| 25 | 3300031241 | Ga0265325_10001666 | Ga0265325_100016663 | 203 |
| 26 | 3300031242 | Ga0265329_10003650 | Ga0265329_100036507 | 203 |
| 27 | 3300031247 | Ga0265340_10011415 | Ga0265340_100114155 | 203 |
| 28 | 3300031249 | Ga0265339_10014132 | Ga0265339_100141322 | 203 |
| 29 | 3300031250 | Ga0265331_10015897 | Ga0265331_100158974 | 203 |
| 30 | 3300031251 | Ga0265327_10005032 | Ga0265327_100050322 | 203 |
| 31 | 3300031344 | Ga0265316_10027658 | Ga0265316_100276584 | 203 |
| 32 | 3300031344 | Ga0265316_10169929 | Ga0265316_101699292 | 203 |
| 33 | 3300031595 | Ga0265313_10002251 | Ga0265313_100022514 | 203 |
| 34 | 3300031711 | Ga0265314_10017707 | Ga0265314_100177072 | 203 |
| 35 | 3300031712 | Ga0265342_10003288 | Ga0265342_100032888 | 203 |
| 36 | 3300053083 | Ga0495655_0006206 | Ga0495655_0006206_77_742 | 203 |
| 37 | 3300026116 | Ga0207674_10408791 | Ga0207674_104087912 | 204 |
| 38 | 3300041512 | Ga0451853_1443220 | Ga0451853_1443220_575_1240 | 205 |
| 39 | 3300046452 | Ga0495617_080559 | Ga0495617_080559_144_845 | 205 |
| 40 | 3300046501 | Ga0495607_0222490 | Ga0495607_0222490_44_745 | 205 |
| 41 | 3300046529 | Ga0495652_0610148 | Ga0495652_0610148_35_700 | 205 |
| 42 | 3300005329 | Ga0070683_100003106 | Ga0070683_1000031062 | 206 |
| 43 | 3300005471 | Ga0070698_100072738 | Ga0070698_1000727382 | 206 |
| 44 | 3300005535 | Ga0070684_100026806 | Ga0070684_1000268062 | 206 |
| 45 | 3300014969 | Ga0157376_10093642 | Ga0157376_100936422 | 206 |
| 46 | 3300025915 | Ga0207693_10188236 | Ga0207693_101882362 | 206 |
| 47 | 3300025929 | Ga0207664_10325383 | Ga0207664_103253832 | 206 |
| 48 | 3300025944 | Ga0207661_10172481 | Ga0207661_101724812 | 206 |
| 49 | 3300025945 | Ga0207679_10209453 | Ga0207679_102094532 | 206 |
| 50 | 3300026116 | Ga0207674_10047966 | Ga0207674_100479662 | 206 |
| 51 | 3300028573 | Ga0265334_10076889 | Ga0265334_100768892 | 206 |
| 52 | 3300028577 | Ga0265318_10039303 | Ga0265318_100393032 | 206 |
| 53 | 3300028577 | Ga0265318_10142557 | Ga0265318_101425571 | 206 |
| 54 | 3300028800 | Ga0265338_10010750 | Ga0265338_1001075012 | 206 |
| 55 | 3300028800 | Ga0265338_10140300 | Ga0265338_101403002 | 206 |
| 56 | 3300031242 | Ga0265329_10051628 | Ga0265329_100516282 | 206 |
| 57 | 3300031249 | Ga0265339_10012774 | Ga0265339_100127745 | 206 |
| 58 | 3300031249 | Ga0265339_10026012 | Ga0265339_100260124 | 206 |
| 59 | 3300031250 | Ga0265331_10079683 | Ga0265331_100796832 | 206 |
| 60 | 3300031250 | Ga0265331_10120844 | Ga0265331_101208442 | 206 |
| 61 | 3300031344 | Ga0265316_10023216 | Ga0265316_100232164 | 206 |
| 62 | 3300031595 | Ga0265313_10055594 | Ga0265313_100555942 | 206 |
| 63 | 3300031711 | Ga0265314_10011890 | Ga0265314_100118909 | 206 |
| 64 | 3300031712 | Ga0265342_10032768 | Ga0265342_100327683 | 206 |
| 65 | 3300031712 | Ga0265342_10121806 | Ga0265342_101218062 | 206 |
| 66 | 3300037312 | Ga0395899_0348603 | Ga0395899_0348603_183_848 | 206 |
| 67 | 3300037418 | Ga0395900_0033120 | Ga0395900_0033120_779_1444 | 206 |
| 68 | 3300037466 | Ga0395898_0015373 | Ga0395898_0015373_5400_6065 | 206 |
| 69 | 3300041459 | Ga0451800_0303337 | Ga0451800_0303337_603_1268 | 206 |
| 70 | 3300041512 | Ga0451853_3617744 | Ga0451853_3617744_807_1472 | 206 |
| 71 | 3300046491 | Ga0495584_0021268 | Ga0495584_0021268_1790_2455 | 206 |
| 72 | 3300046500 | Ga0495596_0145037 | Ga0495596_0145037_69_734 | 206 |
| 73 | 3300046520 | Ga0495637_0114693 | Ga0495637_0114693_331_996 | 206 |
| 74 | 3300046525 | Ga0495663_0010351 | Ga0495663_0010351_725_1390 | 206 |
| 75 | 3300046538 | Ga0495609_0010667 | Ga0495609_0010667_1030_1731 | 206 |
| 76 | 3300046615 | Ga0495656_0014532 | Ga0495656_0014532_1409_2074 | 206 |
| 77 | 3300046692 | Ga0495671_0036146 | Ga0495671_0036146_602_1267 | 206 |
| 78 | 3300046794 | Ga0495589_0179953 | Ga0495589_0179953_204_869 | 206 |
| 79 | 3300046810 | Ga0495660_0126159 | Ga0495660_0126159_35_700 | 206 |
| 80 | 3300009176 | Ga0105242_10205667 | Ga0105242_102056672 | 210 |
| 81 | 3300005471 | Ga0070698_100401417 | Ga0070698_1004014172 | 213 |
| 82 | 3300005444 | Ga0070694_100332545 | Ga0070694_1003325452 | 217 |
| 83 | 3300028794 | Ga0307515_10000947 | Ga0307515_1000094745 | 217 |
| 84 | 3300031730 | Ga0307516_10006457 | Ga0307516_100064577 | 217 |
| 85 | 3300032002 | Ga0307416_100205445 | Ga0307416_1002054452 | 217 |
| 86 | 3300041452 | Ga0451793_1255881 | Ga0451793_1255881_144_806 | 217 |
| 87 | 3300041459 | Ga0451800_1012959 | Ga0451800_1012959_450_1112 | 217 |
| 88 | 3300041460 | Ga0451802_0172239 | Ga0451802_0172239_1944_2606 | 217 |
| 89 | 3300041463 | Ga0451804_0658122 | Ga0451804_0658122_873_1535 | 217 |
| 90 | 3300041486 | Ga0451807_1714584 | Ga0451807_1714584_628_1290 | 217 |
| 91 | 3300041486 | Ga0451807_2357288 | Ga0451807_2357288_1445_2107 | 217 |
| 92 | 3300041501 | Ga0451845_0119325 | Ga0451845_0119325_1136_1798 | 217 |
| 93 | 3300041505 | Ga0451849_1417415 | Ga0451849_1417415_735_1397 | 217 |
| 94 | 3300041507 | Ga0451851_0655441 | Ga0451851_0655441_960_1622 | 217 |
| 95 | 3300041512 | Ga0451853_2071879 | Ga0451853_2071879_6266_6928 | 217 |
| 96 | 3300041512 | Ga0451853_2743555 | Ga0451853_2743555_589_1251 | 217 |
| 97 | 3300046477 | Ga0495664_0164255 | Ga0495664_0164255_77_745 | 217 |
| 98 | 3300046516 | Ga0495628_0293934 | Ga0495628_0293934_484_1152 | 217 |
| 99 | 3300047319 | Ga0495674_0103016 | Ga0495674_0103016_1055_1723 | 217 |
| 100 | 3300053078 | Ga0495612_0000129 | Ga0495612_0000129_15784_16452 | 217 |
| 101 | 3300005435 | Ga0070714_100088928 | Ga0070714_1000889282 | 218 |
| 102 | 3300025929 | Ga0207664_10106192 | Ga0207664_101061922 | 218 |
| 103 | 3300030521 | Ga0307511_10045453 | Ga0307511_100454532 | 218 |
| 104 | 3300044901 | Ga0466960_0066391 | Ga0466960_0066391_389_1168 | 218 |
| 105 | 3300046455 | Ga0495603_0000002 | Ga0495603_0000002_16805_17545 | 218 |
| 106 | 3300046459 | Ga0495629_0062410 | Ga0495629_0062410_543_1256 | 218 |
| 107 | 3300046476 | Ga0495662_0149537 | Ga0495662_0149537_135_809 | 218 |
| 108 | 3300046529 | Ga0495652_0000018 | Ga0495652_0000018_20471_21142 | 218 |
| 109 | 3300046536 | Ga0495587_0309048 | Ga0495587_0309048_175_846 | 218 |
| 110 | 3300046543 | Ga0495645_0003745 | Ga0495645_0003745_7129_7803 | 218 |
| 111 | 3300046642 | Ga0495634_0002851 | Ga0495634_0002851_9309_9983 | 218 |
| 112 | 3300047320 | Ga0495672_0020217 | Ga0495672_0020217_2964_3641 | 218 |
| 113 | 3300048912 | Ga0496109_0274399 | Ga0496109_0274399_637_1320 | 218 |
| 114 | 3300048913 | Ga0496110_0348880 | Ga0496110_0348880_122_805 | 218 |
| 115 | 3300053077 | Ga0495601_0071523 | Ga0495601_0071523_1214_1885 | 218 |
| 116 | 3300005435 | Ga0070714_100821763 | Ga0070714_1008217631 | 219 |
| 117 | 3300005458 | Ga0070681_10213480 | Ga0070681_102134802 | 219 |
| 118 | 3300005937 | Ga0081455_10016958 | Ga0081455_1001695810 | 219 |
| 119 | 3300013105 | Ga0157369_10183763 | Ga0157369_101837634 | 219 |
| 120 | 3300025919 | Ga0207657_10219805 | Ga0207657_102198051 | 219 |
| 121 | 3300044694 | Ga0466963_0338772 | Ga0466963_0338772_136_795 | 219 |
| 122 | 3300045976 | Ga0466967_0313729 | Ga0466967_0313729_614_1273 | 219 |
| 123 | 3300005327 | Ga0070658_10484514 | Ga0070658_104845142 | 220 |
| 124 | 3300005329 | Ga0070683_100035125 | Ga0070683_1000351254 | 220 |
| 125 | 3300005434 | Ga0070709_10473300 | Ga0070709_104733002 | 220 |
| 126 | 3300005435 | Ga0070714_100053854 | Ga0070714_1000538543 | 220 |
| 127 | 3300005435 | Ga0070714_100898700 | Ga0070714_1008987002 | 220 |
| 128 | 3300005436 | Ga0070713_100006886 | Ga0070713_1000068863 | 220 |
| 129 | 3300005437 | Ga0070710_10304922 | Ga0070710_103049222 | 220 |
| 130 | 3300005440 | Ga0070705_100477813 | Ga0070705_1004778131 | 220 |
| 131 | 3300005467 | Ga0070706_100066553 | Ga0070706_1000665532 | 220 |
| 132 | 3300005530 | Ga0070679_100623925 | Ga0070679_1006239252 | 220 |
| 133 | 3300005535 | Ga0070684_100404476 | Ga0070684_1004044762 | 220 |
| 134 | 3300005536 | Ga0070697_100123212 | Ga0070697_1001232122 | 220 |
| 135 | 3300005546 | Ga0070696_100196034 | Ga0070696_1001960342 | 220 |
| 136 | 3300005563 | Ga0068855_100046101 | Ga0068855_1000461013 | 220 |
| 137 | 3300005563 | Ga0068855_100557392 | Ga0068855_1005573921 | 220 |
| 138 | 3300005614 | Ga0068856_100101919 | Ga0068856_1001019192 | 220 |
| 139 | 3300005614 | Ga0068856_100297647 | Ga0068856_1002976472 | 220 |
| 140 | 3300005937 | Ga0081455_10153197 | Ga0081455_101531972 | 220 |
| 141 | 3300006028 | Ga0070717_10191977 | Ga0070717_101919772 | 220 |
| 142 | 3300009093 | Ga0105240_10085401 | Ga0105240_100854014 | 220 |
| 143 | 3300013105 | Ga0157369_10657369 | Ga0157369_106573692 | 220 |
| 144 | 3300020082 | Ga0206353_10081752 | Ga0206353_100817522 | 220 |
| 145 | 3300020082 | Ga0206353_11894553 | Ga0206353_118945532 | 220 |
| 146 | 3300025906 | Ga0207699_10108698 | Ga0207699_101086982 | 220 |
| 147 | 3300025906 | Ga0207699_10413201 | Ga0207699_104132012 | 220 |
| 148 | 3300025909 | Ga0207705_10159631 | Ga0207705_101596312 | 220 |
| 149 | 3300025910 | Ga0207684_10274541 | Ga0207684_102745412 | 220 |
| 150 | 3300025913 | Ga0207695_10071188 | Ga0207695_100711882 | 220 |
| 151 | 3300025921 | Ga0207652_10823889 | Ga0207652_108238891 | 220 |
| 152 | 3300025928 | Ga0207700_10000004 | Ga0207700_10000004331 | 220 |
| 153 | 3300025928 | Ga0207700_10571359 | Ga0207700_105713591 | 220 |
| 154 | 3300025929 | Ga0207664_10157991 | Ga0207664_101579912 | 220 |
| 155 | 3300025939 | Ga0207665_10107182 | Ga0207665_101071822 | 220 |
| 156 | 3300025939 | Ga0207665_10518071 | Ga0207665_105180711 | 220 |
| 157 | 3300025949 | Ga0207667_10509419 | Ga0207667_105094192 | 220 |
| 158 | 3300025972 | Ga0207668_10974512 | Ga0207668_109745121 | 220 |
| 159 | 3300026078 | Ga0207702_10076814 | Ga0207702_100768142 | 220 |
| 160 | 3300026078 | Ga0207702_10306057 | Ga0207702_103060572 | 220 |
| 161 | 3300028563 | Ga0265319_1001496 | Ga0265319_10014962 | 220 |
| 162 | 3300028573 | Ga0265334_10066750 | Ga0265334_100667501 | 220 |
| 163 | 3300028577 | Ga0265318_10009230 | Ga0265318_100092301 | 220 |
| 164 | 3300028666 | Ga0265336_10102088 | Ga0265336_101020882 | 220 |
| 165 | 3300028800 | Ga0265338_10010581 | Ga0265338_1001058111 | 220 |
| 166 | 3300028800 | Ga0265338_10174604 | Ga0265338_101746041 | 220 |
| 167 | 3300031240 | Ga0265320_10010382 | Ga0265320_100103822 | 220 |
| 168 | 3300031241 | Ga0265325_10027491 | Ga0265325_100274912 | 220 |
| 169 | 3300031247 | Ga0265340_10040042 | Ga0265340_100400422 | 220 |
| 170 | 3300031247 | Ga0265340_10104865 | Ga0265340_101048652 | 220 |
| 171 | 3300031249 | Ga0265339_10073395 | Ga0265339_100733952 | 220 |
| 172 | 3300031344 | Ga0265316_10026314 | Ga0265316_100263144 | 220 |
| 173 | 3300031711 | Ga0265314_10047279 | Ga0265314_100472794 | 220 |
| 174 | 3300031712 | Ga0265342_10011149 | Ga0265342_100111496 | 220 |
| 175 | 3300037312 | Ga0395899_0053674 | Ga0395899_0053674_1310_1975 | 220 |
| 176 | 3300037418 | Ga0395900_0232418 | Ga0395900_0232418_367_1029 | 220 |
| 177 | 3300038443 | Ga0395901_0194519 | Ga0395901_0194519_371_1096 | 220 |
| 178 | 3300041459 | Ga0451800_1023831 | Ga0451800_1023831_844_1506 | 220 |
| 179 | 3300041460 | Ga0451802_0814534 | Ga0451802_0814534_365_1027 | 220 |
| 180 | 3300041512 | Ga0451853_1678816 | Ga0451853_1678816_1567_2229 | 220 |
| 181 | 3300044656 | Ga0466969_0090382 | Ga0466969_0090382_319_984 | 220 |
| 182 | 3300044684 | Ga0466966_0142844 | Ga0466966_0142844_304_969 | 220 |
| 183 | 3300044693 | Ga0466961_0039873 | Ga0466961_0039873_1229_1891 | 220 |
| 184 | 3300044694 | Ga0466963_0004743 | Ga0466963_0004743_223_885 | 220 |
| 185 | 3300044694 | Ga0466963_0007397 | Ga0466963_0007397_4027_4689 | 220 |
| 186 | 3300044694 | Ga0466963_0022485 | Ga0466963_0022485_67_729 | 220 |
| 187 | 3300044719 | Ga0466971_0118338 | Ga0466971_0118338_409_1071 | 220 |
| 188 | 3300044842 | Ga0466957_0256935 | Ga0466957_0256935_191_853 | 220 |
| 189 | 3300045049 | Ga0466959_0252697 | Ga0466959_0252697_419_1081 | 220 |
| 190 | 3300045836 | Ga0466958_0015349 | Ga0466958_0015349_880_1542 | 220 |
| 191 | 3300045836 | Ga0466958_0028315 | Ga0466958_0028315_1457_2119 | 220 |
| 192 | 3300045976 | Ga0466967_0007306 | Ga0466967_0007306_6692_7375 | 220 |
| 193 | 3300045976 | Ga0466967_0010600 | Ga0466967_0010600_5893_6555 | 220 |
| 194 | 3300045976 | Ga0466967_0058945 | Ga0466967_0058945_2231_2893 | 220 |
| 195 | 3300045976 | Ga0466967_0083047 | Ga0466967_0083047_825_1487 | 220 |
| 196 | 3300045976 | Ga0466967_0147096 | Ga0466967_0147096_398_1063 | 220 |
| 197 | 3300046454 | Ga0495592_0008445 | Ga0495592_0008445_5330_5992 | 220 |
| 198 | 3300046459 | Ga0495629_0177491 | Ga0495629_0177491_146_808 | 220 |
| 199 | 3300046461 | Ga0495641_0066530 | Ga0495641_0066530_772_1434 | 220 |
| 200 | 3300046462 | Ga0495651_0001012 | Ga0495651_0001012_17233_17895 | 220 |
| 201 | 3300046463 | Ga0495653_0124254 | Ga0495653_0124254_39_701 | 220 |
| 202 | 3300046473 | Ga0495582_0157569 | Ga0495582_0157569_315_977 | 220 |
| 203 | 3300046476 | Ga0495662_0015377 | Ga0495662_0015377_134_796 | 220 |
| 204 | 3300046477 | Ga0495664_0007988 | Ga0495664_0007988_4342_5004 | 220 |
| 205 | 3300046511 | Ga0495608_0018469 | Ga0495608_0018469_2332_2994 | 220 |
| 206 | 3300046514 | Ga0495618_0018284 | Ga0495618_0018284_3006_3668 | 220 |
| 207 | 3300046516 | Ga0495628_0066449 | Ga0495628_0066449_763_1425 | 220 |
| 208 | 3300046517 | Ga0495630_0067712 | Ga0495630_0067712_301_963 | 220 |
| 209 | 3300046526 | Ga0495666_0144375 | Ga0495666_0144375_285_947 | 220 |
| 210 | 3300046529 | Ga0495652_0018727 | Ga0495652_0018727_2278_2940 | 220 |
| 211 | 3300046533 | Ga0495640_0064539 | Ga0495640_0064539_145_807 | 220 |
| 212 | 3300046535 | Ga0495586_0031302 | Ga0495586_0031302_1220_1882 | 220 |
| 213 | 3300046536 | Ga0495587_0179243 | Ga0495587_0179243_158_820 | 220 |
| 214 | 3300046559 | Ga0495667_0001359 | Ga0495667_0001359_15336_15998 | 220 |
| 215 | 3300046680 | Ga0495646_0086558 | Ga0495646_0086558_722_1384 | 220 |
| 216 | 3300046689 | Ga0495613_0011331 | Ga0495613_0011331_4919_5581 | 220 |
| 217 | 3300047317 | Ga0495604_0023034 | Ga0495604_0023034_2439_3101 | 220 |
| 218 | 3300047319 | Ga0495674_0001118 | Ga0495674_0001118_9936_10598 | 220 |
| 219 | 3300047322 | Ga0495680_0005838 | Ga0495680_0005838_7717_8379 | 220 |
| 220 | 3300047322 | Ga0495680_0307152 | Ga0495680_0307152_431_1096 | 220 |
| 221 | 3300047471 | Ga0495684_0005978 | Ga0495684_0005978_7709_8371 | 220 |
| 222 | 3300048903 | Ga0496100_0791091 | Ga0496100_0791091_32_694 | 220 |
| 223 | 3300048904 | Ga0496101_0429762 | Ga0496101_0429762_61_723 | 220 |
| 224 | 3300048912 | Ga0496109_0171370 | Ga0496109_0171370_926_1588 | 220 |
| 225 | 3300048913 | Ga0496110_0073940 | Ga0496110_0073940_87_749 | 220 |
| 226 | 3300048913 | Ga0496110_0265346 | Ga0496110_0265346_336_998 | 220 |
| 227 | 3300048914 | Ga0496111_0012332 | Ga0496111_0012332_2625_3287 | 220 |
| 228 | 3300048914 | Ga0496111_0187345 | Ga0496111_0187345_647_1309 | 220 |
| 229 | 3300048915 | Ga0496112_0105244 | Ga0496112_0105244_1856_2518 | 220 |
| 230 | 3300048915 | Ga0496112_0367965 | Ga0496112_0367965_168_830 | 220 |
| 231 | 3300048916 | Ga0496113_0454619 | Ga0496113_0454619_191_853 | 220 |
| 232 | 3300049583 | Ga0501067_0001961 | Ga0501067_0001961_5011_5673 | 220 |
| 233 | 3300049585 | Ga0501069_0002930 | Ga0501069_0002930_4854_5516 | 220 |
| 234 | 3300049742 | Ga0501080_0175585 | Ga0501080_0175585_1223_1888 | 220 |
| 235 | 3300053077 | Ga0495601_0042730 | Ga0495601_0042730_2084_2746 | 220 |
| 236 | 3300053084 | Ga0495595_0129721 | Ga0495595_0129721_87_752 | 220 |
| 237 | 3300053085 | Ga0495619_0086729 | Ga0495619_0086729_1261_1923 | 220 |
| 238 | 3300053085 | Ga0495619_0600530 | Ga0495619_0600530_23_688 | 220 |
| 239 | 3300061734 | Ga0530510_0009441 | Ga0530510_0009441_1135_1797 | 220 |
| 240 | 3300005327 | Ga0070658_10012569 | Ga0070658_100125694 | 221 |
| 241 | 3300005329 | Ga0070683_100016847 | Ga0070683_1000168474 | 221 |
| 242 | 3300005336 | Ga0070680_100173474 | Ga0070680_1001734742 | 221 |
| 243 | 3300005337 | Ga0070682_100133301 | Ga0070682_1001333012 | 221 |
| 244 | 3300005337 | Ga0070682_100326510 | Ga0070682_1003265102 | 221 |
| 245 | 3300005339 | Ga0070660_100003251 | Ga0070660_1000032512 | 221 |
| 246 | 3300005344 | Ga0070661_100120135 | Ga0070661_1001201353 | 221 |
| 247 | 3300005367 | Ga0070667_100973408 | Ga0070667_1009734081 | 221 |
| 248 | 3300005434 | Ga0070709_10013958 | Ga0070709_100139582 | 221 |
| 249 | 3300005434 | Ga0070709_10268812 | Ga0070709_102688122 | 221 |
| 250 | 3300005435 | Ga0070714_100010935 | Ga0070714_1000109352 | 221 |
| 251 | 3300005435 | Ga0070714_100021402 | Ga0070714_1000214024 | 221 |
| 252 | 3300005435 | Ga0070714_100027718 | Ga0070714_1000277184 | 221 |
| 253 | 3300005435 | Ga0070714_100072759 | Ga0070714_1000727592 | 221 |
| 254 | 3300005435 | Ga0070714_100184468 | Ga0070714_1001844682 | 221 |
| 255 | 3300005435 | Ga0070714_100458373 | Ga0070714_1004583732 | 221 |
| 256 | 3300005435 | Ga0070714_100722627 | Ga0070714_1007226271 | 221 |
| 257 | 3300005435 | Ga0070714_100772534 | Ga0070714_1007725342 | 221 |
| 258 | 3300005435 | Ga0070714_101105522 | Ga0070714_1011055222 | 221 |
| 259 | 3300005436 | Ga0070713_100004631 | Ga0070713_1000046316 | 221 |
| 260 | 3300005436 | Ga0070713_100007202 | Ga0070713_1000072025 | 221 |
| 261 | 3300005436 | Ga0070713_100204957 | Ga0070713_1002049572 | 221 |
| 262 | 3300005437 | Ga0070710_10007692 | Ga0070710_100076923 | 221 |
| 263 | 3300005437 | Ga0070710_10014195 | Ga0070710_100141951 | 221 |
| 264 | 3300005437 | Ga0070710_10215953 | Ga0070710_102159531 | 221 |
| 265 | 3300005439 | Ga0070711_100019659 | Ga0070711_1000196593 | 221 |
| 266 | 3300005439 | Ga0070711_100025041 | Ga0070711_1000250415 | 221 |
| 267 | 3300005456 | Ga0070678_100249752 | Ga0070678_1002497521 | 221 |
| 268 | 3300005458 | Ga0070681_10027474 | Ga0070681_100274743 | 221 |
| 269 | 3300005458 | Ga0070681_10051432 | Ga0070681_100514322 | 221 |
| 270 | 3300005458 | Ga0070681_10225098 | Ga0070681_102250982 | 221 |
| 271 | 3300005468 | Ga0070707_100000445 | Ga0070707_10000044537 | 221 |
| 272 | 3300005471 | Ga0070698_100002087 | Ga0070698_10000208712 | 221 |
| 273 | 3300005530 | Ga0070679_100027534 | Ga0070679_1000275346 | 221 |
| 274 | 3300005530 | Ga0070679_100116390 | Ga0070679_1001163903 | 221 |
| 275 | 3300005535 | Ga0070684_100008226 | Ga0070684_1000082265 | 221 |
| 276 | 3300005536 | Ga0070697_100339058 | Ga0070697_1003390581 | 221 |
| 277 | 3300005545 | Ga0070695_100000042 | Ga0070695_10000004255 | 221 |
| 278 | 3300005546 | Ga0070696_100208902 | Ga0070696_1002089022 | 221 |
| 279 | 3300005547 | Ga0070693_100211223 | Ga0070693_1002112232 | 221 |
| 280 | 3300005549 | Ga0070704_100418484 | Ga0070704_1004184842 | 221 |
| 281 | 3300005563 | Ga0068855_100015736 | Ga0068855_1000157366 | 221 |
| 282 | 3300005564 | Ga0070664_100085262 | Ga0070664_1000852622 | 221 |
| 283 | 3300005564 | Ga0070664_100527386 | Ga0070664_1005273861 | 221 |
| 284 | 3300005614 | Ga0068856_100009230 | Ga0068856_1000092309 | 221 |
| 285 | 3300005616 | Ga0068852_100185251 | Ga0068852_1001852513 | 221 |
| 286 | 3300006028 | Ga0070717_10001383 | Ga0070717_1000138316 | 221 |
| 287 | 3300006028 | Ga0070717_10016886 | Ga0070717_100168864 | 221 |
| 288 | 3300006028 | Ga0070717_10035821 | Ga0070717_100358216 | 221 |
| 289 | 3300006163 | Ga0070715_10000206 | Ga0070715_100002066 | 221 |
| 290 | 3300006173 | Ga0070716_100001775 | Ga0070716_1000017757 | 221 |
| 291 | 3300006173 | Ga0070716_100199420 | Ga0070716_1001994202 | 221 |
| 292 | 3300006175 | Ga0070712_100008799 | Ga0070712_1000087995 | 221 |
| 293 | 3300009093 | Ga0105240_10018359 | Ga0105240_100183593 | 221 |
| 294 | 3300009093 | Ga0105240_10199100 | Ga0105240_101991003 | 221 |
| 295 | 3300009093 | Ga0105240_10364300 | Ga0105240_103643002 | 221 |
| 296 | 3300009098 | Ga0105245_10031009 | Ga0105245_100310095 | 221 |
| 297 | 3300009177 | Ga0105248_10093263 | Ga0105248_100932635 | 221 |
| 298 | 3300009545 | Ga0105237_10006254 | Ga0105237_1000625411 | 221 |
| 299 | 3300009545 | Ga0105237_10056066 | Ga0105237_100560662 | 221 |
| 300 | 3300009551 | Ga0105238_10018870 | Ga0105238_100188706 | 221 |
| 301 | 3300013104 | Ga0157370_10210891 | Ga0157370_102108912 | 221 |
| 302 | 3300013105 | Ga0157369_10003872 | Ga0157369_1000387216 | 221 |
| 303 | 3300013105 | Ga0157369_10027514 | Ga0157369_100275146 | 221 |
| 304 | 3300013296 | Ga0157374_10070638 | Ga0157374_100706384 | 221 |
| 305 | 3300013307 | Ga0157372_10034070 | Ga0157372_100340704 | 221 |
| 306 | 3300013308 | Ga0157375_10007589 | Ga0157375_100075899 | 221 |
| 307 | 3300014968 | Ga0157379_10298862 | Ga0157379_102988622 | 221 |
| 308 | 3300014969 | Ga0157376_11169032 | Ga0157376_111690321 | 221 |
| 309 | 3300020082 | Ga0206353_11535591 | Ga0206353_115355911 | 221 |
| 310 | 3300025898 | Ga0207692_10010200 | Ga0207692_100102003 | 221 |
| 311 | 3300025905 | Ga0207685_10000911 | Ga0207685_100009115 | 221 |
| 312 | 3300025905 | Ga0207685_10089670 | Ga0207685_100896702 | 221 |
| 313 | 3300025906 | Ga0207699_10007017 | Ga0207699_100070177 | 221 |
| 314 | 3300025909 | Ga0207705_10028060 | Ga0207705_100280604 | 221 |
| 315 | 3300025912 | Ga0207707_10016175 | Ga0207707_100161755 | 221 |
| 316 | 3300025912 | Ga0207707_10641990 | Ga0207707_106419902 | 221 |
| 317 | 3300025913 | Ga0207695_10087217 | Ga0207695_100872172 | 221 |
| 318 | 3300025914 | Ga0207671_10048740 | Ga0207671_100487405 | 221 |
| 319 | 3300025915 | Ga0207693_10006828 | Ga0207693_100068283 | 221 |
| 320 | 3300025915 | Ga0207693_10012766 | Ga0207693_100127668 | 221 |
| 321 | 3300025916 | Ga0207663_10013810 | Ga0207663_100138101 | 221 |
| 322 | 3300025916 | Ga0207663_10059772 | Ga0207663_100597723 | 221 |
| 323 | 3300025917 | Ga0207660_10272134 | Ga0207660_102721342 | 221 |
| 324 | 3300025917 | Ga0207660_10515235 | Ga0207660_105152352 | 221 |
| 325 | 3300025919 | Ga0207657_10019430 | Ga0207657_100194307 | 221 |
| 326 | 3300025921 | Ga0207652_10040281 | Ga0207652_100402812 | 221 |
| 327 | 3300025921 | Ga0207652_10180165 | Ga0207652_101801652 | 221 |
| 328 | 3300025922 | Ga0207646_10001908 | Ga0207646_100019084 | 221 |
| 329 | 3300025928 | Ga0207700_10087748 | Ga0207700_100877481 | 221 |
| 330 | 3300025928 | Ga0207700_10100098 | Ga0207700_101000982 | 221 |
| 331 | 3300025929 | Ga0207664_10004541 | Ga0207664_1000454111 | 221 |
| 332 | 3300025929 | Ga0207664_10025574 | Ga0207664_100255744 | 221 |
| 333 | 3300025929 | Ga0207664_10029464 | Ga0207664_100294643 | 221 |
| 334 | 3300025929 | Ga0207664_10545137 | Ga0207664_105451372 | 221 |
| 335 | 3300025929 | Ga0207664_10575730 | Ga0207664_105757302 | 221 |
| 336 | 3300025939 | Ga0207665_10001018 | Ga0207665_1000101816 | 221 |
| 337 | 3300025939 | Ga0207665_10108622 | Ga0207665_101086221 | 221 |
| 338 | 3300025941 | Ga0207711_10357942 | Ga0207711_103579422 | 221 |
| 339 | 3300025944 | Ga0207661_10021891 | Ga0207661_100218913 | 221 |
| 340 | 3300025945 | Ga0207679_10098434 | Ga0207679_100984342 | 221 |
| 341 | 3300026067 | Ga0207678_10348179 | Ga0207678_103481792 | 221 |
| 342 | 3300026078 | Ga0207702_10028533 | Ga0207702_100285332 | 221 |
| 343 | 3300026095 | Ga0207676_10083544 | Ga0207676_100835444 | 221 |
| 344 | 3300028379 | Ga0268266_10494191 | Ga0268266_104941912 | 221 |
| 345 | 3300028573 | Ga0265334_10053732 | Ga0265334_100537322 | 221 |
| 346 | 3300028800 | Ga0265338_10002292 | Ga0265338_1000229220 | 221 |
| 347 | 3300028800 | Ga0265338_10348840 | Ga0265338_103488402 | 221 |
| 348 | 3300031238 | Ga0265332_10031014 | Ga0265332_100310142 | 221 |
| 349 | 3300032126 | Ga0307415_101188908 | Ga0307415_1011889081 | 221 |
| 350 | 3300035083 | Ga0373926_0044449 | Ga0373926_0044449_34_699 | 221 |
| 351 | 3300035086 | Ga0373934_0081066 | Ga0373934_0081066_622_1287 | 221 |
| 352 | 3300035091 | Ga0373951_0126699 | Ga0373951_0126699_11_676 | 221 |
| 353 | 3300035117 | Ga0373953_0089999 | Ga0373953_0089999_299_964 | 221 |
| 354 | 3300035119 | Ga0373956_0016534 | Ga0373956_0016534_1644_2309 | 221 |
| 355 | 3300035121 | Ga0373960_0061586 | Ga0373960_0061586_265_930 | 221 |
| 356 | 3300035170 | Ga0373943_0008619 | Ga0373943_0008619_542_1207 | 221 |
| 357 | 3300035171 | Ga0373946_0013615 | Ga0373946_0013615_26_691 | 221 |
| 358 | 3300035172 | Ga0373955_0097376 | Ga0373955_0097376_123_788 | 221 |
| 359 | 3300035172 | Ga0373955_0144301 | Ga0373955_0144301_497_1234 | 221 |
| 360 | 3300035242 | Ga0373962_0144100 | Ga0373962_0144100_79_744 | 221 |
| 361 | 3300035691 | Ga0373931_0015316 | Ga0373931_0015316_50_715 | 221 |
| 362 | 3300035724 | Ga0373933_0077820 | Ga0373933_0077820_554_1219 | 221 |
| 363 | 3300035724 | Ga0373933_0115994 | Ga0373933_0115994_554_1219 | 221 |
| 364 | 3300035724 | Ga0373933_0271731 | Ga0373933_0271731_391_1056 | 221 |
| 365 | 3300035725 | Ga0373947_0004256 | Ga0373947_0004256_1335_2000 | 221 |
| 366 | 3300036401 | Ga0373937_0000308 | Ga0373937_0000308_26532_27197 | 221 |
| 367 | 3300036401 | Ga0373937_0193882 | Ga0373937_0193882_295_960 | 221 |
| 368 | 3300037068 | Ga0373925_0001399 | Ga0373925_0001399_15745_16410 | 221 |
| 369 | 3300037312 | Ga0395899_0020630 | Ga0395899_0020630_3492_4157 | 221 |
| 370 | 3300037312 | Ga0395899_0344519 | Ga0395899_0344519_118_783 | 221 |
| 371 | 3300037418 | Ga0395900_0016514 | Ga0395900_0016514_387_1052 | 221 |
| 372 | 3300037418 | Ga0395900_0356731 | Ga0395900_0356731_263_928 | 221 |
| 373 | 3300037466 | Ga0395898_0012929 | Ga0395898_0012929_7102_7767 | 221 |
| 374 | 3300037466 | Ga0395898_0205818 | Ga0395898_0205818_1043_1708 | 221 |
| 375 | 3300037466 | Ga0395898_0487976 | Ga0395898_0487976_338_1003 | 221 |
| 376 | 3300038443 | Ga0395901_0171908 | Ga0395901_0171908_774_1439 | 221 |
| 377 | 3300044656 | Ga0466969_0002282 | Ga0466969_0002282_4301_4966 | 221 |
| 378 | 3300044656 | Ga0466969_0031409 | Ga0466969_0031409_808_1473 | 221 |
| 379 | 3300044683 | Ga0466965_0047128 | Ga0466965_0047128_539_1204 | 221 |
| 380 | 3300044683 | Ga0466965_0105291 | Ga0466965_0105291_134_799 | 221 |
| 381 | 3300044684 | Ga0466966_0008290 | Ga0466966_0008290_3953_4618 | 221 |
| 382 | 3300044684 | Ga0466966_0018620 | Ga0466966_0018620_3682_4347 | 221 |
| 383 | 3300044684 | Ga0466966_0023443 | Ga0466966_0023443_1023_1688 | 221 |
| 384 | 3300044684 | Ga0466966_0034276 | Ga0466966_0034276_1282_1947 | 221 |
| 385 | 3300044684 | Ga0466966_0072802 | Ga0466966_0072802_557_1222 | 221 |
| 386 | 3300044693 | Ga0466961_0006444 | Ga0466961_0006444_2777_3442 | 221 |
| 387 | 3300044693 | Ga0466961_0031517 | Ga0466961_0031517_1872_2537 | 221 |
| 388 | 3300044693 | Ga0466961_0032800 | Ga0466961_0032800_1924_2589 | 221 |
| 389 | 3300044693 | Ga0466961_0047611 | Ga0466961_0047611_669_1334 | 221 |
| 390 | 3300044693 | Ga0466961_0048517 | Ga0466961_0048517_850_1533 | 221 |
| 391 | 3300044693 | Ga0466961_0109552 | Ga0466961_0109552_362_1027 | 221 |
| 392 | 3300044693 | Ga0466961_0112539 | Ga0466961_0112539_909_1574 | 221 |
| 393 | 3300044693 | Ga0466961_0124934 | Ga0466961_0124934_881_1546 | 221 |
| 394 | 3300044694 | Ga0466963_0000063 | Ga0466963_0000063_16218_16883 | 221 |
| 395 | 3300044694 | Ga0466963_0000532 | Ga0466963_0000532_4303_4968 | 221 |
| 396 | 3300044694 | Ga0466963_0001170 | Ga0466963_0001170_5843_6508 | 221 |
| 397 | 3300044694 | Ga0466963_0001668 | Ga0466963_0001668_1617_2282 | 221 |
| 398 | 3300044694 | Ga0466963_0003131 | Ga0466963_0003131_6878_7543 | 221 |
| 399 | 3300044694 | Ga0466963_0003410 | Ga0466963_0003410_4252_4917 | 221 |
| 400 | 3300044694 | Ga0466963_0004571 | Ga0466963_0004571_3855_4568 | 221 |
| 401 | 3300044694 | Ga0466963_0012078 | Ga0466963_0012078_2075_2740 | 221 |
| 402 | 3300044694 | Ga0466963_0018497 | Ga0466963_0018497_1545_2210 | 221 |
| 403 | 3300044694 | Ga0466963_0018591 | Ga0466963_0018591_1567_2232 | 221 |
| 404 | 3300044694 | Ga0466963_0061136 | Ga0466963_0061136_905_1570 | 221 |
| 405 | 3300044694 | Ga0466963_0084005 | Ga0466963_0084005_1222_1887 | 221 |
| 406 | 3300044694 | Ga0466963_0147766 | Ga0466963_0147766_297_962 | 221 |
| 407 | 3300044694 | Ga0466963_0154628 | Ga0466963_0154628_145_810 | 221 |
| 408 | 3300044694 | Ga0466963_0210251 | Ga0466963_0210251_185_850 | 221 |
| 409 | 3300044706 | Ga0466964_0005060 | Ga0466964_0005060_4125_4790 | 221 |
| 410 | 3300044706 | Ga0466964_0010435 | Ga0466964_0010435_899_1564 | 221 |
| 411 | 3300044706 | Ga0466964_0014073 | Ga0466964_0014073_1585_2250 | 221 |
| 412 | 3300044706 | Ga0466964_0016028 | Ga0466964_0016028_1650_2315 | 221 |
| 413 | 3300044706 | Ga0466964_0061897 | Ga0466964_0061897_315_980 | 221 |
| 414 | 3300044706 | Ga0466964_0071411 | Ga0466964_0071411_412_1077 | 221 |
| 415 | 3300044706 | Ga0466964_0181266 | Ga0466964_0181266_56_721 | 221 |
| 416 | 3300044719 | Ga0466971_0000840 | Ga0466971_0000840_3516_4181 | 221 |
| 417 | 3300044719 | Ga0466971_0003605 | Ga0466971_0003605_3030_3695 | 221 |
| 418 | 3300044719 | Ga0466971_0009517 | Ga0466971_0009517_274_939 | 221 |
| 419 | 3300044719 | Ga0466971_0023522 | Ga0466971_0023522_1328_1993 | 221 |
| 420 | 3300044719 | Ga0466971_0085144 | Ga0466971_0085144_420_1085 | 221 |
| 421 | 3300044719 | Ga0466971_0108675 | Ga0466971_0108675_81_746 | 221 |
| 422 | 3300044735 | Ga0466968_0000944 | Ga0466968_0000944_5077_5742 | 221 |
| 423 | 3300044735 | Ga0466968_0009575 | Ga0466968_0009575_931_1596 | 221 |
| 424 | 3300044735 | Ga0466968_0018611 | Ga0466968_0018611_783_1505 | 221 |
| 425 | 3300044735 | Ga0466968_0043696 | Ga0466968_0043696_464_1129 | 221 |
| 426 | 3300044735 | Ga0466968_0056623 | Ga0466968_0056623_359_1024 | 221 |
| 427 | 3300044735 | Ga0466968_0068640 | Ga0466968_0068640_833_1498 | 221 |
| 428 | 3300044765 | Ga0466970_0054110 | Ga0466970_0054110_1342_2007 | 221 |
| 429 | 3300044765 | Ga0466970_0126007 | Ga0466970_0126007_230_895 | 221 |
| 430 | 3300044765 | Ga0466970_0231341 | Ga0466970_0231341_260_925 | 221 |
| 431 | 3300044842 | Ga0466957_0001577 | Ga0466957_0001577_10722_11387 | 221 |
| 432 | 3300044842 | Ga0466957_0002652 | Ga0466957_0002652_2303_2968 | 221 |
| 433 | 3300044842 | Ga0466957_0004191 | Ga0466957_0004191_218_883 | 221 |
| 434 | 3300044842 | Ga0466957_0004835 | Ga0466957_0004835_5302_5967 | 221 |
| 435 | 3300044842 | Ga0466957_0007463 | Ga0466957_0007463_3375_4040 | 221 |
| 436 | 3300044842 | Ga0466957_0013568 | Ga0466957_0013568_2445_3170 | 221 |
| 437 | 3300044842 | Ga0466957_0015401 | Ga0466957_0015401_38_703 | 221 |
| 438 | 3300044842 | Ga0466957_0066509 | Ga0466957_0066509_860_1525 | 221 |
| 439 | 3300044842 | Ga0466957_0067764 | Ga0466957_0067764_1310_1975 | 221 |
| 440 | 3300044842 | Ga0466957_0323344 | Ga0466957_0323344_50_715 | 221 |
| 441 | 3300044901 | Ga0466960_0015030 | Ga0466960_0015030_2548_3213 | 221 |
| 442 | 3300044901 | Ga0466960_0154748 | Ga0466960_0154748_145_810 | 221 |
| 443 | 3300045049 | Ga0466959_0007814 | Ga0466959_0007814_894_1559 | 221 |
| 444 | 3300045049 | Ga0466959_0010769 | Ga0466959_0010769_2733_3398 | 221 |
| 445 | 3300045049 | Ga0466959_0021405 | Ga0466959_0021405_2242_2907 | 221 |
| 446 | 3300045049 | Ga0466959_0031708 | Ga0466959_0031708_3082_3765 | 221 |
| 447 | 3300045049 | Ga0466959_0063445 | Ga0466959_0063445_1622_2287 | 221 |
| 448 | 3300045049 | Ga0466959_0076233 | Ga0466959_0076233_948_1613 | 221 |
| 449 | 3300045049 | Ga0466959_0151383 | Ga0466959_0151383_900_1565 | 221 |
| 450 | 3300045836 | Ga0466958_0001030 | Ga0466958_0001030_914_1579 | 221 |
| 451 | 3300045836 | Ga0466958_0001870 | Ga0466958_0001870_854_1519 | 221 |
| 452 | 3300045836 | Ga0466958_0008049 | Ga0466958_0008049_377_1042 | 221 |
| 453 | 3300045836 | Ga0466958_0015206 | Ga0466958_0015206_3451_4116 | 221 |
| 454 | 3300045836 | Ga0466958_0017512 | Ga0466958_0017512_628_1293 | 221 |
| 455 | 3300045836 | Ga0466958_0021892 | Ga0466958_0021892_593_1258 | 221 |
| 456 | 3300045836 | Ga0466958_0043820 | Ga0466958_0043820_429_1154 | 221 |
| 457 | 3300045836 | Ga0466958_0071955 | Ga0466958_0071955_867_1532 | 221 |
| 458 | 3300045836 | Ga0466958_0305958 | Ga0466958_0305958_19_684 | 221 |
| 459 | 3300045976 | Ga0466967_0000058 | Ga0466967_0000058_12919_13584 | 221 |
| 460 | 3300045976 | Ga0466967_0005902 | Ga0466967_0005902_2396_3061 | 221 |
| 461 | 3300045976 | Ga0466967_0011156 | Ga0466967_0011156_5670_6335 | 221 |
| 462 | 3300045976 | Ga0466967_0018957 | Ga0466967_0018957_4389_5114 | 221 |
| 463 | 3300045976 | Ga0466967_0039152 | Ga0466967_0039152_1662_2327 | 221 |
| 464 | 3300045976 | Ga0466967_0039367 | Ga0466967_0039367_2198_2863 | 221 |
| 465 | 3300045976 | Ga0466967_0067806 | Ga0466967_0067806_1088_1753 | 221 |
| 466 | 3300045976 | Ga0466967_0068222 | Ga0466967_0068222_1795_2460 | 221 |
| 467 | 3300045976 | Ga0466967_0068774 | Ga0466967_0068774_2462_3127 | 221 |
| 468 | 3300045976 | Ga0466967_0085431 | Ga0466967_0085431_1356_2021 | 221 |
| 469 | 3300045976 | Ga0466967_0138683 | Ga0466967_0138683_1413_2078 | 221 |
| 470 | 3300045976 | Ga0466967_0140998 | Ga0466967_0140998_1426_2091 | 221 |
| 471 | 3300045976 | Ga0466967_0158044 | Ga0466967_0158044_987_1652 | 221 |
| 472 | 3300045976 | Ga0466967_0175536 | Ga0466967_0175536_657_1322 | 221 |
| 473 | 3300045976 | Ga0466967_0214732 | Ga0466967_0214732_575_1282 | 221 |
| 474 | 3300045976 | Ga0466967_0298546 | Ga0466967_0298546_124_789 | 221 |
| 475 | 3300045976 | Ga0466967_0644371 | Ga0466967_0644371_74_739 | 221 |
| 476 | 3300045976 | Ga0466967_0819592 | Ga0466967_0819592_70_738 | 221 |
| 477 | 3300046454 | Ga0495592_0000410 | Ga0495592_0000410_14570_15235 | 221 |
| 478 | 3300046454 | Ga0495592_0004998 | Ga0495592_0004998_4256_4975 | 221 |
| 479 | 3300046454 | Ga0495592_0027012 | Ga0495592_0027012_2566_3231 | 221 |
| 480 | 3300046454 | Ga0495592_0351882 | Ga0495592_0351882_121_786 | 221 |
| 481 | 3300046455 | Ga0495603_0025944 | Ga0495603_0025944_2280_2945 | 221 |
| 482 | 3300046459 | Ga0495629_0082168 | Ga0495629_0082168_245_910 | 221 |
| 483 | 3300046459 | Ga0495629_0191436 | Ga0495629_0191436_95_760 | 221 |
| 484 | 3300046459 | Ga0495629_0361411 | Ga0495629_0361411_239_904 | 221 |
| 485 | 3300046461 | Ga0495641_0023968 | Ga0495641_0023968_1983_2648 | 221 |
| 486 | 3300046462 | Ga0495651_0000034 | Ga0495651_0000034_41514_42179 | 221 |
| 487 | 3300046462 | Ga0495651_0001663 | Ga0495651_0001663_2750_3469 | 221 |
| 488 | 3300046462 | Ga0495651_0091036 | Ga0495651_0091036_957_1622 | 221 |
| 489 | 3300046462 | Ga0495651_0106335 | Ga0495651_0106335_1344_2009 | 221 |
| 490 | 3300046463 | Ga0495653_0027281 | Ga0495653_0027281_2153_2818 | 221 |
| 491 | 3300046463 | Ga0495653_0034260 | Ga0495653_0034260_1079_1744 | 221 |
| 492 | 3300046463 | Ga0495653_0034515 | Ga0495653_0034515_538_1203 | 221 |
| 493 | 3300046463 | Ga0495653_0056787 | Ga0495653_0056787_382_1047 | 221 |
| 494 | 3300046472 | Ga0495580_0025275 | Ga0495580_0025275_3247_3912 | 221 |
| 495 | 3300046472 | Ga0495580_0084445 | Ga0495580_0084445_506_1171 | 221 |
| 496 | 3300046473 | Ga0495582_0010406 | Ga0495582_0010406_829_1494 | 221 |
| 497 | 3300046473 | Ga0495582_0015104 | Ga0495582_0015104_3250_3915 | 221 |
| 498 | 3300046474 | Ga0495605_0128346 | Ga0495605_0128346_166_831 | 221 |
| 499 | 3300046475 | Ga0495639_0004561 | Ga0495639_0004561_1769_2434 | 221 |
| 500 | 3300046476 | Ga0495662_0025982 | Ga0495662_0025982_829_1494 | 221 |
| 501 | 3300046477 | Ga0495664_0037454 | Ga0495664_0037454_1127_1792 | 221 |
| 502 | 3300046477 | Ga0495664_0047482 | Ga0495664_0047482_727_1446 | 221 |
| 503 | 3300046500 | Ga0495596_0071924 | Ga0495596_0071924_642_1307 | 221 |
| 504 | 3300046511 | Ga0495608_0000638 | Ga0495608_0000638_20825_21490 | 221 |
| 505 | 3300046511 | Ga0495608_0009815 | Ga0495608_0009815_2053_2718 | 221 |
| 506 | 3300046511 | Ga0495608_0040572 | Ga0495608_0040572_1854_2519 | 221 |
| 507 | 3300046511 | Ga0495608_0105641 | Ga0495608_0105641_547_1212 | 221 |
| 508 | 3300046511 | Ga0495608_0145303 | Ga0495608_0145303_645_1310 | 221 |
| 509 | 3300046514 | Ga0495618_0002873 | Ga0495618_0002873_9737_10402 | 221 |
| 510 | 3300046514 | Ga0495618_0005628 | Ga0495618_0005628_1824_2489 | 221 |
| 511 | 3300046514 | Ga0495618_0171924 | Ga0495618_0171924_346_1011 | 221 |
| 512 | 3300046514 | Ga0495618_0395402 | Ga0495618_0395402_50_715 | 221 |
| 513 | 3300046516 | Ga0495628_0000184 | Ga0495628_0000184_12683_13348 | 221 |
| 514 | 3300046516 | Ga0495628_0095275 | Ga0495628_0095275_431_1096 | 221 |
| 515 | 3300046516 | Ga0495628_0153783 | Ga0495628_0153783_381_1046 | 221 |
| 516 | 3300046517 | Ga0495630_0016688 | Ga0495630_0016688_4531_5196 | 221 |
| 517 | 3300046517 | Ga0495630_0124664 | Ga0495630_0124664_628_1293 | 221 |
| 518 | 3300046517 | Ga0495630_0186274 | Ga0495630_0186274_27_692 | 221 |
| 519 | 3300046526 | Ga0495666_0005883 | Ga0495666_0005883_4178_4843 | 221 |
| 520 | 3300046528 | Ga0495642_0228442 | Ga0495642_0228442_95_760 | 221 |
| 521 | 3300046529 | Ga0495652_0000319 | Ga0495652_0000319_14698_15363 | 221 |
| 522 | 3300046529 | Ga0495652_0012982 | Ga0495652_0012982_97_816 | 221 |
| 523 | 3300046529 | Ga0495652_0040512 | Ga0495652_0040512_2125_2790 | 221 |
| 524 | 3300046529 | Ga0495652_0303383 | Ga0495652_0303383_429_1094 | 221 |
| 525 | 3300046531 | Ga0495665_0003054 | Ga0495665_0003054_2125_2790 | 221 |
| 526 | 3300046533 | Ga0495640_0007089 | Ga0495640_0007089_6081_6746 | 221 |
| 527 | 3300046533 | Ga0495640_0018293 | Ga0495640_0018293_4021_4686 | 221 |
| 528 | 3300046533 | Ga0495640_0070391 | Ga0495640_0070391_371_1036 | 221 |
| 529 | 3300046535 | Ga0495586_0006570 | Ga0495586_0006570_942_1607 | 221 |
| 530 | 3300046535 | Ga0495586_0093838 | Ga0495586_0093838_856_1521 | 221 |
| 531 | 3300046535 | Ga0495586_0166511 | Ga0495586_0166511_11_676 | 221 |
| 532 | 3300046536 | Ga0495587_0000055 | Ga0495587_0000055_2266_2931 | 221 |
| 533 | 3300046536 | Ga0495587_0002592 | Ga0495587_0002592_4907_5626 | 221 |
| 534 | 3300046538 | Ga0495609_0132281 | Ga0495609_0132281_104_769 | 221 |
| 535 | 3300046543 | Ga0495645_0000170 | Ga0495645_0000170_17518_18183 | 221 |
| 536 | 3300046543 | Ga0495645_0040286 | Ga0495645_0040286_279_998 | 221 |
| 537 | 3300046559 | Ga0495667_0024084 | Ga0495667_0024084_1662_2327 | 221 |
| 538 | 3300046559 | Ga0495667_0030639 | Ga0495667_0030639_737_1456 | 221 |
| 539 | 3300046559 | Ga0495667_0036127 | Ga0495667_0036127_1682_2347 | 221 |
| 540 | 3300046559 | Ga0495667_0456729 | Ga0495667_0456729_12_677 | 221 |
| 541 | 3300046615 | Ga0495656_0014707 | Ga0495656_0014707_1941_2606 | 221 |
| 542 | 3300046615 | Ga0495656_0100521 | Ga0495656_0100521_161_826 | 221 |
| 543 | 3300046642 | Ga0495634_0024046 | Ga0495634_0024046_3490_4155 | 221 |
| 544 | 3300046642 | Ga0495634_0034030 | Ga0495634_0034030_628_1293 | 221 |
| 545 | 3300046642 | Ga0495634_0101062 | Ga0495634_0101062_17_682 | 221 |
| 546 | 3300046642 | Ga0495634_0178773 | Ga0495634_0178773_16_681 | 221 |
| 547 | 3300046642 | Ga0495634_0195754 | Ga0495634_0195754_404_1069 | 221 |
| 548 | 3300046663 | Ga0495635_0005146 | Ga0495635_0005146_2534_3199 | 221 |
| 549 | 3300046663 | Ga0495635_0026307 | Ga0495635_0026307_298_963 | 221 |
| 550 | 3300046663 | Ga0495635_0075977 | Ga0495635_0075977_129_794 | 221 |
| 551 | 3300046663 | Ga0495635_0185457 | Ga0495635_0185457_44_763 | 221 |
| 552 | 3300046674 | Ga0495588_0212725 | Ga0495588_0212725_175_840 | 221 |
| 553 | 3300046675 | Ga0495657_0008362 | Ga0495657_0008362_3130_3795 | 221 |
| 554 | 3300046675 | Ga0495657_0026041 | Ga0495657_0026041_1974_2639 | 221 |
| 555 | 3300046675 | Ga0495657_0028353 | Ga0495657_0028353_2634_3353 | 221 |
| 556 | 3300046675 | Ga0495657_0055604 | Ga0495657_0055604_789_1454 | 221 |
| 557 | 3300046675 | Ga0495657_0075310 | Ga0495657_0075310_780_1445 | 221 |
| 558 | 3300046675 | Ga0495657_0088258 | Ga0495657_0088258_548_1213 | 221 |
| 559 | 3300046678 | Ga0495599_0000227 | Ga0495599_0000227_34863_35528 | 221 |
| 560 | 3300046678 | Ga0495599_0075134 | Ga0495599_0075134_133_798 | 221 |
| 561 | 3300046678 | Ga0495599_0487806 | Ga0495599_0487806_46_711 | 221 |
| 562 | 3300046679 | Ga0495623_0000149 | Ga0495623_0000149_32840_33505 | 221 |
| 563 | 3300046679 | Ga0495623_0024677 | Ga0495623_0024677_186_905 | 221 |
| 564 | 3300046680 | Ga0495646_0008095 | Ga0495646_0008095_511_1176 | 221 |
| 565 | 3300046680 | Ga0495646_0059895 | Ga0495646_0059895_165_884 | 221 |
| 566 | 3300046681 | Ga0495647_0003022 | Ga0495647_0003022_2205_2870 | 221 |
| 567 | 3300046681 | Ga0495647_0105101 | Ga0495647_0105101_308_973 | 221 |
| 568 | 3300046683 | Ga0495658_0017571 | Ga0495658_0017571_829_1494 | 221 |
| 569 | 3300046683 | Ga0495658_0050975 | Ga0495658_0050975_713_1378 | 221 |
| 570 | 3300046683 | Ga0495658_0066811 | Ga0495658_0066811_842_1507 | 221 |
| 571 | 3300046689 | Ga0495613_0007620 | Ga0495613_0007620_4551_5216 | 221 |
| 572 | 3300046689 | Ga0495613_0400639 | Ga0495613_0400639_148_813 | 221 |
| 573 | 3300046690 | Ga0495624_0044075 | Ga0495624_0044075_1335_2000 | 221 |
| 574 | 3300046690 | Ga0495624_0068338 | Ga0495624_0068338_1031_1696 | 221 |
| 575 | 3300046690 | Ga0495624_0181478 | Ga0495624_0181478_238_903 | 221 |
| 576 | 3300046691 | Ga0495670_0135443 | Ga0495670_0135443_112_777 | 221 |
| 577 | 3300046809 | Ga0495600_0061743 | Ga0495600_0061743_1059_1724 | 221 |
| 578 | 3300046809 | Ga0495600_0138290 | Ga0495600_0138290_398_1063 | 221 |
| 579 | 3300046809 | Ga0495600_0161643 | Ga0495600_0161643_45_764 | 221 |
| 580 | 3300046809 | Ga0495600_0177910 | Ga0495600_0177910_137_802 | 221 |
| 581 | 3300047315 | Ga0495581_0000841 | Ga0495581_0000841_14356_15021 | 221 |
| 582 | 3300047315 | Ga0495581_0021505 | Ga0495581_0021505_953_1618 | 221 |
| 583 | 3300047315 | Ga0495581_0216160 | Ga0495581_0216160_295_960 | 221 |
| 584 | 3300047317 | Ga0495604_0000194 | Ga0495604_0000194_41458_42123 | 221 |
| 585 | 3300047317 | Ga0495604_0022634 | Ga0495604_0022634_298_963 | 221 |
| 586 | 3300047318 | Ga0495636_0135668 | Ga0495636_0135668_131_796 | 221 |
| 587 | 3300047319 | Ga0495674_0019031 | Ga0495674_0019031_2158_2823 | 221 |
| 588 | 3300047319 | Ga0495674_0024937 | Ga0495674_0024937_1590_2255 | 221 |
| 589 | 3300047319 | Ga0495674_0105138 | Ga0495674_0105138_946_1665 | 221 |
| 590 | 3300047319 | Ga0495674_0211448 | Ga0495674_0211448_349_1014 | 221 |
| 591 | 3300047321 | Ga0495676_0038375 | Ga0495676_0038375_372_1037 | 221 |
| 592 | 3300047321 | Ga0495676_0114233 | Ga0495676_0114233_234_899 | 221 |
| 593 | 3300047321 | Ga0495676_0143234 | Ga0495676_0143234_217_882 | 221 |
| 594 | 3300047321 | Ga0495676_0330414 | Ga0495676_0330414_137_802 | 221 |
| 595 | 3300047322 | Ga0495680_0001661 | Ga0495680_0001661_16060_16725 | 221 |
| 596 | 3300047322 | Ga0495680_0027260 | Ga0495680_0027260_2296_3015 | 221 |
| 597 | 3300047322 | Ga0495680_0056570 | Ga0495680_0056570_932_1597 | 221 |
| 598 | 3300047322 | Ga0495680_0064483 | Ga0495680_0064483_140_805 | 221 |
| 599 | 3300047322 | Ga0495680_0075140 | Ga0495680_0075140_1069_1734 | 221 |
| 600 | 3300047322 | Ga0495680_0161960 | Ga0495680_0161960_314_979 | 221 |
| 601 | 3300047444 | Ga0495675_0000029 | Ga0495675_0000029_822_1487 | 221 |
| 602 | 3300047444 | Ga0495675_0023279 | Ga0495675_0023279_2383_3102 | 221 |
| 603 | 3300047444 | Ga0495675_0256667 | Ga0495675_0256667_346_1011 | 221 |
| 604 | 3300047471 | Ga0495684_0010365 | Ga0495684_0010365_5274_5939 | 221 |
| 605 | 3300047471 | Ga0495684_0047784 | Ga0495684_0047784_79_744 | 221 |
| 606 | 3300047471 | Ga0495684_0060194 | Ga0495684_0060194_892_1557 | 221 |
| 607 | 3300047471 | Ga0495684_0157964 | Ga0495684_0157964_845_1564 | 221 |
| 608 | 3300047471 | Ga0495684_0324658 | Ga0495684_0324658_141_806 | 221 |
| 609 | 3300047673 | Ga0495593_0000750 | Ga0495593_0000750_17309_17974 | 221 |
| 610 | 3300048088 | Ga0495602_0000741 | Ga0495602_0000741_466_1131 | 221 |
| 611 | 3300048088 | Ga0495602_0044523 | Ga0495602_0044523_1878_2597 | 221 |
| 612 | 3300048088 | Ga0495602_0077464 | Ga0495602_0077464_43_708 | 221 |
| 613 | 3300048089 | Ga0495614_0001705 | Ga0495614_0001705_6590_7255 | 221 |
| 614 | 3300048089 | Ga0495614_0108431 | Ga0495614_0108431_286_951 | 221 |
| 615 | 3300048903 | Ga0496100_0022876 | Ga0496100_0022876_3070_3735 | 221 |
| 616 | 3300048903 | Ga0496100_0081379 | Ga0496100_0081379_1023_1688 | 221 |
| 617 | 3300048904 | Ga0496101_0046600 | Ga0496101_0046600_58_723 | 221 |
| 618 | 3300048904 | Ga0496101_0147262 | Ga0496101_0147262_951_1616 | 221 |
| 619 | 3300048904 | Ga0496101_0543266 | Ga0496101_0543266_11_676 | 221 |
| 620 | 3300048905 | Ga0496102_0054721 | Ga0496102_0054721_1615_2280 | 221 |
| 621 | 3300048906 | Ga0496103_0037070 | Ga0496103_0037070_2274_2939 | 221 |
| 622 | 3300048906 | Ga0496103_0052413 | Ga0496103_0052413_407_1072 | 221 |
| 623 | 3300048907 | Ga0496104_0025508 | Ga0496104_0025508_2067_2732 | 221 |
| 624 | 3300048907 | Ga0496104_0228354 | Ga0496104_0228354_1048_1713 | 221 |
| 625 | 3300048908 | Ga0496105_0002189 | Ga0496105_0002189_5456_6121 | 221 |
| 626 | 3300048908 | Ga0496105_0046395 | Ga0496105_0046395_1138_1803 | 221 |
| 627 | 3300048909 | Ga0496106_0012986 | Ga0496106_0012986_321_986 | 221 |
| 628 | 3300048910 | Ga0496107_0152341 | Ga0496107_0152341_265_930 | 221 |
| 629 | 3300048910 | Ga0496107_0166603 | Ga0496107_0166603_890_1555 | 221 |
| 630 | 3300048911 | Ga0496108_0006809 | Ga0496108_0006809_1650_2315 | 221 |
| 631 | 3300048911 | Ga0496108_0014135 | Ga0496108_0014135_673_1362 | 221 |
| 632 | 3300048911 | Ga0496108_0030189 | Ga0496108_0030189_641_1306 | 221 |
| 633 | 3300048911 | Ga0496108_0172167 | Ga0496108_0172167_920_1585 | 221 |
| 634 | 3300048912 | Ga0496109_0004307 | Ga0496109_0004307_1627_2292 | 221 |
| 635 | 3300048912 | Ga0496109_0020876 | Ga0496109_0020876_2876_3541 | 221 |
| 636 | 3300048912 | Ga0496109_0193873 | Ga0496109_0193873_1166_1831 | 221 |
| 637 | 3300048913 | Ga0496110_0052905 | Ga0496110_0052905_2005_2670 | 221 |
| 638 | 3300048913 | Ga0496110_0237246 | Ga0496110_0237246_773_1438 | 221 |
| 639 | 3300048914 | Ga0496111_0025587 | Ga0496111_0025587_1559_2224 | 221 |
| 640 | 3300048914 | Ga0496111_0031648 | Ga0496111_0031648_218_883 | 221 |
| 641 | 3300048914 | Ga0496111_0203715 | Ga0496111_0203715_767_1456 | 221 |
| 642 | 3300048915 | Ga0496112_0068703 | Ga0496112_0068703_2296_2961 | 221 |
| 643 | 3300048915 | Ga0496112_0090106 | Ga0496112_0090106_1996_2688 | 221 |
| 644 | 3300048916 | Ga0496113_0008476 | Ga0496113_0008476_3661_4326 | 221 |
| 645 | 3300048916 | Ga0496113_0050750 | Ga0496113_0050750_1462_2151 | 221 |
| 646 | 3300048916 | Ga0496113_0059994 | Ga0496113_0059994_290_955 | 221 |
| 647 | 3300048916 | Ga0496113_0226609 | Ga0496113_0226609_569_1234 | 221 |
| 648 | 3300048917 | Ga0496114_0005225 | Ga0496114_0005225_3242_3907 | 221 |
| 649 | 3300048917 | Ga0496114_0012744 | Ga0496114_0012744_286_951 | 221 |
| 650 | 3300048917 | Ga0496114_0323000 | Ga0496114_0323000_421_1086 | 221 |
| 651 | 3300048917 | Ga0496114_0452156 | Ga0496114_0452156_140_805 | 221 |
| 652 | 3300048918 | Ga0496115_0009386 | Ga0496115_0009386_3454_4119 | 221 |
| 653 | 3300048918 | Ga0496115_0134297 | Ga0496115_0134297_114_779 | 221 |
| 654 | 3300048918 | Ga0496115_0136240 | Ga0496115_0136240_223_888 | 221 |
| 655 | 3300049580 | Ga0501046_0247857 | Ga0501046_0247857_102_767 | 221 |
| 656 | 3300049583 | Ga0501067_0011371 | Ga0501067_0011371_1121_1786 | 221 |
| 657 | 3300049585 | Ga0501069_0007840 | Ga0501069_0007840_501_1166 | 221 |
| 658 | 3300049585 | Ga0501069_0208935 | Ga0501069_0208935_16_681 | 221 |
| 659 | 3300049585 | Ga0501069_0215897 | Ga0501069_0215897_11_676 | 221 |
| 660 | 3300049588 | Ga0501072_0003796 | Ga0501072_0003796_1872_2537 | 221 |
| 661 | 3300049589 | Ga0501073_0041383 | Ga0501073_0041383_1673_2338 | 221 |
| 662 | 3300049590 | Ga0501074_0003122 | Ga0501074_0003122_9345_10010 | 221 |
| 663 | 3300049741 | Ga0501079_0185371 | Ga0501079_0185371_161_826 | 221 |
| 664 | 3300049742 | Ga0501080_0019295 | Ga0501080_0019295_2067_2732 | 221 |
| 665 | 3300049744 | Ga0501083_0000442 | Ga0501083_0000442_11117_11782 | 221 |
| 666 | 3300053077 | Ga0495601_0000082 | Ga0495601_0000082_17485_18150 | 221 |
| 667 | 3300053077 | Ga0495601_0006082 | Ga0495601_0006082_270_989 | 221 |
| 668 | 3300053077 | Ga0495601_0007828 | Ga0495601_0007828_1071_1736 | 221 |
| 669 | 3300053077 | Ga0495601_0440087 | Ga0495601_0440087_14_679 | 221 |
| 670 | 3300053078 | Ga0495612_0009834 | Ga0495612_0009834_1046_1765 | 221 |
| 671 | 3300053078 | Ga0495612_0012566 | Ga0495612_0012566_1678_2343 | 221 |
| 672 | 3300053078 | Ga0495612_0292991 | Ga0495612_0292991_51_716 | 221 |
| 673 | 3300053084 | Ga0495595_0006938 | Ga0495595_0006938_3007_3672 | 221 |
| 674 | 3300053084 | Ga0495595_0009298 | Ga0495595_0009298_1970_2689 | 221 |
| 675 | 3300053084 | Ga0495595_0014501 | Ga0495595_0014501_2015_2680 | 221 |
| 676 | 3300053084 | Ga0495595_0019068 | Ga0495595_0019068_716_1381 | 221 |
| 677 | 3300053085 | Ga0495619_0004401 | Ga0495619_0004401_2028_2693 | 221 |
| 678 | 3300053085 | Ga0495619_0023764 | Ga0495619_0023764_2640_3359 | 221 |
| 679 | 3300053085 | Ga0495619_0054388 | Ga0495619_0054388_1650_2315 | 221 |
| 680 | 3300053085 | Ga0495619_0059351 | Ga0495619_0059351_1834_2499 | 221 |
| 681 | 3300053085 | Ga0495619_0200484 | Ga0495619_0200484_84_749 | 221 |
| 682 | 3300053085 | Ga0495619_0351819 | Ga0495619_0351819_195_860 | 221 |
| 683 | 3300054114 | Ga0501084_0170305 | Ga0501084_0170305_39_704 | 221 |
| 684 | 3300060353 | Ga0501082_0189722 | Ga0501082_0189722_1054_1719 | 221 |
| 685 | 3300061719 | Ga0466962_0000979 | Ga0466962_0000979_10278_10943 | 221 |
| 686 | 3300061719 | Ga0466962_0001028 | Ga0466962_0001028_2949_3614 | 221 |
| 687 | 3300061719 | Ga0466962_0005923 | Ga0466962_0005923_4664_5329 | 221 |
| 688 | 3300061719 | Ga0466962_0025537 | Ga0466962_0025537_548_1213 | 221 |
| 689 | 3300061719 | Ga0466962_0088428 | Ga0466962_0088428_330_995 | 221 |
| 690 | 3300061719 | Ga0466962_0091444 | Ga0466962_0091444_766_1431 | 221 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6is2-assembly1.cif.gz_A | crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg | 0.9901 | 2 | 117 |
| 1zh4-assembly1.cif.gz_A | crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe | 0.984 | 2 | 118 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9831 | 1 | 118 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9828 | 1 | 118 |
| 5hm6-assembly1.cif.gz_A | n-terminal domain of bfmr from acinetobacter baumannii | 0.9823 | 2 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9899 | 2 | 80 | 3.40.50.2300 |
| af_Q2FY79_1_81_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9891 | 2 | 80 | 3.40.50.2300 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9868 | 1 | 80 | 3.40.50.2300 |
| 5hm6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9842 | 2 | 117 | 3.40.50.2300 |
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9764 | 2 | 117 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538H6N8-F1-model_v4 | Response regulator transcription factor | 1 | 1 | 115 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7C4A519-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.9863 | 2 | 119 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |
| AF-A0A7V5N7J6-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.9855 | 2 | 119 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 |
| AF-A0A2C9ZU15-F1-model_v4 | Response regulatory domain-containing protein | 0.9846 | 1 | 120 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7V2DF89-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.9802 | 2 | 119 |
GO:0000160
GO:0003677 GO:0005524 GO:0006355 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar