F475470
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 379 | 689 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0130337|Ga0436365_0130337_455_898 |
| Length | 147 |
| Sequence | MLQGEFAMSIQAVLLPLFVEVLLTFVLLYGMAYTRTRAFRTGEVKARDVALREPNWPPHIIQIGNAYHNQLELPVLFYVLTILAWVTRHADLLFVVLAWIFVVSRLAHAYIHVTDNDVNRRGPAFGVGALVLSIMWLIFMIRILLGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 242 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 243 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 244 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 247 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 248 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 249 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 250 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 251 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 324 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 325 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 335 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0.14 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.61 |
| Nodule | 0 |
| Rhizoplane | 6.96 |
| Rhizosphere | 89.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c013089 | 3300000041 | Bacteria | 711 |
| 2 | JGI24752J21851_1011925 | 3300001976 | Bacteria | 1137 |
| 3 | JGI24750J21931_1022732 | 3300002070 | Bacteria | 887 |
| 4 | JGI24033J26618_1034978 | 3300002155 | Bacteria | 686 |
| 5 | JGI24034J26672_10006795 | 3300002239 | Bacteria | 1654 |
| 6 | JGI24742J22300_10006754 | 3300002244 | Bacteria | 1892 |
| 7 | Ga0065704_10756000 | 3300005289 | Unclassified | 540 |
| 8 | Ga0065707_10141329 | 3300005295 | Bacteria | 1768 |
| 9 | Ga0070658_10079763 | 3300005327 | Bacteria | 2688 |
| 10 | Ga0070658_10267551 | 3300005327 | Bacteria | 1453 |
| 11 | Ga0070658_10338868 | 3300005327 | Bacteria | 1286 |
| 12 | Ga0070676_10410820 | 3300005328 | Bacteria | 944 |
| 13 | Ga0070683_100089578 | 3300005329 | Bacteria | 2887 |
| 14 | Ga0070683_100713126 | 3300005329 | Bacteria | 961 |
| 15 | Ga0070683_101019127 | 3300005329 | Bacteria | 795 |
| 16 | Ga0070690_100004750 | 3300005330 | Bacteria | 7581 |
| 17 | Ga0070690_100272104 | 3300005330 | Bacteria | 1205 |
| 18 | Ga0070670_100077822 | 3300005331 | Bacteria | 2849 |
| 19 | Ga0070670_100193646 | 3300005331 | Unclassified | 1766 |
| 20 | Ga0068869_100160140 | 3300005334 | Bacteria | 1752 |
| 21 | Ga0070666_10005333 | 3300005335 | Bacteria | 7881 |
| 22 | Ga0070666_10100412 | 3300005335 | Bacteria | 1994 |
| 23 | Ga0070680_100011041 | 3300005336 | Bacteria | 6980 |
| 24 | Ga0070680_100048701 | 3300005336 | Bacteria | 3454 |
| 25 | Ga0070682_100153679 | 3300005337 | Bacteria | 1582 |
| 26 | Ga0070682_100754479 | 3300005337 | Bacteria | 786 |
| 27 | Ga0068868_100009579 | 3300005338 | Bacteria | 6982 |
| 28 | Ga0068868_100203154 | 3300005338 | Bacteria | 1653 |
| 29 | Ga0070660_100026110 | 3300005339 | Bacteria | 4347 |
| 30 | Ga0070660_100704625 | 3300005339 | Bacteria | 847 |
| 31 | Ga0070689_100326574 | 3300005340 | Bacteria | 1283 |
| 32 | Ga0070691_10060524 | 3300005341 | Bacteria | 1820 |
| 33 | Ga0070687_100001901 | 3300005343 | Bacteria | 7599 |
| 34 | Ga0070668_100147565 | 3300005347 | Bacteria | 1899 |
| 35 | Ga0070668_100516722 | 3300005347 | Bacteria | 1036 |
| 36 | Ga0070669_100018044 | 3300005353 | Bacteria | 5040 |
| 37 | Ga0070675_100073782 | 3300005354 | Bacteria | 2833 |
| 38 | Ga0070671_100013696 | 3300005355 | Bacteria | 6539 |
| 39 | Ga0070671_100111917 | 3300005355 | Bacteria | 2293 |
| 40 | Ga0070674_100216482 | 3300005356 | Bacteria | 1488 |
| 41 | Ga0070673_100055829 | 3300005364 | Bacteria | 3113 |
| 42 | Ga0070688_100005391 | 3300005365 | Bacteria | 6731 |
| 43 | Ga0070688_100025542 | 3300005365 | Bacteria | 3498 |
| 44 | Ga0070659_100202939 | 3300005366 | Bacteria | 1632 |
| 45 | Ga0070667_100015010 | 3300005367 | Bacteria | 6400 |
| 46 | Ga0070709_10011165 | 3300005434 | Bacteria | 4996 |
| 47 | Ga0070714_100051098 | 3300005435 | Bacteria | 3524 |
| 48 | Ga0070714_101522846 | 3300005435 | Unclassified | 653 |
| 49 | Ga0070713_100012585 | 3300005436 | Bacteria | 6213 |
| 50 | Ga0070710_10008108 | 3300005437 | Bacteria | 5107 |
| 51 | Ga0070710_10128963 | 3300005437 | Bacteria | 1540 |
| 52 | Ga0070701_10037248 | 3300005438 | Bacteria | 2455 |
| 53 | Ga0070701_10534913 | 3300005438 | Bacteria | 766 |
| 54 | Ga0070711_100124408 | 3300005439 | Bacteria | 1912 |
| 55 | Ga0070705_100377861 | 3300005440 | Unclassified | 1042 |
| 56 | Ga0070700_100032022 | 3300005441 | Bacteria | 3157 |
| 57 | Ga0070700_100202336 | 3300005441 | Bacteria | 1396 |
| 58 | Ga0070663_100097264 | 3300005455 | Bacteria | 2191 |
| 59 | Ga0070663_100260532 | 3300005455 | Bacteria | 1375 |
| 60 | Ga0070663_100347875 | 3300005455 | Bacteria | 1199 |
| 61 | Ga0070678_100046523 | 3300005456 | Bacteria | 3111 |
| 62 | Ga0070662_101160230 | 3300005457 | Bacteria | 663 |
| 63 | Ga0070681_10040444 | 3300005458 | Bacteria | 4671 |
| 64 | Ga0070681_10406289 | 3300005458 | Bacteria | 1273 |
| 65 | Ga0070681_10539591 | 3300005458 | Bacteria | 1080 |
| 66 | Ga0070681_10700047 | 3300005458 | Bacteria | 929 |
| 67 | Ga0070681_10798478 | 3300005458 | Bacteria | 861 |
| 68 | Ga0068867_100158454 | 3300005459 | Bacteria | 1783 |
| 69 | Ga0068867_100418996 | 3300005459 | Bacteria | 1134 |
| 70 | Ga0070685_10009588 | 3300005466 | Bacteria | 5007 |
| 71 | Ga0070685_10244574 | 3300005466 | Bacteria | 1186 |
| 72 | Ga0070698_101832010 | 3300005471 | Unclassified | 560 |
| 73 | Ga0070679_100082606 | 3300005530 | Bacteria | 3202 |
| 74 | Ga0070679_100252520 | 3300005530 | Bacteria | 1719 |
| 75 | Ga0070679_100277019 | 3300005530 | Bacteria | 1630 |
| 76 | Ga0070679_100564379 | 3300005530 | Bacteria | 1082 |
| 77 | Ga0070684_100311377 | 3300005535 | Bacteria | 1446 |
| 78 | Ga0068853_100328557 | 3300005539 | Bacteria | 1419 |
| 79 | Ga0068853_100418783 | 3300005539 | Bacteria | 1256 |
| 80 | Ga0070686_100021647 | 3300005544 | Bacteria | 3827 |
| 81 | Ga0070686_100047753 | 3300005544 | Bacteria | 2708 |
| 82 | Ga0070696_100309883 | 3300005546 | Bacteria | 1212 |
| 83 | Ga0070696_100530008 | 3300005546 | Bacteria | 941 |
| 84 | Ga0070693_100491668 | 3300005547 | Bacteria | 869 |
| 85 | Ga0070665_100234794 | 3300005548 | Bacteria | 1834 |
| 86 | Ga0070704_100296399 | 3300005549 | Bacteria | 1346 |
| 87 | Ga0070704_100739494 | 3300005549 | Bacteria | 875 |
| 88 | Ga0068855_100028877 | 3300005563 | Bacteria | 6636 |
| 89 | Ga0068855_100034429 | 3300005563 | Bacteria | 6041 |
| 90 | Ga0068855_100046361 | 3300005563 | Bacteria | 5139 |
| 91 | Ga0068855_100454307 | 3300005563 | Bacteria | 1397 |
| 92 | Ga0068855_102419626 | 3300005563 | Bacteria | 524 |
| 93 | Ga0070664_100055015 | 3300005564 | Bacteria | 3377 |
| 94 | Ga0070664_100096824 | 3300005564 | Bacteria | 2561 |
| 95 | Ga0070664_101950108 | 3300005564 | Bacteria | 557 |
| 96 | Ga0068857_100508115 | 3300005577 | Bacteria | 1132 |
| 97 | Ga0068854_100053757 | 3300005578 | Bacteria | 2893 |
| 98 | Ga0068854_101150832 | 3300005578 | Unclassified | 693 |
| 99 | Ga0068856_100059622 | 3300005614 | Bacteria | 3770 |
| 100 | Ga0068856_100069685 | 3300005614 | Bacteria | 3477 |
| 101 | Ga0068856_101116249 | 3300005614 | Bacteria | 806 |
| 102 | Ga0068856_101281959 | 3300005614 | Bacteria | 748 |
| 103 | Ga0070702_100019921 | 3300005615 | Bacteria | 3507 |
| 104 | Ga0070702_100457235 | 3300005615 | Bacteria | 927 |
| 105 | Ga0068852_100015569 | 3300005616 | Bacteria | 5905 |
| 106 | Ga0068852_100015717 | 3300005616 | Bacteria | 5882 |
| 107 | Ga0068852_100491691 | 3300005616 | Bacteria | 1220 |
| 108 | Ga0068859_100046985 | 3300005617 | Bacteria | 4336 |
| 109 | Ga0068859_100077641 | 3300005617 | Bacteria | 3361 |
| 110 | Ga0068864_100178406 | 3300005618 | Bacteria | 1940 |
| 111 | Ga0068864_101321907 | 3300005618 | Bacteria | 721 |
| 112 | Ga0068864_101321909 | 3300005618 | Bacteria | 721 |
| 113 | Ga0068866_10194272 | 3300005718 | Bacteria | 1208 |
| 114 | Ga0068861_100023990 | 3300005719 | Bacteria | 4406 |
| 115 | Ga0068861_100465344 | 3300005719 | Bacteria | 1136 |
| 116 | Ga0068851_10250166 | 3300005834 | Bacteria | 1005 |
| 117 | Ga0068851_10301002 | 3300005834 | Bacteria | 922 |
| 118 | Ga0068870_10024950 | 3300005840 | Bacteria | 2963 |
| 119 | Ga0068863_100007995 | 3300005841 | Bacteria | 10337 |
| 120 | Ga0068863_100177973 | 3300005841 | Bacteria | 2041 |
| 121 | Ga0068858_100051014 | 3300005842 | Bacteria | 3828 |
| 122 | Ga0068858_100413605 | 3300005842 | Bacteria | 1296 |
| 123 | Ga0068860_100024209 | 3300005843 | Bacteria | 5870 |
| 124 | Ga0068860_100132560 | 3300005843 | Bacteria | 2392 |
| 125 | Ga0068860_100167186 | 3300005843 | Bacteria | 2123 |
| 126 | Ga0068862_100042098 | 3300005844 | Bacteria | 3889 |
| 127 | Ga0081455_10016444 | 3300005937 | Bacteria | 7143 |
| 128 | Ga0081455_10092919 | 3300005937 | Bacteria | 2440 |
| 129 | Ga0081540_1005514 | 3300005983 | Bacteria | 9433 |
| 130 | Ga0070717_10001862 | 3300006028 | Bacteria | 14744 |
| 131 | Ga0070717_11208937 | 3300006028 | Bacteria | 688 |
| 132 | Ga0075365_10157008 | 3300006038 | Bacteria | 1584 |
| 133 | Ga0075365_10164267 | 3300006038 | Bacteria | 1548 |
| 134 | Ga0075365_10690221 | 3300006038 | Bacteria | 721 |
| 135 | Ga0075432_10003683 | 3300006058 | Bacteria | 5217 |
| 136 | Ga0070716_100003599 | 3300006173 | Bacteria | 7323 |
| 137 | Ga0070716_100510115 | 3300006173 | Bacteria | 889 |
| 138 | Ga0070712_100029025 | 3300006175 | Bacteria | 3706 |
| 139 | Ga0070712_100365986 | 3300006175 | Bacteria | 1184 |
| 140 | Ga0075362_10153827 | 3300006177 | Bacteria | 1105 |
| 141 | Ga0075367_10206271 | 3300006178 | Bacteria | 1228 |
| 142 | Ga0075369_10269022 | 3300006186 | Bacteria | 793 |
| 143 | Ga0075427_10006245 | 3300006194 | Bacteria | 1721 |
| 144 | Ga0075366_10175307 | 3300006195 | Bacteria | 1302 |
| 145 | Ga0097621_100014218 | 3300006237 | Bacteria | 5953 |
| 146 | Ga0075370_10590528 | 3300006353 | Bacteria | 673 |
| 147 | Ga0068871_100120498 | 3300006358 | Bacteria | 2216 |
| 148 | Ga0068871_100197665 | 3300006358 | Bacteria | 1735 |
| 149 | Ga0075428_100016183 | 3300006844 | Bacteria | 8245 |
| 150 | Ga0075428_101182159 | 3300006844 | Unclassified | 807 |
| 151 | Ga0075430_100002056 | 3300006846 | Bacteria | 16585 |
| 152 | Ga0075431_100003489 | 3300006847 | Bacteria | 15246 |
| 153 | Ga0075431_100015898 | 3300006847 | Bacteria | 7632 |
| 154 | Ga0075431_100564421 | 3300006847 | Bacteria | 1125 |
| 155 | Ga0075433_10000975 | 3300006852 | Bacteria | 20309 |
| 156 | Ga0075433_10083868 | 3300006852 | Bacteria | 2813 |
| 157 | Ga0075434_100009141 | 3300006871 | Bacteria | 9233 |
| 158 | Ga0075434_100043125 | 3300006871 | Bacteria | 4473 |
| 159 | Ga0075434_100097339 | 3300006871 | Bacteria | 2947 |
| 160 | Ga0075429_100003309 | 3300006880 | Bacteria | 13720 |
| 161 | Ga0075429_100305503 | 3300006880 | Bacteria | 1393 |
| 162 | Ga0068865_100025798 | 3300006881 | Bacteria | 3870 |
| 163 | Ga0075436_100782623 | 3300006914 | Unclassified | 710 |
| 164 | Ga0097620_100046986 | 3300006931 | Bacteria | 4336 |
| 165 | Ga0097620_100077644 | 3300006931 | Bacteria | 3361 |
| 166 | Ga0075435_100013273 | 3300007076 | Bacteria | 6121 |
| 167 | Ga0075435_100142893 | 3300007076 | Bacteria | 2009 |
| 168 | Ga0099795_10057260 | 3300007788 | Bacteria | 1436 |
| 169 | Ga0105251_10076254 | 3300009011 | Bacteria | 1556 |
| 170 | Ga0105251_10390841 | 3300009011 | Unclassified | 638 |
| 171 | Ga0105250_10126230 | 3300009092 | Bacteria | 1054 |
| 172 | Ga0105250_10228553 | 3300009092 | Bacteria | 791 |
| 173 | Ga0105240_10139397 | 3300009093 | Bacteria | 2901 |
| 174 | Ga0105240_10448727 | 3300009093 | Bacteria | 1444 |
| 175 | Ga0105240_10625281 | 3300009093 | Bacteria | 1183 |
| 176 | Ga0105240_11479306 | 3300009093 | Unclassified | 712 |
| 177 | Ga0111539_10000528 | 3300009094 | Bacteria | 48456 |
| 178 | Ga0111539_10186184 | 3300009094 | Bacteria | 2424 |
| 179 | Ga0111539_11376270 | 3300009094 | Bacteria | 819 |
| 180 | Ga0111539_12509515 | 3300009094 | Unclassified | 598 |
| 181 | Ga0105245_10068932 | 3300009098 | Bacteria | 3206 |
| 182 | Ga0105245_10106651 | 3300009098 | Bacteria | 2600 |
| 183 | Ga0105245_10567994 | 3300009098 | Bacteria | 1158 |
| 184 | Ga0105247_10048801 | 3300009101 | Bacteria | 2601 |
| 185 | Ga0105247_10079448 | 3300009101 | Bacteria | 2064 |
| 186 | Ga0114129_10001477 | 3300009147 | Bacteria | 31843 |
| 187 | Ga0114129_10007748 | 3300009147 | Bacteria | 15282 |
| 188 | Ga0105243_10038896 | 3300009148 | Bacteria | 3707 |
| 189 | Ga0105243_10130437 | 3300009148 | Bacteria | 2132 |
| 190 | Ga0105242_10012341 | 3300009176 | Bacteria | 6574 |
| 191 | Ga0105242_10039122 | 3300009176 | Bacteria | 3816 |
| 192 | Ga0105248_10013945 | 3300009177 | Bacteria | 8843 |
| 193 | Ga0105248_10241572 | 3300009177 | Bacteria | 2033 |
| 194 | Ga0105237_10504905 | 3300009545 | Bacteria | 1216 |
| 195 | Ga0105237_10901945 | 3300009545 | Bacteria | 891 |
| 196 | Ga0105238_10018493 | 3300009551 | Bacteria | 7090 |
| 197 | Ga0105238_10403418 | 3300009551 | Bacteria | 1360 |
| 198 | Ga0105238_10698658 | 3300009551 | Bacteria | 1026 |
| 199 | Ga0105249_10029823 | 3300009553 | Bacteria | 4928 |
| 200 | Ga0105239_10228481 | 3300010375 | Bacteria | 2088 |
| 201 | Ga0105239_10434164 | 3300010375 | Bacteria | 1489 |
| 202 | Ga0105246_10122755 | 3300011119 | Bacteria | 1927 |
| 203 | Ga0105246_10188248 | 3300011119 | Unclassified | 1595 |
| 204 | Ga0105246_10982887 | 3300011119 | Bacteria | 763 |
| 205 | Ga0157337_1000643 | 3300012483 | Bacteria | 1649 |
| 206 | Ga0157373_10067799 | 3300013100 | Bacteria | 2523 |
| 207 | Ga0157373_10667678 | 3300013100 | Bacteria | 760 |
| 208 | Ga0157371_10109500 | 3300013102 | Bacteria | 1961 |
| 209 | Ga0157371_10322111 | 3300013102 | Bacteria | 1122 |
| 210 | Ga0157371_10368375 | 3300013102 | Bacteria | 1048 |
| 211 | Ga0157370_10137309 | 3300013104 | Bacteria | 2278 |
| 212 | Ga0157370_10759041 | 3300013104 | Bacteria | 884 |
| 213 | Ga0157370_11423349 | 3300013104 | Bacteria | 624 |
| 214 | Ga0157369_10119677 | 3300013105 | Bacteria | 2794 |
| 215 | Ga0157369_10295835 | 3300013105 | Bacteria | 1685 |
| 216 | Ga0157374_10018913 | 3300013296 | Bacteria | 6090 |
| 217 | Ga0157374_10890242 | 3300013296 | Bacteria | 908 |
| 218 | Ga0157378_10047440 | 3300013297 | Bacteria | 3820 |
| 219 | Ga0163162_12045174 | 3300013306 | Bacteria | 657 |
| 220 | Ga0163162_12352795 | 3300013306 | Unclassified | 612 |
| 221 | Ga0157372_10154780 | 3300013307 | Bacteria | 2647 |
| 222 | Ga0157372_10997970 | 3300013307 | Bacteria | 970 |
| 223 | Ga0157372_11083179 | 3300013307 | Bacteria | 927 |
| 224 | Ga0157372_11165292 | 3300013307 | Unclassified | 891 |
| 225 | Ga0157375_10927554 | 3300013308 | Bacteria | 1014 |
| 226 | Ga0163163_10060186 | 3300014325 | Bacteria | 3759 |
| 227 | Ga0163163_10152441 | 3300014325 | Bacteria | 2355 |
| 228 | Ga0163163_10300859 | 3300014325 | Bacteria | 1657 |
| 229 | Ga0157380_10064729 | 3300014326 | Bacteria | 2936 |
| 230 | Ga0157380_10643400 | 3300014326 | Bacteria | 1056 |
| 231 | Ga0157377_10024449 | 3300014745 | Bacteria | 3211 |
| 232 | Ga0157379_10097715 | 3300014968 | Bacteria | 2636 |
| 233 | Ga0157379_10218083 | 3300014968 | Bacteria | 1728 |
| 234 | Ga0157379_10475732 | 3300014968 | Bacteria | 1156 |
| 235 | Ga0157376_10076919 | 3300014969 | Bacteria | 2853 |
| 236 | Ga0157376_10611885 | 3300014969 | Bacteria | 1085 |
| 237 | Ga0163161_10008394 | 3300017792 | Bacteria | 7148 |
| 238 | Ga0163161_10900074 | 3300017792 | Bacteria | 750 |
| 239 | Ga0206354_11271362 | 3300020081 | Bacteria | 1380 |
| 240 | Ga0213872_10023205 | 3300021361 | Bacteria | 2855 |
| 241 | Ga0209233_1023036 | 3300025261 | Bacteria | 1584 |
| 242 | Ga0207656_10096009 | 3300025321 | Bacteria | 1352 |
| 243 | Ga0207713_1177315 | 3300025735 | Unclassified | 668 |
| 244 | Ga0207682_10076333 | 3300025893 | Bacteria | 1428 |
| 245 | Ga0207692_10000849 | 3300025898 | Bacteria | 10974 |
| 246 | Ga0207692_10085845 | 3300025898 | Bacteria | 1694 |
| 247 | Ga0207642_10063491 | 3300025899 | Bacteria | 1728 |
| 248 | Ga0207710_10005282 | 3300025900 | Bacteria | 5582 |
| 249 | Ga0207710_10051963 | 3300025900 | Bacteria | 1842 |
| 250 | Ga0207688_10000263 | 3300025901 | Bacteria | 23901 |
| 251 | Ga0207680_10227257 | 3300025903 | Bacteria | 1281 |
| 252 | Ga0207647_10122036 | 3300025904 | Bacteria | 1536 |
| 253 | Ga0207685_10004719 | 3300025905 | Bacteria | 3504 |
| 254 | Ga0207699_10015354 | 3300025906 | Bacteria | 3975 |
| 255 | Ga0207643_10000889 | 3300025908 | Bacteria | 18002 |
| 256 | Ga0207705_10104154 | 3300025909 | Bacteria | 2090 |
| 257 | Ga0207705_10364742 | 3300025909 | Bacteria | 1114 |
| 258 | Ga0207654_10353721 | 3300025911 | Bacteria | 1012 |
| 259 | Ga0207707_10255296 | 3300025912 | Bacteria | 1522 |
| 260 | Ga0207707_10663306 | 3300025912 | Bacteria | 878 |
| 261 | Ga0207707_10938910 | 3300025912 | Bacteria | 713 |
| 262 | Ga0207695_10084346 | 3300025913 | Bacteria | 3208 |
| 263 | Ga0207693_10027936 | 3300025915 | Bacteria | 4460 |
| 264 | Ga0207693_10313014 | 3300025915 | Bacteria | 1229 |
| 265 | Ga0207663_10010022 | 3300025916 | Bacteria | 5022 |
| 266 | Ga0207663_10129408 | 3300025916 | Bacteria | 1742 |
| 267 | Ga0207663_10187916 | 3300025916 | Bacteria | 1481 |
| 268 | Ga0207663_10231348 | 3300025916 | Bacteria | 1351 |
| 269 | Ga0207660_10071085 | 3300025917 | Bacteria | 2531 |
| 270 | Ga0207662_10000154 | 3300025918 | Bacteria | 32501 |
| 271 | Ga0207662_10822231 | 3300025918 | Unclassified | 655 |
| 272 | Ga0207657_10030200 | 3300025919 | Bacteria | 4922 |
| 273 | Ga0207657_10039476 | 3300025919 | Bacteria | 4195 |
| 274 | Ga0207657_10046045 | 3300025919 | Bacteria | 3822 |
| 275 | Ga0207657_10049848 | 3300025919 | Bacteria | 3646 |
| 276 | Ga0207649_10426105 | 3300025920 | Bacteria | 997 |
| 277 | Ga0207649_10503202 | 3300025920 | Bacteria | 922 |
| 278 | Ga0207652_10045626 | 3300025921 | Bacteria | 3737 |
| 279 | Ga0207652_10065293 | 3300025921 | Bacteria | 3151 |
| 280 | Ga0207652_10263380 | 3300025921 | Bacteria | 1555 |
| 281 | Ga0207652_10408728 | 3300025921 | Bacteria | 1225 |
| 282 | Ga0207652_11002585 | 3300025921 | Bacteria | 734 |
| 283 | Ga0207681_10377907 | 3300025923 | Bacteria | 1140 |
| 284 | Ga0207694_10018170 | 3300025924 | Bacteria | 5317 |
| 285 | Ga0207694_11189101 | 3300025924 | Unclassified | 645 |
| 286 | Ga0207650_10019781 | 3300025925 | Bacteria | 4736 |
| 287 | Ga0207650_11168550 | 3300025925 | Bacteria | 655 |
| 288 | Ga0207687_10008325 | 3300025927 | Bacteria | 6787 |
| 289 | Ga0207687_10020528 | 3300025927 | Bacteria | 4383 |
| 290 | Ga0207700_10000290 | 3300025928 | Bacteria | 29736 |
| 291 | Ga0207664_10011397 | 3300025929 | Bacteria | 6318 |
| 292 | Ga0207664_10148360 | 3300025929 | Bacteria | 1990 |
| 293 | Ga0207644_10023219 | 3300025931 | Bacteria | 4245 |
| 294 | Ga0207644_10114016 | 3300025931 | Bacteria | 2047 |
| 295 | Ga0207706_10020484 | 3300025933 | Bacteria | 5944 |
| 296 | Ga0207686_10143841 | 3300025934 | Bacteria | 1652 |
| 297 | Ga0207686_10187036 | 3300025934 | Bacteria | 1473 |
| 298 | Ga0207709_10075832 | 3300025935 | Bacteria | 2151 |
| 299 | Ga0207709_10386909 | 3300025935 | Bacteria | 1066 |
| 300 | Ga0207670_10020290 | 3300025936 | Bacteria | 4081 |
| 301 | Ga0207670_10066843 | 3300025936 | Bacteria | 2471 |
| 302 | Ga0207669_10051306 | 3300025937 | Bacteria | 2471 |
| 303 | Ga0207704_10037137 | 3300025938 | Bacteria | 2811 |
| 304 | Ga0207704_11367885 | 3300025938 | Unclassified | 606 |
| 305 | Ga0207665_10000719 | 3300025939 | Bacteria | 22485 |
| 306 | Ga0207691_10783504 | 3300025940 | Bacteria | 802 |
| 307 | Ga0207711_10037954 | 3300025941 | Bacteria | 4095 |
| 308 | Ga0207689_10003869 | 3300025942 | Bacteria | 13641 |
| 309 | Ga0207689_10052656 | 3300025942 | Bacteria | 3353 |
| 310 | Ga0207661_10115604 | 3300025944 | Bacteria | 2276 |
| 311 | Ga0207661_10358056 | 3300025944 | Bacteria | 1318 |
| 312 | Ga0207679_10135099 | 3300025945 | Unclassified | 1985 |
| 313 | Ga0207679_10441782 | 3300025945 | Bacteria | 1152 |
| 314 | Ga0207667_10021843 | 3300025949 | Bacteria | 7083 |
| 315 | Ga0207667_10056762 | 3300025949 | Bacteria | 4112 |
| 316 | Ga0207667_10119538 | 3300025949 | Bacteria | 2715 |
| 317 | Ga0207667_10459653 | 3300025949 | Bacteria | 1293 |
| 318 | Ga0207651_10000900 | 3300025960 | Bacteria | 13066 |
| 319 | Ga0207651_10025682 | 3300025960 | Bacteria | 3666 |
| 320 | Ga0207712_10010883 | 3300025961 | Bacteria | 5790 |
| 321 | Ga0207712_10165155 | 3300025961 | Bacteria | 1725 |
| 322 | Ga0207668_10081158 | 3300025972 | Bacteria | 2352 |
| 323 | Ga0207668_10739485 | 3300025972 | Bacteria | 867 |
| 324 | Ga0207668_10895402 | 3300025972 | Bacteria | 789 |
| 325 | Ga0207640_10025032 | 3300025981 | Bacteria | 3608 |
| 326 | Ga0207640_10444288 | 3300025981 | Bacteria | 1067 |
| 327 | Ga0207658_10018594 | 3300025986 | Bacteria | 4802 |
| 328 | Ga0207658_10034145 | 3300025986 | Bacteria | 3633 |
| 329 | Ga0207677_10010239 | 3300026023 | Bacteria | 5300 |
| 330 | Ga0207677_10115356 | 3300026023 | Bacteria | 2009 |
| 331 | Ga0207703_10012561 | 3300026035 | Bacteria | 6602 |
| 332 | Ga0207703_10013883 | 3300026035 | Bacteria | 6279 |
| 333 | Ga0207639_10093434 | 3300026041 | Bacteria | 2412 |
| 334 | Ga0207639_10415489 | 3300026041 | Bacteria | 1215 |
| 335 | Ga0207678_10006545 | 3300026067 | Bacteria | 10328 |
| 336 | Ga0207678_10029694 | 3300026067 | Bacteria | 4773 |
| 337 | Ga0207708_10006322 | 3300026075 | Bacteria | 8779 |
| 338 | Ga0207702_10036530 | 3300026078 | Bacteria | 4110 |
| 339 | Ga0207702_10115998 | 3300026078 | Bacteria | 2389 |
| 340 | Ga0207702_10341752 | 3300026078 | Bacteria | 1430 |
| 341 | Ga0207702_10647095 | 3300026078 | Bacteria | 1039 |
| 342 | Ga0207702_11117600 | 3300026078 | Bacteria | 782 |
| 343 | Ga0207702_11233472 | 3300026078 | Bacteria | 742 |
| 344 | Ga0207641_10135346 | 3300026088 | Bacteria | 2217 |
| 345 | Ga0207648_10001639 | 3300026089 | Bacteria | 24530 |
| 346 | Ga0207676_10031583 | 3300026095 | Bacteria | 3983 |
| 347 | Ga0207676_10091150 | 3300026095 | Bacteria | 2503 |
| 348 | Ga0207674_10390731 | 3300026116 | Bacteria | 1345 |
| 349 | Ga0207674_11772636 | 3300026116 | Bacteria | 585 |
| 350 | Ga0207675_100008008 | 3300026118 | Bacteria | 9959 |
| 351 | Ga0207675_100476902 | 3300026118 | Bacteria | 1239 |
| 352 | Ga0207683_10001293 | 3300026121 | Bacteria | 22621 |
| 353 | Ga0207683_10035723 | 3300026121 | Bacteria | 4323 |
| 354 | Ga0207698_10004120 | 3300026142 | Bacteria | 8830 |
| 355 | Ga0207698_10017188 | 3300026142 | Bacteria | 4900 |
| 356 | Ga0207698_10092670 | 3300026142 | Bacteria | 2478 |
| 357 | Ga0207698_10258184 | 3300026142 | Bacteria | 1599 |
| 358 | Ga0209981_1014619 | 3300027378 | Bacteria | 1096 |
| 359 | Ga0209996_1004003 | 3300027395 | Bacteria | 1867 |
| 360 | Ga0209995_1060903 | 3300027471 | Unclassified | 643 |
| 361 | Ga0209999_1068974 | 3300027543 | Bacteria | 677 |
| 362 | Ga0210002_1013355 | 3300027617 | Bacteria | 1281 |
| 363 | Ga0209971_1005532 | 3300027682 | Bacteria | 2999 |
| 364 | Ga0209974_10029129 | 3300027876 | Bacteria | 1829 |
| 365 | Ga0209974_10070872 | 3300027876 | Bacteria | 1189 |
| 366 | Ga0207428_10000291 | 3300027907 | Bacteria | 67245 |
| 367 | Ga0268266_10047490 | 3300028379 | Bacteria | 3678 |
| 368 | Ga0268266_10098922 | 3300028379 | Bacteria | 2567 |
| 369 | Ga0265330_10012435 | 3300031235 | Bacteria | 3979 |
| 370 | Ga0265325_10008234 | 3300031241 | Bacteria | 6166 |
| 371 | Ga0265339_10177578 | 3300031249 | Bacteria | 1062 |
| 372 | Ga0265313_10010630 | 3300031595 | Bacteria | 5796 |
| 373 | Ga0265313_10095574 | 3300031595 | Bacteria | 1326 |
| 374 | Ga0265342_10001132 | 3300031712 | Bacteria | 25514 |
| 375 | Ga0373930_0010716 | 3300034816 | Bacteria | 1644 |
| 376 | Ga0373930_0061651 | 3300034816 | Bacteria | 838 |
| 377 | Ga0373938_0012517 | 3300034957 | Bacteria | 1593 |
| 378 | Ga0373938_0182322 | 3300034957 | Bacteria | 574 |
| 379 | Ga0373926_0003254 | 3300035083 | Bacteria | 5219 |
| 380 | Ga0373926_0033420 | 3300035083 | Bacteria | 1818 |
| 381 | Ga0373928_0003461 | 3300035084 | Bacteria | 3006 |
| 382 | Ga0373928_0235041 | 3300035084 | Unclassified | 541 |
| 383 | Ga0373929_0071923 | 3300035085 | Bacteria | 828 |
| 384 | Ga0373944_0002442 | 3300035089 | Bacteria | 4718 |
| 385 | Ga0373944_0041525 | 3300035089 | Bacteria | 1423 |
| 386 | Ga0373949_0007797 | 3300035090 | Bacteria | 2345 |
| 387 | Ga0373951_0048220 | 3300035091 | Bacteria | 1043 |
| 388 | Ga0373932_0008691 | 3300035112 | Bacteria | 2430 |
| 389 | Ga0373932_0072417 | 3300035112 | Bacteria | 1072 |
| 390 | Ga0373932_0195610 | 3300035112 | Bacteria | 716 |
| 391 | Ga0373936_0001218 | 3300035113 | Bacteria | 9265 |
| 392 | Ga0373936_0472281 | 3300035113 | Bacteria | 581 |
| 393 | Ga0373941_0049948 | 3300035115 | Bacteria | 1326 |
| 394 | Ga0373945_0025022 | 3300035116 | Bacteria | 2071 |
| 395 | Ga0373945_0029135 | 3300035116 | Bacteria | 1938 |
| 396 | Ga0373957_0021460 | 3300035120 | Bacteria | 2293 |
| 397 | Ga0373960_0002561 | 3300035121 | Bacteria | 4103 |
| 398 | Ga0373943_0007114 | 3300035170 | Bacteria | 5021 |
| 399 | Ga0373943_0022381 | 3300035170 | Bacteria | 2928 |
| 400 | Ga0373943_0034507 | 3300035170 | Bacteria | 2413 |
| 401 | Ga0373946_0001618 | 3300035171 | Bacteria | 7840 |
| 402 | Ga0373946_0024824 | 3300035171 | Bacteria | 2353 |
| 403 | Ga0373946_0147382 | 3300035171 | Bacteria | 1095 |
| 404 | Ga0373955_0005754 | 3300035172 | Bacteria | 5591 |
| 405 | Ga0373942_0001847 | 3300035207 | Bacteria | 5335 |
| 406 | Ga0373961_0033656 | 3300035241 | Bacteria | 1444 |
| 407 | Ga0373962_0076346 | 3300035242 | Bacteria | 1010 |
| 408 | Ga0373962_0128593 | 3300035242 | Bacteria | 813 |
| 409 | Ga0373924_0088592 | 3300035410 | Bacteria | 1322 |
| 410 | Ga0373924_0344291 | 3300035410 | Bacteria | 664 |
| 411 | Ga0373931_0009468 | 3300035691 | Bacteria | 4658 |
| 412 | Ga0373931_0085084 | 3300035691 | Bacteria | 1752 |
| 413 | Ga0373931_0184127 | 3300035691 | Bacteria | 1239 |
| 414 | Ga0373935_0015189 | 3300035692 | Bacteria | 4651 |
| 415 | Ga0373935_0021688 | 3300035692 | Bacteria | 3934 |
| 416 | Ga0373935_0209387 | 3300035692 | Bacteria | 1350 |
| 417 | Ga0373927_0023883 | 3300035695 | Bacteria | 3999 |
| 418 | Ga0373927_0210982 | 3300035695 | Bacteria | 1275 |
| 419 | Ga0373933_0124674 | 3300035724 | Bacteria | 1615 |
| 420 | Ga0373947_0000874 | 3300035725 | Bacteria | 18211 |
| 421 | Ga0373947_0042141 | 3300035725 | Bacteria | 2724 |
| 422 | Ga0373947_0148838 | 3300035725 | Bacteria | 1506 |
| 423 | Ga0373925_0013063 | 3300037068 | Bacteria | 6011 |
| 424 | Ga0373925_0033677 | 3300037068 | Bacteria | 3775 |
| 425 | Ga0373925_0331648 | 3300037068 | Bacteria | 1232 |
| 426 | Ga0373925_0608263 | 3300037068 | Unclassified | 900 |
| 427 | Ga0395899_0007661 | 3300037312 | Bacteria | 8324 |
| 428 | Ga0395900_0002820 | 3300037418 | Bacteria | 18968 |
| 429 | Ga0395898_0106187 | 3300037466 | Bacteria | 2693 |
| 430 | Ga0436364_1286367 | 3300037853 | Bacteria | 4237 |
| 431 | Ga0395901_0127978 | 3300038443 | Bacteria | 2669 |
| 432 | Ga0436365_0130337 | 3300039437 | Bacteria | 926 |
| 433 | Ga0436365_0722556 | 3300039437 | Unclassified | 914 |
| 434 | Ga0436360_0717772 | 3300039438 | Bacteria | 1978 |
| 435 | Ga0436361_0476110 | 3300039447 | Bacteria | 14479 |
| 436 | Ga0436363_1057531 | 3300039450 | Bacteria | 2280 |
| 437 | Ga0439453_0165428 | 3300041408 | Unclassified | 532 |
| 438 | Ga0451853_3077804 | 3300041512 | Bacteria | 824 |
| 439 | Ga0439441_087049 | 3300042001 | Bacteria | 687 |
| 440 | Ga0439448_0127148 | 3300042005 | Unclassified | 877 |
| 441 | Ga0439463_036157 | 3300042016 | Bacteria | 1251 |
| 442 | Ga0439458_0065671 | 3300042157 | Bacteria | 911 |
| 443 | Ga0439464_0034619 | 3300042439 | Bacteria | 1424 |
| 444 | Ga0439440_0082861 | 3300042993 | Bacteria | 851 |
| 445 | Ga0466957_0579864 | 3300044842 | Bacteria | 784 |
| 446 | Ga0495617_038309 | 3300046452 | Bacteria | 1604 |
| 447 | Ga0495592_0086248 | 3300046454 | Bacteria | 2261 |
| 448 | Ga0495603_0005459 | 3300046455 | Bacteria | 7590 |
| 449 | Ga0495603_0019346 | 3300046455 | Bacteria | 4121 |
| 450 | Ga0495603_0049120 | 3300046455 | Bacteria | 2511 |
| 451 | Ga0495629_0000329 | 3300046459 | Bacteria | 40545 |
| 452 | Ga0495629_0063291 | 3300046459 | Bacteria | 2583 |
| 453 | Ga0495641_0009078 | 3300046461 | Bacteria | 5957 |
| 454 | Ga0495641_0050896 | 3300046461 | Bacteria | 1892 |
| 455 | Ga0495641_0133445 | 3300046461 | Bacteria | 1108 |
| 456 | Ga0495651_0008552 | 3300046462 | Bacteria | 7843 |
| 457 | Ga0495653_0112173 | 3300046463 | Bacteria | 1957 |
| 458 | Ga0495653_0844471 | 3300046463 | Unclassified | 548 |
| 459 | Ga0495580_0003611 | 3300046472 | Bacteria | 13108 |
| 460 | Ga0495580_0227297 | 3300046472 | Bacteria | 1281 |
| 461 | Ga0495582_0018577 | 3300046473 | Bacteria | 3801 |
| 462 | Ga0495582_0054817 | 3300046473 | Bacteria | 2197 |
| 463 | Ga0495582_0083289 | 3300046473 | Bacteria | 1777 |
| 464 | Ga0495639_0007456 | 3300046475 | Bacteria | 4695 |
| 465 | Ga0495662_0033343 | 3300046476 | Bacteria | 2487 |
| 466 | Ga0495664_0009503 | 3300046477 | Bacteria | 5444 |
| 467 | Ga0495584_0015175 | 3300046491 | Bacteria | 3924 |
| 468 | Ga0495584_0074841 | 3300046491 | Bacteria | 1702 |
| 469 | Ga0495584_0127545 | 3300046491 | Bacteria | 1290 |
| 470 | Ga0495585_0066829 | 3300046492 | Bacteria | 1968 |
| 471 | Ga0495585_0149042 | 3300046492 | Bacteria | 1221 |
| 472 | Ga0495585_0556189 | 3300046492 | Bacteria | 542 |
| 473 | Ga0495594_0028755 | 3300046499 | Bacteria | 3000 |
| 474 | Ga0495594_0127347 | 3300046499 | Bacteria | 1441 |
| 475 | Ga0495594_0295731 | 3300046499 | Bacteria | 922 |
| 476 | Ga0495596_0260973 | 3300046500 | Unclassified | 672 |
| 477 | Ga0495607_0055693 | 3300046501 | Bacteria | 2274 |
| 478 | Ga0495608_0146790 | 3300046511 | Bacteria | 1504 |
| 479 | Ga0495616_0282392 | 3300046513 | Bacteria | 705 |
| 480 | Ga0495620_0049417 | 3300046515 | Bacteria | 1800 |
| 481 | Ga0495630_0067980 | 3300046517 | Bacteria | 2678 |
| 482 | Ga0495630_0353611 | 3300046517 | Bacteria | 1124 |
| 483 | Ga0495631_0098585 | 3300046518 | Bacteria | 1258 |
| 484 | Ga0495637_0244169 | 3300046520 | Bacteria | 648 |
| 485 | Ga0495644_0000434 | 3300046523 | Bacteria | 18447 |
| 486 | Ga0495644_0121756 | 3300046523 | Bacteria | 993 |
| 487 | Ga0495666_0015395 | 3300046526 | Bacteria | 3807 |
| 488 | Ga0495666_0085502 | 3300046526 | Bacteria | 1490 |
| 489 | Ga0495652_0013346 | 3300046529 | Bacteria | 7393 |
| 490 | Ga0495652_0477563 | 3300046529 | Bacteria | 868 |
| 491 | Ga0495665_0026914 | 3300046531 | Bacteria | 3087 |
| 492 | Ga0495665_0427889 | 3300046531 | Bacteria | 670 |
| 493 | Ga0495640_0056948 | 3300046533 | Bacteria | 2668 |
| 494 | Ga0495586_0028072 | 3300046535 | Bacteria | 3011 |
| 495 | Ga0495587_0018879 | 3300046536 | Bacteria | 4274 |
| 496 | Ga0495598_0003767 | 3300046537 | Bacteria | 3240 |
| 497 | Ga0495598_0040231 | 3300046537 | Bacteria | 1362 |
| 498 | Ga0495598_0060701 | 3300046537 | Bacteria | 1166 |
| 499 | Ga0495621_0122795 | 3300046539 | Bacteria | 1005 |
| 500 | Ga0495645_0185944 | 3300046543 | Bacteria | 1420 |
| 501 | Ga0495622_0003676 | 3300046557 | Bacteria | 7191 |
| 502 | Ga0495633_0000643 | 3300046558 | Bacteria | 32448 |
| 503 | Ga0495667_0005122 | 3300046559 | Bacteria | 8854 |
| 504 | Ga0495656_0000842 | 3300046615 | Bacteria | 9892 |
| 505 | Ga0495656_0009556 | 3300046615 | Bacteria | 3491 |
| 506 | Ga0495656_0420483 | 3300046615 | Bacteria | 701 |
| 507 | Ga0495668_0087643 | 3300046616 | Bacteria | 1707 |
| 508 | Ga0495611_0004301 | 3300046648 | Bacteria | 6186 |
| 509 | Ga0495635_0001379 | 3300046663 | Bacteria | 16201 |
| 510 | Ga0495659_0001236 | 3300046664 | Bacteria | 8840 |
| 511 | Ga0495588_0025967 | 3300046674 | Bacteria | 2922 |
| 512 | Ga0495599_0018912 | 3300046678 | Bacteria | 4294 |
| 513 | Ga0495646_0006527 | 3300046680 | Bacteria | 7401 |
| 514 | Ga0495647_0002668 | 3300046681 | Bacteria | 5665 |
| 515 | Ga0495647_0005000 | 3300046681 | Bacteria | 4342 |
| 516 | Ga0495647_0026623 | 3300046681 | Bacteria | 2120 |
| 517 | Ga0495658_0019600 | 3300046683 | Bacteria | 3533 |
| 518 | Ga0495658_0032637 | 3300046683 | Bacteria | 2844 |
| 519 | Ga0495658_0102097 | 3300046683 | Bacteria | 1713 |
| 520 | Ga0495658_0142187 | 3300046683 | Bacteria | 1468 |
| 521 | Ga0495613_0002281 | 3300046689 | Bacteria | 14509 |
| 522 | Ga0495613_0020424 | 3300046689 | Bacteria | 4937 |
| 523 | Ga0495613_0095407 | 3300046689 | Bacteria | 2151 |
| 524 | Ga0495624_0017283 | 3300046690 | Bacteria | 4844 |
| 525 | Ga0495624_0053551 | 3300046690 | Bacteria | 2547 |
| 526 | Ga0495624_0630233 | 3300046690 | Unclassified | 638 |
| 527 | Ga0495670_0008704 | 3300046691 | Bacteria | 4996 |
| 528 | Ga0495670_0191884 | 3300046691 | Bacteria | 1080 |
| 529 | Ga0495589_0040148 | 3300046794 | Bacteria | 2338 |
| 530 | Ga0495589_0109481 | 3300046794 | Bacteria | 1334 |
| 531 | Ga0495600_0007387 | 3300046809 | Bacteria | 6720 |
| 532 | Ga0495600_0131647 | 3300046809 | Bacteria | 1626 |
| 533 | Ga0495581_0061310 | 3300047315 | Bacteria | 2173 |
| 534 | Ga0495581_0161655 | 3300047315 | Unclassified | 1309 |
| 535 | Ga0495604_0033622 | 3300047317 | Bacteria | 4058 |
| 536 | Ga0495604_0105809 | 3300047317 | Bacteria | 2059 |
| 537 | Ga0495636_0080604 | 3300047318 | Bacteria | 1401 |
| 538 | Ga0495636_0133774 | 3300047318 | Bacteria | 1104 |
| 539 | Ga0495674_0028368 | 3300047319 | Bacteria | 5103 |
| 540 | Ga0495676_0095528 | 3300047321 | Bacteria | 2211 |
| 541 | Ga0495676_0314303 | 3300047321 | Bacteria | 1053 |
| 542 | Ga0495680_0033843 | 3300047322 | Bacteria | 4134 |
| 543 | Ga0495683_0152824 | 3300047323 | Bacteria | 1073 |
| 544 | Ga0495677_0061234 | 3300047445 | Bacteria | 1396 |
| 545 | Ga0495679_066200 | 3300047446 | Bacteria | 1050 |
| 546 | Ga0495679_081250 | 3300047446 | Bacteria | 920 |
| 547 | Ga0495681_0064951 | 3300047470 | Bacteria | 1670 |
| 548 | Ga0495684_0035502 | 3300047471 | Bacteria | 3823 |
| 549 | Ga0495593_0012135 | 3300047673 | Bacteria | 4929 |
| 550 | Ga0495593_0038715 | 3300047673 | Bacteria | 2574 |
| 551 | Ga0495614_0088465 | 3300048089 | Bacteria | 1346 |
| 552 | Ga0495615_0227393 | 3300048090 | Bacteria | 584 |
| 553 | Ga0496100_0089349 | 3300048903 | Bacteria | 2098 |
| 554 | Ga0496100_0144215 | 3300048903 | Bacteria | 1691 |
| 555 | Ga0496100_0367840 | 3300048903 | Bacteria | 1089 |
| 556 | Ga0496101_0004213 | 3300048904 | Bacteria | 9009 |
| 557 | Ga0496101_0304570 | 3300048904 | Bacteria | 1248 |
| 558 | Ga0496101_0574367 | 3300048904 | Bacteria | 891 |
| 559 | Ga0496102_0092434 | 3300048905 | Bacteria | 2801 |
| 560 | Ga0496102_0154819 | 3300048905 | Bacteria | 2154 |
| 561 | Ga0496103_0003429 | 3300048906 | Bacteria | 9692 |
| 562 | Ga0496103_0062407 | 3300048906 | Bacteria | 2319 |
| 563 | Ga0496103_0214867 | 3300048906 | Bacteria | 1236 |
| 564 | Ga0496104_0006123 | 3300048907 | Bacteria | 10560 |
| 565 | Ga0496104_0149939 | 3300048907 | Bacteria | 2239 |
| 566 | Ga0496104_0150356 | 3300048907 | Bacteria | 2235 |
| 567 | Ga0496104_0168778 | 3300048907 | Bacteria | 2098 |
| 568 | Ga0496104_0301127 | 3300048907 | Bacteria | 1515 |
| 569 | Ga0496105_0004225 | 3300048908 | Bacteria | 10790 |
| 570 | Ga0496105_0225419 | 3300048908 | Bacteria | 1524 |
| 571 | Ga0496105_0701845 | 3300048908 | Bacteria | 776 |
| 572 | Ga0496106_0018998 | 3300048909 | Bacteria | 5093 |
| 573 | Ga0496107_0008057 | 3300048910 | Bacteria | 7275 |
| 574 | Ga0496107_0410147 | 3300048910 | Bacteria | 1007 |
| 575 | Ga0496108_0008243 | 3300048911 | Bacteria | 8457 |
| 576 | Ga0496108_0021192 | 3300048911 | Bacteria | 5341 |
| 577 | Ga0496108_0327544 | 3300048911 | Bacteria | 1335 |
| 578 | Ga0496108_0540885 | 3300048911 | Bacteria | 1016 |
| 579 | Ga0496108_1148920 | 3300048911 | Unclassified | 658 |
| 580 | Ga0496109_0001287 | 3300048912 | Bacteria | 20815 |
| 581 | Ga0496109_0023515 | 3300048912 | Bacteria | 5471 |
| 582 | Ga0496109_0042157 | 3300048912 | Bacteria | 4133 |
| 583 | Ga0496110_0122545 | 3300048913 | Bacteria | 2343 |
| 584 | Ga0496110_0138319 | 3300048913 | Bacteria | 2202 |
| 585 | Ga0496110_0558874 | 3300048913 | Bacteria | 1040 |
| 586 | Ga0496111_0003286 | 3300048914 | Bacteria | 9989 |
| 587 | Ga0496111_0040897 | 3300048914 | Bacteria | 3325 |
| 588 | Ga0496111_0123339 | 3300048914 | Bacteria | 1914 |
| 589 | Ga0496111_0761276 | 3300048914 | Bacteria | 702 |
| 590 | Ga0496112_0017567 | 3300048915 | Bacteria | 6724 |
| 591 | Ga0496112_0034589 | 3300048915 | Bacteria | 4917 |
| 592 | Ga0496112_0131407 | 3300048915 | Bacteria | 2475 |
| 593 | Ga0496112_0169516 | 3300048915 | Bacteria | 2148 |
| 594 | Ga0496112_0672495 | 3300048915 | Bacteria | 964 |
| 595 | Ga0496113_0002800 | 3300048916 | Bacteria | 10265 |
| 596 | Ga0496113_0445340 | 3300048916 | Bacteria | 1040 |
| 597 | Ga0496114_0008606 | 3300048917 | Bacteria | 8086 |
| 598 | Ga0496115_0051251 | 3300048918 | Bacteria | 3309 |
| 599 | Ga0496115_0061200 | 3300048918 | Bacteria | 3035 |
| 600 | Ga0496115_0260056 | 3300048918 | Bacteria | 1427 |
| 601 | Ga0496125_0388504 | 3300048928 | Bacteria | 820 |
| 602 | Ga0501031_0098852 | 3300049568 | Bacteria | 1904 |
| 603 | Ga0501032_0015269 | 3300049569 | Bacteria | 5422 |
| 604 | Ga0501032_0044630 | 3300049569 | Bacteria | 3000 |
| 605 | Ga0501032_0195859 | 3300049569 | Bacteria | 1320 |
| 606 | Ga0501032_0840002 | 3300049569 | Bacteria | 579 |
| 607 | Ga0501033_0025535 | 3300049570 | Bacteria | 4451 |
| 608 | Ga0501033_0526089 | 3300049570 | Bacteria | 816 |
| 609 | Ga0501034_0027313 | 3300049571 | Bacteria | 5806 |
| 610 | Ga0501034_0282954 | 3300049571 | Bacteria | 1597 |
| 611 | Ga0501034_0353702 | 3300049571 | Bacteria | 1397 |
| 612 | Ga0501034_0813078 | 3300049571 | Bacteria | 827 |
| 613 | Ga0501036_0066228 | 3300049572 | Bacteria | 3056 |
| 614 | Ga0501036_0110127 | 3300049572 | Bacteria | 2327 |
| 615 | Ga0501037_0044108 | 3300049573 | Bacteria | 3276 |
| 616 | Ga0501037_0143953 | 3300049573 | Bacteria | 1705 |
| 617 | Ga0501037_0150424 | 3300049573 | Bacteria | 1664 |
| 618 | Ga0501038_0047718 | 3300049574 | Bacteria | 3709 |
| 619 | Ga0501039_0032188 | 3300049575 | Bacteria | 4042 |
| 620 | Ga0501043_0065506 | 3300049579 | Bacteria | 2853 |
| 621 | Ga0501043_0153705 | 3300049579 | Bacteria | 1800 |
| 622 | Ga0501043_0407565 | 3300049579 | Bacteria | 1026 |
| 623 | Ga0501043_0899213 | 3300049579 | Bacteria | 635 |
| 624 | Ga0501047_0054286 | 3300049581 | Bacteria | 3875 |
| 625 | Ga0501047_0058262 | 3300049581 | Bacteria | 3731 |
| 626 | Ga0501047_0320760 | 3300049581 | Bacteria | 1389 |
| 627 | Ga0501047_0482356 | 3300049581 | Bacteria | 1067 |
| 628 | Ga0501067_0203003 | 3300049583 | Bacteria | 1104 |
| 629 | Ga0501068_0085093 | 3300049584 | Bacteria | 1946 |
| 630 | Ga0501069_0004336 | 3300049585 | Bacteria | 7326 |
| 631 | Ga0501069_0121497 | 3300049585 | Bacteria | 1492 |
| 632 | Ga0501069_0420652 | 3300049585 | Bacteria | 792 |
| 633 | Ga0501070_0003447 | 3300049586 | Bacteria | 13708 |
| 634 | Ga0501070_0071101 | 3300049586 | Bacteria | 2881 |
| 635 | Ga0501070_0100722 | 3300049586 | Bacteria | 2390 |
| 636 | Ga0501070_0940342 | 3300049586 | Bacteria | 673 |
| 637 | Ga0501071_0324175 | 3300049587 | Bacteria | 1170 |
| 638 | Ga0501073_0015858 | 3300049589 | Bacteria | 5460 |
| 639 | Ga0501074_0162484 | 3300049590 | Bacteria | 1595 |
| 640 | Ga0501074_0911273 | 3300049590 | Archaea | 619 |
| 641 | Ga0501076_0747978 | 3300049592 | Bacteria | 807 |
| 642 | Ga0501077_0016202 | 3300049593 | Bacteria | 4695 |
| 643 | Ga0501077_0046592 | 3300049593 | Bacteria | 2754 |
| 644 | Ga0501079_0376994 | 3300049741 | Bacteria | 1112 |
| 645 | Ga0501080_0087621 | 3300049742 | Bacteria | 2892 |
| 646 | Ga0501080_0113880 | 3300049742 | Bacteria | 2507 |
| 647 | Ga0501080_0434103 | 3300049742 | Bacteria | 1179 |
| 648 | Ga0501083_0025847 | 3300049744 | Bacteria | 4064 |
| 649 | Ga0501083_0101701 | 3300049744 | Bacteria | 1894 |
| 650 | Ga0501035_0064401 | 3300049822 | Bacteria | 3258 |
| 651 | Ga0501035_1250133 | 3300049822 | Unclassified | 574 |
| 652 | Ga0501044_0081705 | 3300049823 | Bacteria | 3270 |
| 653 | Ga0501044_0107001 | 3300049823 | Bacteria | 2808 |
| 654 | Ga0501044_0149655 | 3300049823 | Bacteria | 2317 |
| 655 | Ga0501044_0471796 | 3300049823 | Unclassified | 1159 |
| 656 | Ga0501044_1115430 | 3300049823 | Unclassified | 658 |
| 657 | nmdc:mga00v17_252254_c1 | 3300050491 | Bacteria | 1144 |
| 658 | nmdc:mga0yw44_1008_c1 | 3300050492 | Bacteria | 10779 |
| 659 | nmdc:mga0yw44_157337_c1 | 3300050492 | Bacteria | 1486 |
| 660 | nmdc:mga0yw44_81393_c1 | 3300050492 | Bacteria | 2030 |
| 661 | nmdc:mga06z11_137950_c1 | 3300050494 | Bacteria | 1376 |
| 662 | nmdc:mga07m45_315047_c1 | 3300050496 | Bacteria | 909 |
| 663 | nmdc:mga07m45_355593_c1 | 3300050496 | Bacteria | 851 |
| 664 | nmdc:mga05p37_262_c1 | 3300050507 | Bacteria | 49144 |
| 665 | nmdc:mga05p37_62866_c1 | 3300050507 | Bacteria | 4569 |
| 666 | nmdc:mga09592_1228_c1 | 3300050508 | Bacteria | 20528 |
| 667 | nmdc:mga09592_887928_c1 | 3300050508 | Bacteria | 750 |
| 668 | nmdc:mga0qj67_1310_c1 | 3300050509 | Bacteria | 17456 |
| 669 | nmdc:mga06r32_510_c1 | 3300050510 | Bacteria | 33391 |
| 670 | nmdc:mga06r32_68955_c1 | 3300050510 | Bacteria | 3417 |
| 671 | nmdc:mga08y16_170558_c1 | 3300050511 | Bacteria | 2260 |
| 672 | nmdc:mga08y16_3743_c2 | 3300050511 | Bacteria | 7173 |
| 673 | nmdc:mga0n895_106_c1 | 3300050512 | Bacteria | 49191 |
| 674 | nmdc:mga0n895_217352_c1 | 3300050512 | Bacteria | 1941 |
| 675 | nmdc:mga0rr50_1148_c1 | 3300050513 | Bacteria | 14394 |
| 676 | nmdc:mga0rr50_614393_c1 | 3300050513 | Bacteria | 927 |
| 677 | nmdc:mga0rr50_81239_c1 | 3300050513 | Bacteria | 2501 |
| 678 | nmdc:mga08x19_161049_c1 | 3300050514 | Bacteria | 1524 |
| 679 | nmdc:mga0a205_1112_c1 | 3300050515 | Bacteria | 22250 |
| 680 | Ga0495601_0018697 | 3300053077 | Bacteria | 4218 |
| 681 | Ga0495612_0001704 | 3300053078 | Bacteria | 9020 |
| 682 | Ga0495595_0249666 | 3300053084 | Bacteria | 888 |
| 683 | Ga0495595_0258506 | 3300053084 | Bacteria | 872 |
| 684 | Ga0495619_0000609 | 3300053085 | Bacteria | 23652 |
| 685 | Ga0495619_0093004 | 3300053085 | Bacteria | 2043 |
| 686 | Ga0500616_0004537 | 3300053153 | Bacteria | 9843 |
| 687 | Ga0500599_067584 | 3300053736 | Bacteria | 590 |
| 688 | Ga0501084_0637963 | 3300054114 | Bacteria | 899 |
| 689 | Ga0501082_0888920 | 3300060353 | Bacteria | 779 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_0717772 | Ga0436360_0717772_650_1072 | 105 |
| 2 | 3300049586 | Ga0501070_0940342 | Ga0501070_0940342_309_653 | 105 |
| 3 | 3300039450 | Ga0436363_1057531 | Ga0436363_1057531_428_781 | 108 |
| 4 | 3300049587 | Ga0501071_0324175 | Ga0501071_0324175_750_1157 | 111 |
| 5 | 3300021361 | Ga0213872_10023205 | Ga0213872_100232053 | 114 |
| 6 | 3300039447 | Ga0436361_0476110 | Ga0436361_0476110_3841_4263 | 114 |
| 7 | 3300005843 | Ga0068860_100167186 | Ga0068860_1001671862 | 116 |
| 8 | 3300035113 | Ga0373936_0472281 | Ga0373936_0472281_176_553 | 116 |
| 9 | 3300046461 | Ga0495641_0133445 | Ga0495641_0133445_693_1070 | 116 |
| 10 | 3300046517 | Ga0495630_0353611 | Ga0495630_0353611_710_1087 | 116 |
| 11 | 3300025919 | Ga0207657_10039476 | Ga0207657_100394761 | 117 |
| 12 | 3300025972 | Ga0207668_10739485 | Ga0207668_107394852 | 117 |
| 13 | 3300042005 | Ga0439448_0127148 | Ga0439448_0127148_442_867 | 117 |
| 14 | 3300049593 | Ga0501077_0046592 | Ga0501077_0046592_1419_1844 | 117 |
| 15 | 3300049822 | Ga0501035_1250133 | Ga0501035_1250133_105_530 | 117 |
| 16 | 3300013104 | Ga0157370_10759041 | Ga0157370_107590412 | 118 |
| 17 | 3300005458 | Ga0070681_10539591 | Ga0070681_105395912 | 119 |
| 18 | 3300005530 | Ga0070679_100564379 | Ga0070679_1005643792 | 119 |
| 19 | 3300025912 | Ga0207707_10663306 | Ga0207707_106633062 | 119 |
| 20 | 3300025921 | Ga0207652_10408728 | Ga0207652_104087282 | 119 |
| 21 | 3300027378 | Ga0209981_1014619 | Ga0209981_10146192 | 119 |
| 22 | 3300027395 | Ga0209996_1004003 | Ga0209996_10040032 | 119 |
| 23 | 3300027471 | Ga0209995_1060903 | Ga0209995_10609032 | 119 |
| 24 | 3300027543 | Ga0209999_1068974 | Ga0209999_10689742 | 119 |
| 25 | 3300027617 | Ga0210002_1013355 | Ga0210002_10133552 | 119 |
| 26 | 3300027876 | Ga0209974_10070872 | Ga0209974_100708722 | 119 |
| 27 | 3300041408 | Ga0439453_0165428 | Ga0439453_0165428_55_480 | 119 |
| 28 | 3300042016 | Ga0439463_036157 | Ga0439463_036157_468_893 | 119 |
| 29 | 3300042157 | Ga0439458_0065671 | Ga0439458_0065671_305_730 | 119 |
| 30 | 3300042439 | Ga0439464_0034619 | Ga0439464_0034619_303_728 | 119 |
| 31 | 3300005471 | Ga0070698_101832010 | Ga0070698_1018320101 | 120 |
| 32 | 3300027682 | Ga0209971_1005532 | Ga0209971_10055322 | 120 |
| 33 | 3300027876 | Ga0209974_10029129 | Ga0209974_100291292 | 120 |
| 34 | 3300049585 | Ga0501069_0420652 | Ga0501069_0420652_201_626 | 120 |
| 35 | 3300049569 | Ga0501032_0195859 | Ga0501032_0195859_30_422 | 121 |
| 36 | 3300005563 | Ga0068855_100028877 | Ga0068855_1000288774 | 122 |
| 37 | 3300025949 | Ga0207667_10056762 | Ga0207667_100567622 | 122 |
| 38 | 3300006038 | Ga0075365_10157008 | Ga0075365_101570082 | 125 |
| 39 | 3300006847 | Ga0075431_100564421 | Ga0075431_1005644211 | 125 |
| 40 | 3300046463 | Ga0495653_0844471 | Ga0495653_0844471_132_536 | 125 |
| 41 | 3300050492 | nmdc:mga0yw44_81393_c1 | nmdc:mga0yw44_81393_c1_1532_1954 | 125 |
| 42 | iso_pu_bacteria | 2643221547 | 2643756714 | 127 |
| 43 | 3300005331 | Ga0070670_100193646 | Ga0070670_1001936461 | 129 |
| 44 | 3300005435 | Ga0070714_101522846 | Ga0070714_1015228462 | 129 |
| 45 | 3300006028 | Ga0070717_11208937 | Ga0070717_112089372 | 129 |
| 46 | 3300006852 | Ga0075433_10083868 | Ga0075433_100838682 | 129 |
| 47 | 3300007076 | Ga0075435_100142893 | Ga0075435_1001428932 | 129 |
| 48 | 3300009094 | Ga0111539_12509515 | Ga0111539_125095152 | 129 |
| 49 | 3300011119 | Ga0105246_10188248 | Ga0105246_101882482 | 129 |
| 50 | 3300014325 | Ga0163163_10060186 | Ga0163163_100601862 | 129 |
| 51 | 3300005937 | Ga0081455_10016444 | Ga0081455_100164442 | 130 |
| 52 | 3300006844 | Ga0075428_101182159 | Ga0075428_1011821592 | 130 |
| 53 | 3300006871 | Ga0075434_100043125 | Ga0075434_1000431253 | 130 |
| 54 | 3300009094 | Ga0111539_11376270 | Ga0111539_113762701 | 130 |
| 55 | 3300009147 | Ga0114129_10007748 | Ga0114129_100077486 | 130 |
| 56 | 3300025945 | Ga0207679_10135099 | Ga0207679_101350992 | 130 |
| 57 | 3300037068 | Ga0373925_0608263 | Ga0373925_0608263_189_611 | 130 |
| 58 | 3300042001 | Ga0439441_087049 | Ga0439441_087049_246_665 | 130 |
| 59 | 3300042993 | Ga0439440_0082861 | Ga0439440_0082861_59_484 | 130 |
| 60 | 3300047315 | Ga0495581_0161655 | Ga0495581_0161655_115_537 | 130 |
| 61 | 3300047318 | Ga0495636_0133774 | Ga0495636_0133774_21_446 | 130 |
| 62 | 3300048907 | Ga0496104_0006123 | Ga0496104_0006123_6787_7209 | 130 |
| 63 | 3300048908 | Ga0496105_0004225 | Ga0496105_0004225_8741_9163 | 130 |
| 64 | 3300048911 | Ga0496108_0021192 | Ga0496108_0021192_3354_3776 | 130 |
| 65 | 3300048912 | Ga0496109_0001287 | Ga0496109_0001287_15448_15870 | 130 |
| 66 | 3300048914 | Ga0496111_0123339 | Ga0496111_0123339_111_533 | 130 |
| 67 | 3300048915 | Ga0496112_0017567 | Ga0496112_0017567_2917_3339 | 130 |
| 68 | 3300048916 | Ga0496113_0002800 | Ga0496113_0002800_7877_8299 | 130 |
| 69 | 3300048918 | Ga0496115_0061200 | Ga0496115_0061200_1023_1445 | 130 |
| 70 | 3300049568 | Ga0501031_0098852 | Ga0501031_0098852_369_794 | 130 |
| 71 | 3300049569 | Ga0501032_0015269 | Ga0501032_0015269_2320_2745 | 130 |
| 72 | 3300049569 | Ga0501032_0044630 | Ga0501032_0044630_1781_2200 | 130 |
| 73 | 3300049569 | Ga0501032_0840002 | Ga0501032_0840002_133_558 | 130 |
| 74 | 3300049570 | Ga0501033_0025535 | Ga0501033_0025535_213_638 | 130 |
| 75 | 3300049570 | Ga0501033_0526089 | Ga0501033_0526089_372_797 | 130 |
| 76 | 3300049571 | Ga0501034_0027313 | Ga0501034_0027313_1827_2252 | 130 |
| 77 | 3300049571 | Ga0501034_0282954 | Ga0501034_0282954_1048_1467 | 130 |
| 78 | 3300049572 | Ga0501036_0066228 | Ga0501036_0066228_487_912 | 130 |
| 79 | 3300049572 | Ga0501036_0110127 | Ga0501036_0110127_1295_1720 | 130 |
| 80 | 3300049573 | Ga0501037_0044108 | Ga0501037_0044108_308_733 | 130 |
| 81 | 3300049573 | Ga0501037_0143953 | Ga0501037_0143953_782_1207 | 130 |
| 82 | 3300049573 | Ga0501037_0150424 | Ga0501037_0150424_317_736 | 130 |
| 83 | 3300049574 | Ga0501038_0047718 | Ga0501038_0047718_1558_1983 | 130 |
| 84 | 3300049575 | Ga0501039_0032188 | Ga0501039_0032188_3021_3446 | 130 |
| 85 | 3300049579 | Ga0501043_0065506 | Ga0501043_0065506_1045_1464 | 130 |
| 86 | 3300049579 | Ga0501043_0153705 | Ga0501043_0153705_581_1006 | 130 |
| 87 | 3300049579 | Ga0501043_0407565 | Ga0501043_0407565_44_469 | 130 |
| 88 | 3300049581 | Ga0501047_0054286 | Ga0501047_0054286_1418_1837 | 130 |
| 89 | 3300049581 | Ga0501047_0058262 | Ga0501047_0058262_987_1412 | 130 |
| 90 | 3300049581 | Ga0501047_0320760 | Ga0501047_0320760_728_1153 | 130 |
| 91 | 3300049583 | Ga0501067_0203003 | Ga0501067_0203003_199_624 | 130 |
| 92 | 3300049584 | Ga0501068_0085093 | Ga0501068_0085093_588_1007 | 130 |
| 93 | 3300049585 | Ga0501069_0121497 | Ga0501069_0121497_293_718 | 130 |
| 94 | 3300049586 | Ga0501070_0071101 | Ga0501070_0071101_1866_2291 | 130 |
| 95 | 3300049586 | Ga0501070_0100722 | Ga0501070_0100722_1801_2226 | 130 |
| 96 | 3300049589 | Ga0501073_0015858 | Ga0501073_0015858_1890_2309 | 130 |
| 97 | 3300049590 | Ga0501074_0162484 | Ga0501074_0162484_386_811 | 130 |
| 98 | 3300049590 | Ga0501074_0911273 | Ga0501074_0911273_112_537 | 130 |
| 99 | 3300049741 | Ga0501079_0376994 | Ga0501079_0376994_287_712 | 130 |
| 100 | 3300049742 | Ga0501080_0087621 | Ga0501080_0087621_372_797 | 130 |
| 101 | 3300049742 | Ga0501080_0113880 | Ga0501080_0113880_1835_2260 | 130 |
| 102 | 3300049744 | Ga0501083_0101701 | Ga0501083_0101701_858_1277 | 130 |
| 103 | 3300049822 | Ga0501035_0064401 | Ga0501035_0064401_1860_2285 | 130 |
| 104 | 3300049823 | Ga0501044_0081705 | Ga0501044_0081705_525_950 | 130 |
| 105 | 3300049823 | Ga0501044_0107001 | Ga0501044_0107001_930_1355 | 130 |
| 106 | 3300049823 | Ga0501044_0149655 | Ga0501044_0149655_1280_1699 | 130 |
| 107 | 3300049823 | Ga0501044_0471796 | Ga0501044_0471796_334_753 | 130 |
| 108 | 3300050507 | nmdc:mga05p37_62866_c1 | nmdc:mga05p37_62866_c1_1697_2122 | 130 |
| 109 | 3300050508 | nmdc:mga09592_887928_c1 | nmdc:mga09592_887928_c1_60_485 | 130 |
| 110 | 3300050513 | nmdc:mga0rr50_614393_c1 | nmdc:mga0rr50_614393_c1_445_870 | 130 |
| 111 | 3300053153 | Ga0500616_0004537 | Ga0500616_0004537_1045_1464 | 130 |
| 112 | 3300053736 | Ga0500599_067584 | Ga0500599_067584_20_439 | 130 |
| 113 | 3300001976 | JGI24752J21851_1011925 | JGI24752J21851_10119252 | 131 |
| 114 | 3300002070 | JGI24750J21931_1022732 | JGI24750J21931_10227322 | 131 |
| 115 | 3300002155 | JGI24033J26618_1034978 | JGI24033J26618_10349782 | 131 |
| 116 | 3300002239 | JGI24034J26672_10006795 | JGI24034J26672_100067952 | 131 |
| 117 | 3300002244 | JGI24742J22300_10006754 | JGI24742J22300_100067542 | 131 |
| 118 | 3300005295 | Ga0065707_10141329 | Ga0065707_101413292 | 131 |
| 119 | 3300005327 | Ga0070658_10338868 | Ga0070658_103388682 | 131 |
| 120 | 3300005328 | Ga0070676_10410820 | Ga0070676_104108202 | 131 |
| 121 | 3300005329 | Ga0070683_100713126 | Ga0070683_1007131262 | 131 |
| 122 | 3300005330 | Ga0070690_100004750 | Ga0070690_1000047503 | 131 |
| 123 | 3300005331 | Ga0070670_100077822 | Ga0070670_1000778222 | 131 |
| 124 | 3300005335 | Ga0070666_10100412 | Ga0070666_101004122 | 131 |
| 125 | 3300005337 | Ga0070682_100754479 | Ga0070682_1007544792 | 131 |
| 126 | 3300005338 | Ga0068868_100009579 | Ga0068868_1000095794 | 131 |
| 127 | 3300005339 | Ga0070660_100704625 | Ga0070660_1007046251 | 131 |
| 128 | 3300005341 | Ga0070691_10060524 | Ga0070691_100605242 | 131 |
| 129 | 3300005343 | Ga0070687_100001901 | Ga0070687_1000019012 | 131 |
| 130 | 3300005347 | Ga0070668_100147565 | Ga0070668_1001475652 | 131 |
| 131 | 3300005353 | Ga0070669_100018044 | Ga0070669_1000180445 | 131 |
| 132 | 3300005354 | Ga0070675_100073782 | Ga0070675_1000737822 | 131 |
| 133 | 3300005355 | Ga0070671_100013696 | Ga0070671_1000136966 | 131 |
| 134 | 3300005364 | Ga0070673_100055829 | Ga0070673_1000558293 | 131 |
| 135 | 3300005365 | Ga0070688_100005391 | Ga0070688_1000053913 | 131 |
| 136 | 3300005366 | Ga0070659_100202939 | Ga0070659_1002029392 | 131 |
| 137 | 3300005437 | Ga0070710_10128963 | Ga0070710_101289632 | 131 |
| 138 | 3300005438 | Ga0070701_10037248 | Ga0070701_100372482 | 131 |
| 139 | 3300005441 | Ga0070700_100032022 | Ga0070700_1000320222 | 131 |
| 140 | 3300005455 | Ga0070663_100097264 | Ga0070663_1000972642 | 131 |
| 141 | 3300005455 | Ga0070663_100347875 | Ga0070663_1003478752 | 131 |
| 142 | 3300005456 | Ga0070678_100046523 | Ga0070678_1000465232 | 131 |
| 143 | 3300005457 | Ga0070662_101160230 | Ga0070662_1011602301 | 131 |
| 144 | 3300005458 | Ga0070681_10798478 | Ga0070681_107984782 | 131 |
| 145 | 3300005459 | Ga0068867_100158454 | Ga0068867_1001584542 | 131 |
| 146 | 3300005466 | Ga0070685_10009588 | Ga0070685_100095883 | 131 |
| 147 | 3300005544 | Ga0070686_100047753 | Ga0070686_1000477532 | 131 |
| 148 | 3300005546 | Ga0070696_100530008 | Ga0070696_1005300082 | 131 |
| 149 | 3300005549 | Ga0070704_100296399 | Ga0070704_1002963992 | 131 |
| 150 | 3300005563 | Ga0068855_102419626 | Ga0068855_1024196261 | 131 |
| 151 | 3300005564 | Ga0070664_100055015 | Ga0070664_1000550153 | 131 |
| 152 | 3300005578 | Ga0068854_100053757 | Ga0068854_1000537572 | 131 |
| 153 | 3300005614 | Ga0068856_100069685 | Ga0068856_1000696853 | 131 |
| 154 | 3300005615 | Ga0070702_100457235 | Ga0070702_1004572352 | 131 |
| 155 | 3300005616 | Ga0068852_100015717 | Ga0068852_1000157172 | 131 |
| 156 | 3300005617 | Ga0068859_100046985 | Ga0068859_1000469854 | 131 |
| 157 | 3300005618 | Ga0068864_101321907 | Ga0068864_1013219072 | 131 |
| 158 | 3300005618 | Ga0068864_101321909 | Ga0068864_1013219092 | 131 |
| 159 | 3300005719 | Ga0068861_100023990 | Ga0068861_1000239902 | 131 |
| 160 | 3300005834 | Ga0068851_10301002 | Ga0068851_103010022 | 131 |
| 161 | 3300005840 | Ga0068870_10024950 | Ga0068870_100249502 | 131 |
| 162 | 3300005841 | Ga0068863_100007995 | Ga0068863_1000079955 | 131 |
| 163 | 3300005842 | Ga0068858_100051014 | Ga0068858_1000510143 | 131 |
| 164 | 3300005843 | Ga0068860_100024209 | Ga0068860_1000242092 | 131 |
| 165 | 3300005844 | Ga0068862_100042098 | Ga0068862_1000420982 | 131 |
| 166 | 3300005937 | Ga0081455_10092919 | Ga0081455_100929193 | 131 |
| 167 | 3300006038 | Ga0075365_10164267 | Ga0075365_101642672 | 131 |
| 168 | 3300006038 | Ga0075365_10690221 | Ga0075365_106902211 | 131 |
| 169 | 3300006173 | Ga0070716_100510115 | Ga0070716_1005101151 | 131 |
| 170 | 3300006175 | Ga0070712_100029025 | Ga0070712_1000290252 | 131 |
| 171 | 3300006177 | Ga0075362_10153827 | Ga0075362_101538272 | 131 |
| 172 | 3300006178 | Ga0075367_10206271 | Ga0075367_102062711 | 131 |
| 173 | 3300006186 | Ga0075369_10269022 | Ga0075369_102690221 | 131 |
| 174 | 3300006195 | Ga0075366_10175307 | Ga0075366_101753072 | 131 |
| 175 | 3300006353 | Ga0075370_10590528 | Ga0075370_105905281 | 131 |
| 176 | 3300006358 | Ga0068871_100197665 | Ga0068871_1001976651 | 131 |
| 177 | 3300006847 | Ga0075431_100015898 | Ga0075431_1000158984 | 131 |
| 178 | 3300006880 | Ga0075429_100305503 | Ga0075429_1003055032 | 131 |
| 179 | 3300006881 | Ga0068865_100025798 | Ga0068865_1000257982 | 131 |
| 180 | 3300006914 | Ga0075436_100782623 | Ga0075436_1007826231 | 131 |
| 181 | 3300006931 | Ga0097620_100046986 | Ga0097620_1000469862 | 131 |
| 182 | 3300007788 | Ga0099795_10057260 | Ga0099795_100572602 | 131 |
| 183 | 3300009011 | Ga0105251_10076254 | Ga0105251_100762542 | 131 |
| 184 | 3300009092 | Ga0105250_10126230 | Ga0105250_101262302 | 131 |
| 185 | 3300009093 | Ga0105240_11479306 | Ga0105240_114793062 | 131 |
| 186 | 3300009094 | Ga0111539_10186184 | Ga0111539_101861841 | 131 |
| 187 | 3300009098 | Ga0105245_10106651 | Ga0105245_101066511 | 131 |
| 188 | 3300009098 | Ga0105245_10567994 | Ga0105245_105679942 | 131 |
| 189 | 3300009101 | Ga0105247_10079448 | Ga0105247_100794482 | 131 |
| 190 | 3300009148 | Ga0105243_10130437 | Ga0105243_101304372 | 131 |
| 191 | 3300009176 | Ga0105242_10012341 | Ga0105242_100123415 | 131 |
| 192 | 3300009177 | Ga0105248_10013945 | Ga0105248_100139453 | 131 |
| 193 | 3300009545 | Ga0105237_10901945 | Ga0105237_109019451 | 131 |
| 194 | 3300009551 | Ga0105238_10018493 | Ga0105238_100184932 | 131 |
| 195 | 3300009553 | Ga0105249_10029823 | Ga0105249_100298232 | 131 |
| 196 | 3300010375 | Ga0105239_10434164 | Ga0105239_104341642 | 131 |
| 197 | 3300011119 | Ga0105246_10122755 | Ga0105246_101227552 | 131 |
| 198 | 3300013102 | Ga0157371_10109500 | Ga0157371_101095002 | 131 |
| 199 | 3300013296 | Ga0157374_10018913 | Ga0157374_100189132 | 131 |
| 200 | 3300014325 | Ga0163163_10152441 | Ga0163163_101524412 | 131 |
| 201 | 3300014326 | Ga0157380_10064729 | Ga0157380_100647294 | 131 |
| 202 | 3300014326 | Ga0157380_10643400 | Ga0157380_106434002 | 131 |
| 203 | 3300014745 | Ga0157377_10024449 | Ga0157377_100244492 | 131 |
| 204 | 3300014968 | Ga0157379_10097715 | Ga0157379_100977152 | 131 |
| 205 | 3300014969 | Ga0157376_10076919 | Ga0157376_100769192 | 131 |
| 206 | 3300017792 | Ga0163161_10008394 | Ga0163161_100083945 | 131 |
| 207 | 3300025261 | Ga0209233_1023036 | Ga0209233_10230363 | 131 |
| 208 | 3300025321 | Ga0207656_10096009 | Ga0207656_100960092 | 131 |
| 209 | 3300025893 | Ga0207682_10076333 | Ga0207682_100763332 | 131 |
| 210 | 3300025898 | Ga0207692_10085845 | Ga0207692_100858452 | 131 |
| 211 | 3300025900 | Ga0207710_10005282 | Ga0207710_100052825 | 131 |
| 212 | 3300025901 | Ga0207688_10000263 | Ga0207688_100002638 | 131 |
| 213 | 3300025904 | Ga0207647_10122036 | Ga0207647_101220362 | 131 |
| 214 | 3300025908 | Ga0207643_10000889 | Ga0207643_100008896 | 131 |
| 215 | 3300025911 | Ga0207654_10353721 | Ga0207654_103537212 | 131 |
| 216 | 3300025915 | Ga0207693_10027936 | Ga0207693_100279362 | 131 |
| 217 | 3300025915 | Ga0207693_10313014 | Ga0207693_103130142 | 131 |
| 218 | 3300025916 | Ga0207663_10129408 | Ga0207663_101294082 | 131 |
| 219 | 3300025916 | Ga0207663_10187916 | Ga0207663_101879162 | 131 |
| 220 | 3300025918 | Ga0207662_10000154 | Ga0207662_1000015410 | 131 |
| 221 | 3300025920 | Ga0207649_10503202 | Ga0207649_105032021 | 131 |
| 222 | 3300025923 | Ga0207681_10377907 | Ga0207681_103779072 | 131 |
| 223 | 3300025925 | Ga0207650_11168550 | Ga0207650_111685501 | 131 |
| 224 | 3300025927 | Ga0207687_10008325 | Ga0207687_100083255 | 131 |
| 225 | 3300025931 | Ga0207644_10023219 | Ga0207644_100232192 | 131 |
| 226 | 3300025933 | Ga0207706_10020484 | Ga0207706_100204848 | 131 |
| 227 | 3300025935 | Ga0207709_10075832 | Ga0207709_100758321 | 131 |
| 228 | 3300025936 | Ga0207670_10020290 | Ga0207670_100202902 | 131 |
| 229 | 3300025938 | Ga0207704_10037137 | Ga0207704_100371372 | 131 |
| 230 | 3300025942 | Ga0207689_10003869 | Ga0207689_100038692 | 131 |
| 231 | 3300025949 | Ga0207667_10459653 | Ga0207667_104596531 | 131 |
| 232 | 3300025960 | Ga0207651_10000900 | Ga0207651_100009006 | 131 |
| 233 | 3300025961 | Ga0207712_10010883 | Ga0207712_100108835 | 131 |
| 234 | 3300025972 | Ga0207668_10895402 | Ga0207668_108954022 | 131 |
| 235 | 3300025981 | Ga0207640_10025032 | Ga0207640_100250322 | 131 |
| 236 | 3300025986 | Ga0207658_10018594 | Ga0207658_100185943 | 131 |
| 237 | 3300026023 | Ga0207677_10010239 | Ga0207677_100102393 | 131 |
| 238 | 3300026035 | Ga0207703_10013883 | Ga0207703_100138832 | 131 |
| 239 | 3300026041 | Ga0207639_10093434 | Ga0207639_100934342 | 131 |
| 240 | 3300026067 | Ga0207678_10029694 | Ga0207678_100296942 | 131 |
| 241 | 3300026075 | Ga0207708_10006322 | Ga0207708_1000632210 | 131 |
| 242 | 3300026078 | Ga0207702_10115998 | Ga0207702_101159982 | 131 |
| 243 | 3300026088 | Ga0207641_10135346 | Ga0207641_101353462 | 131 |
| 244 | 3300026089 | Ga0207648_10001639 | Ga0207648_100016396 | 131 |
| 245 | 3300026095 | Ga0207676_10031583 | Ga0207676_100315831 | 131 |
| 246 | 3300026118 | Ga0207675_100008008 | Ga0207675_1000080086 | 131 |
| 247 | 3300026121 | Ga0207683_10035723 | Ga0207683_100357232 | 131 |
| 248 | 3300026142 | Ga0207698_10004120 | Ga0207698_100041209 | 131 |
| 249 | 3300028379 | Ga0268266_10098922 | Ga0268266_100989222 | 131 |
| 250 | 3300031249 | Ga0265339_10177578 | Ga0265339_101775782 | 131 |
| 251 | 3300034816 | Ga0373930_0061651 | Ga0373930_0061651_127_549 | 131 |
| 252 | 3300034957 | Ga0373938_0182322 | Ga0373938_0182322_84_506 | 131 |
| 253 | 3300035083 | Ga0373926_0033420 | Ga0373926_0033420_1106_1528 | 131 |
| 254 | 3300035084 | Ga0373928_0235041 | Ga0373928_0235041_104_526 | 131 |
| 255 | 3300035089 | Ga0373944_0041525 | Ga0373944_0041525_397_819 | 131 |
| 256 | 3300035112 | Ga0373932_0072417 | Ga0373932_0072417_170_592 | 131 |
| 257 | 3300035112 | Ga0373932_0195610 | Ga0373932_0195610_21_446 | 131 |
| 258 | 3300035116 | Ga0373945_0029135 | Ga0373945_0029135_815_1237 | 131 |
| 259 | 3300035170 | Ga0373943_0022381 | Ga0373943_0022381_70_492 | 131 |
| 260 | 3300035171 | Ga0373946_0147382 | Ga0373946_0147382_111_533 | 131 |
| 261 | 3300035242 | Ga0373962_0076346 | Ga0373962_0076346_141_563 | 131 |
| 262 | 3300035410 | Ga0373924_0344291 | Ga0373924_0344291_96_518 | 131 |
| 263 | 3300035691 | Ga0373931_0085084 | Ga0373931_0085084_575_1000 | 131 |
| 264 | 3300035691 | Ga0373931_0184127 | Ga0373931_0184127_314_736 | 131 |
| 265 | 3300035692 | Ga0373935_0021688 | Ga0373935_0021688_2724_3146 | 131 |
| 266 | 3300035695 | Ga0373927_0210982 | Ga0373927_0210982_256_678 | 131 |
| 267 | 3300035725 | Ga0373947_0042141 | Ga0373947_0042141_627_1049 | 131 |
| 268 | 3300037068 | Ga0373925_0331648 | Ga0373925_0331648_22_444 | 131 |
| 269 | 3300037312 | Ga0395899_0007661 | Ga0395899_0007661_1528_1953 | 131 |
| 270 | 3300037418 | Ga0395900_0002820 | Ga0395900_0002820_13694_14119 | 131 |
| 271 | 3300037466 | Ga0395898_0106187 | Ga0395898_0106187_711_1136 | 131 |
| 272 | 3300037853 | Ga0436364_1286367 | Ga0436364_1286367_2346_2768 | 131 |
| 273 | 3300038443 | Ga0395901_0127978 | Ga0395901_0127978_815_1240 | 131 |
| 274 | 3300039437 | Ga0436365_0130337 | Ga0436365_0130337_455_898 | 131 |
| 275 | 3300039437 | Ga0436365_0722556 | Ga0436365_0722556_31_453 | 131 |
| 276 | 3300041512 | Ga0451853_3077804 | Ga0451853_3077804_174_596 | 131 |
| 277 | 3300046455 | Ga0495603_0019346 | Ga0495603_0019346_984_1406 | 131 |
| 278 | 3300046472 | Ga0495580_0227297 | Ga0495580_0227297_789_1211 | 131 |
| 279 | 3300046473 | Ga0495582_0018577 | Ga0495582_0018577_1898_2320 | 131 |
| 280 | 3300046491 | Ga0495584_0074841 | Ga0495584_0074841_116_538 | 131 |
| 281 | 3300046491 | Ga0495584_0127545 | Ga0495584_0127545_720_1142 | 131 |
| 282 | 3300046492 | Ga0495585_0066829 | Ga0495585_0066829_682_1104 | 131 |
| 283 | 3300046492 | Ga0495585_0149042 | Ga0495585_0149042_764_1186 | 131 |
| 284 | 3300046492 | Ga0495585_0556189 | Ga0495585_0556189_85_507 | 131 |
| 285 | 3300046499 | Ga0495594_0295731 | Ga0495594_0295731_443_865 | 131 |
| 286 | 3300046501 | Ga0495607_0055693 | Ga0495607_0055693_232_654 | 131 |
| 287 | 3300046513 | Ga0495616_0282392 | Ga0495616_0282392_189_611 | 131 |
| 288 | 3300046515 | Ga0495620_0049417 | Ga0495620_0049417_1340_1762 | 131 |
| 289 | 3300046520 | Ga0495637_0244169 | Ga0495637_0244169_177_599 | 131 |
| 290 | 3300046523 | Ga0495644_0121756 | Ga0495644_0121756_407_829 | 131 |
| 291 | 3300046526 | Ga0495666_0085502 | Ga0495666_0085502_75_497 | 131 |
| 292 | 3300046529 | Ga0495652_0477563 | Ga0495652_0477563_291_713 | 131 |
| 293 | 3300046531 | Ga0495665_0427889 | Ga0495665_0427889_127_549 | 131 |
| 294 | 3300046537 | Ga0495598_0040231 | Ga0495598_0040231_778_1200 | 131 |
| 295 | 3300046537 | Ga0495598_0060701 | Ga0495598_0060701_183_605 | 131 |
| 296 | 3300046539 | Ga0495621_0122795 | Ga0495621_0122795_362_784 | 131 |
| 297 | 3300046543 | Ga0495645_0185944 | Ga0495645_0185944_542_964 | 131 |
| 298 | 3300046615 | Ga0495656_0009556 | Ga0495656_0009556_2286_2708 | 131 |
| 299 | 3300046615 | Ga0495656_0420483 | Ga0495656_0420483_183_605 | 131 |
| 300 | 3300046616 | Ga0495668_0087643 | Ga0495668_0087643_64_486 | 131 |
| 301 | 3300046681 | Ga0495647_0026623 | Ga0495647_0026623_1228_1650 | 131 |
| 302 | 3300046683 | Ga0495658_0142187 | Ga0495658_0142187_387_809 | 131 |
| 303 | 3300046690 | Ga0495624_0053551 | Ga0495624_0053551_1611_2033 | 131 |
| 304 | 3300046691 | Ga0495670_0191884 | Ga0495670_0191884_564_986 | 131 |
| 305 | 3300046794 | Ga0495589_0040148 | Ga0495589_0040148_1603_2025 | 131 |
| 306 | 3300047317 | Ga0495604_0105809 | Ga0495604_0105809_1197_1619 | 131 |
| 307 | 3300047321 | Ga0495676_0095528 | Ga0495676_0095528_115_537 | 131 |
| 308 | 3300047323 | Ga0495683_0152824 | Ga0495683_0152824_302_724 | 131 |
| 309 | 3300047445 | Ga0495677_0061234 | Ga0495677_0061234_468_890 | 131 |
| 310 | 3300047446 | Ga0495679_066200 | Ga0495679_066200_40_462 | 131 |
| 311 | 3300048090 | Ga0495615_0227393 | Ga0495615_0227393_139_561 | 131 |
| 312 | 3300048903 | Ga0496100_0089349 | Ga0496100_0089349_1121_1543 | 131 |
| 313 | 3300048904 | Ga0496101_0004213 | Ga0496101_0004213_2908_3330 | 131 |
| 314 | 3300048905 | Ga0496102_0092434 | Ga0496102_0092434_232_654 | 131 |
| 315 | 3300048906 | Ga0496103_0003429 | Ga0496103_0003429_684_1106 | 131 |
| 316 | 3300048907 | Ga0496104_0149939 | Ga0496104_0149939_1377_1799 | 131 |
| 317 | 3300048907 | Ga0496104_0168778 | Ga0496104_0168778_1121_1543 | 131 |
| 318 | 3300048910 | Ga0496107_0008057 | Ga0496107_0008057_4822_5244 | 131 |
| 319 | 3300048911 | Ga0496108_0008243 | Ga0496108_0008243_684_1106 | 131 |
| 320 | 3300048911 | Ga0496108_1148920 | Ga0496108_1148920_93_515 | 131 |
| 321 | 3300048912 | Ga0496109_0023515 | Ga0496109_0023515_54_476 | 131 |
| 322 | 3300048913 | Ga0496110_0558874 | Ga0496110_0558874_409_831 | 131 |
| 323 | 3300048914 | Ga0496111_0003286 | Ga0496111_0003286_2859_3281 | 131 |
| 324 | 3300048914 | Ga0496111_0761276 | Ga0496111_0761276_22_444 | 131 |
| 325 | 3300048915 | Ga0496112_0034589 | Ga0496112_0034589_3656_4078 | 131 |
| 326 | 3300048915 | Ga0496112_0672495 | Ga0496112_0672495_211_633 | 131 |
| 327 | 3300049579 | Ga0501043_0899213 | Ga0501043_0899213_23_445 | 131 |
| 328 | 3300049592 | Ga0501076_0747978 | Ga0501076_0747978_20_442 | 131 |
| 329 | 3300049593 | Ga0501077_0016202 | Ga0501077_0016202_583_1005 | 131 |
| 330 | 3300049744 | Ga0501083_0025847 | Ga0501083_0025847_1618_2040 | 131 |
| 331 | 3300050491 | nmdc:mga00v17_252254_c1 | nmdc:mga00v17_252254_c1_190_612 | 131 |
| 332 | 3300050492 | nmdc:mga0yw44_1008_c1 | nmdc:mga0yw44_1008_c1_1497_1919 | 131 |
| 333 | 3300050492 | nmdc:mga0yw44_157337_c1 | nmdc:mga0yw44_157337_c1_407_829 | 131 |
| 334 | 3300050494 | nmdc:mga06z11_137950_c1 | nmdc:mga06z11_137950_c1_324_746 | 131 |
| 335 | 3300050496 | nmdc:mga07m45_355593_c1 | nmdc:mga07m45_355593_c1_375_797 | 131 |
| 336 | 3300050510 | nmdc:mga06r32_68955_c1 | nmdc:mga06r32_68955_c1_1385_1807 | 131 |
| 337 | 3300050511 | nmdc:mga08y16_170558_c1 | nmdc:mga08y16_170558_c1_1267_1689 | 131 |
| 338 | 3300053084 | Ga0495595_0249666 | Ga0495595_0249666_243_665 | 131 |
| 339 | 3300054114 | Ga0501084_0637963 | Ga0501084_0637963_288_710 | 131 |
| 340 | 3300000041 | ARcpr5oldR_c013089 | ARcpr5oldR_0130892 | 132 |
| 341 | 3300005289 | Ga0065704_10756000 | Ga0065704_107560001 | 132 |
| 342 | 3300005327 | Ga0070658_10079763 | Ga0070658_100797634 | 132 |
| 343 | 3300005327 | Ga0070658_10267551 | Ga0070658_102675512 | 132 |
| 344 | 3300005329 | Ga0070683_100089578 | Ga0070683_1000895782 | 132 |
| 345 | 3300005329 | Ga0070683_101019127 | Ga0070683_1010191271 | 132 |
| 346 | 3300005330 | Ga0070690_100272104 | Ga0070690_1002721042 | 132 |
| 347 | 3300005334 | Ga0068869_100160140 | Ga0068869_1001601402 | 132 |
| 348 | 3300005335 | Ga0070666_10005333 | Ga0070666_100053333 | 132 |
| 349 | 3300005336 | Ga0070680_100011041 | Ga0070680_1000110414 | 132 |
| 350 | 3300005336 | Ga0070680_100048701 | Ga0070680_1000487012 | 132 |
| 351 | 3300005337 | Ga0070682_100153679 | Ga0070682_1001536792 | 132 |
| 352 | 3300005338 | Ga0068868_100203154 | Ga0068868_1002031542 | 132 |
| 353 | 3300005339 | Ga0070660_100026110 | Ga0070660_1000261103 | 132 |
| 354 | 3300005340 | Ga0070689_100326574 | Ga0070689_1003265742 | 132 |
| 355 | 3300005347 | Ga0070668_100516722 | Ga0070668_1005167222 | 132 |
| 356 | 3300005355 | Ga0070671_100111917 | Ga0070671_1001119172 | 132 |
| 357 | 3300005356 | Ga0070674_100216482 | Ga0070674_1002164822 | 132 |
| 358 | 3300005365 | Ga0070688_100025542 | Ga0070688_1000255423 | 132 |
| 359 | 3300005367 | Ga0070667_100015010 | Ga0070667_1000150104 | 132 |
| 360 | 3300005434 | Ga0070709_10011165 | Ga0070709_100111653 | 132 |
| 361 | 3300005435 | Ga0070714_100051098 | Ga0070714_1000510983 | 132 |
| 362 | 3300005436 | Ga0070713_100012585 | Ga0070713_1000125852 | 132 |
| 363 | 3300005437 | Ga0070710_10008108 | Ga0070710_100081082 | 132 |
| 364 | 3300005438 | Ga0070701_10534913 | Ga0070701_105349132 | 132 |
| 365 | 3300005439 | Ga0070711_100124408 | Ga0070711_1001244082 | 132 |
| 366 | 3300005440 | Ga0070705_100377861 | Ga0070705_1003778611 | 132 |
| 367 | 3300005441 | Ga0070700_100202336 | Ga0070700_1002023362 | 132 |
| 368 | 3300005455 | Ga0070663_100260532 | Ga0070663_1002605322 | 132 |
| 369 | 3300005458 | Ga0070681_10040444 | Ga0070681_100404444 | 132 |
| 370 | 3300005458 | Ga0070681_10406289 | Ga0070681_104062891 | 132 |
| 371 | 3300005458 | Ga0070681_10700047 | Ga0070681_107000471 | 132 |
| 372 | 3300005459 | Ga0068867_100418996 | Ga0068867_1004189962 | 132 |
| 373 | 3300005466 | Ga0070685_10244574 | Ga0070685_102445742 | 132 |
| 374 | 3300005530 | Ga0070679_100082606 | Ga0070679_1000826064 | 132 |
| 375 | 3300005530 | Ga0070679_100252520 | Ga0070679_1002525202 | 132 |
| 376 | 3300005530 | Ga0070679_100277019 | Ga0070679_1002770192 | 132 |
| 377 | 3300005535 | Ga0070684_100311377 | Ga0070684_1003113772 | 132 |
| 378 | 3300005539 | Ga0068853_100328557 | Ga0068853_1003285572 | 132 |
| 379 | 3300005539 | Ga0068853_100418783 | Ga0068853_1004187832 | 132 |
| 380 | 3300005544 | Ga0070686_100021647 | Ga0070686_1000216473 | 132 |
| 381 | 3300005546 | Ga0070696_100309883 | Ga0070696_1003098831 | 132 |
| 382 | 3300005547 | Ga0070693_100491668 | Ga0070693_1004916682 | 132 |
| 383 | 3300005548 | Ga0070665_100234794 | Ga0070665_1002347942 | 132 |
| 384 | 3300005549 | Ga0070704_100739494 | Ga0070704_1007394942 | 132 |
| 385 | 3300005563 | Ga0068855_100034429 | Ga0068855_1000344296 | 132 |
| 386 | 3300005563 | Ga0068855_100046361 | Ga0068855_1000463613 | 132 |
| 387 | 3300005563 | Ga0068855_100454307 | Ga0068855_1004543072 | 132 |
| 388 | 3300005564 | Ga0070664_100096824 | Ga0070664_1000968242 | 132 |
| 389 | 3300005564 | Ga0070664_101950108 | Ga0070664_1019501081 | 132 |
| 390 | 3300005577 | Ga0068857_100508115 | Ga0068857_1005081152 | 132 |
| 391 | 3300005578 | Ga0068854_101150832 | Ga0068854_1011508321 | 132 |
| 392 | 3300005614 | Ga0068856_100059622 | Ga0068856_1000596225 | 132 |
| 393 | 3300005614 | Ga0068856_101116249 | Ga0068856_1011162491 | 132 |
| 394 | 3300005614 | Ga0068856_101281959 | Ga0068856_1012819592 | 132 |
| 395 | 3300005615 | Ga0070702_100019921 | Ga0070702_1000199212 | 132 |
| 396 | 3300005616 | Ga0068852_100015569 | Ga0068852_1000155695 | 132 |
| 397 | 3300005616 | Ga0068852_100491691 | Ga0068852_1004916912 | 132 |
| 398 | 3300005617 | Ga0068859_100077641 | Ga0068859_1000776412 | 132 |
| 399 | 3300005618 | Ga0068864_100178406 | Ga0068864_1001784062 | 132 |
| 400 | 3300005718 | Ga0068866_10194272 | Ga0068866_101942722 | 132 |
| 401 | 3300005719 | Ga0068861_100465344 | Ga0068861_1004653442 | 132 |
| 402 | 3300005834 | Ga0068851_10250166 | Ga0068851_102501662 | 132 |
| 403 | 3300005841 | Ga0068863_100177973 | Ga0068863_1001779732 | 132 |
| 404 | 3300005842 | Ga0068858_100413605 | Ga0068858_1004136052 | 132 |
| 405 | 3300005843 | Ga0068860_100132560 | Ga0068860_1001325602 | 132 |
| 406 | 3300005983 | Ga0081540_1005514 | Ga0081540_10055142 | 132 |
| 407 | 3300006028 | Ga0070717_10001862 | Ga0070717_100018624 | 132 |
| 408 | 3300006058 | Ga0075432_10003683 | Ga0075432_100036834 | 132 |
| 409 | 3300006173 | Ga0070716_100003599 | Ga0070716_1000035992 | 132 |
| 410 | 3300006175 | Ga0070712_100365986 | Ga0070712_1003659862 | 132 |
| 411 | 3300006194 | Ga0075427_10006245 | Ga0075427_100062452 | 132 |
| 412 | 3300006237 | Ga0097621_100014218 | Ga0097621_1000142182 | 132 |
| 413 | 3300006358 | Ga0068871_100120498 | Ga0068871_1001204982 | 132 |
| 414 | 3300006844 | Ga0075428_100016183 | Ga0075428_1000161835 | 132 |
| 415 | 3300006846 | Ga0075430_100002056 | Ga0075430_1000020563 | 132 |
| 416 | 3300006847 | Ga0075431_100003489 | Ga0075431_1000034893 | 132 |
| 417 | 3300006852 | Ga0075433_10000975 | Ga0075433_100009752 | 132 |
| 418 | 3300006871 | Ga0075434_100009141 | Ga0075434_1000091415 | 132 |
| 419 | 3300006871 | Ga0075434_100097339 | Ga0075434_1000973392 | 132 |
| 420 | 3300006880 | Ga0075429_100003309 | Ga0075429_1000033096 | 132 |
| 421 | 3300006931 | Ga0097620_100077644 | Ga0097620_1000776442 | 132 |
| 422 | 3300007076 | Ga0075435_100013273 | Ga0075435_1000132733 | 132 |
| 423 | 3300009011 | Ga0105251_10390841 | Ga0105251_103908412 | 132 |
| 424 | 3300009092 | Ga0105250_10228553 | Ga0105250_102285532 | 132 |
| 425 | 3300009093 | Ga0105240_10139397 | Ga0105240_101393972 | 132 |
| 426 | 3300009093 | Ga0105240_10448727 | Ga0105240_104487271 | 132 |
| 427 | 3300009093 | Ga0105240_10625281 | Ga0105240_106252812 | 132 |
| 428 | 3300009094 | Ga0111539_10000528 | Ga0111539_100005285 | 132 |
| 429 | 3300009098 | Ga0105245_10068932 | Ga0105245_100689323 | 132 |
| 430 | 3300009101 | Ga0105247_10048801 | Ga0105247_100488013 | 132 |
| 431 | 3300009147 | Ga0114129_10001477 | Ga0114129_100014775 | 132 |
| 432 | 3300009148 | Ga0105243_10038896 | Ga0105243_100388962 | 132 |
| 433 | 3300009176 | Ga0105242_10039122 | Ga0105242_100391222 | 132 |
| 434 | 3300009177 | Ga0105248_10241572 | Ga0105248_102415722 | 132 |
| 435 | 3300009545 | Ga0105237_10504905 | Ga0105237_105049052 | 132 |
| 436 | 3300009551 | Ga0105238_10403418 | Ga0105238_104034181 | 132 |
| 437 | 3300009551 | Ga0105238_10698658 | Ga0105238_106986582 | 132 |
| 438 | 3300010375 | Ga0105239_10228481 | Ga0105239_102284812 | 132 |
| 439 | 3300011119 | Ga0105246_10982887 | Ga0105246_109828871 | 132 |
| 440 | 3300012483 | Ga0157337_1000643 | Ga0157337_10006432 | 132 |
| 441 | 3300013100 | Ga0157373_10067799 | Ga0157373_100677993 | 132 |
| 442 | 3300013100 | Ga0157373_10667678 | Ga0157373_106676782 | 132 |
| 443 | 3300013102 | Ga0157371_10322111 | Ga0157371_103221111 | 132 |
| 444 | 3300013102 | Ga0157371_10368375 | Ga0157371_103683752 | 132 |
| 445 | 3300013104 | Ga0157370_10137309 | Ga0157370_101373092 | 132 |
| 446 | 3300013104 | Ga0157370_11423349 | Ga0157370_114233492 | 132 |
| 447 | 3300013105 | Ga0157369_10119677 | Ga0157369_101196772 | 132 |
| 448 | 3300013105 | Ga0157369_10295835 | Ga0157369_102958352 | 132 |
| 449 | 3300013296 | Ga0157374_10890242 | Ga0157374_108902422 | 132 |
| 450 | 3300013297 | Ga0157378_10047440 | Ga0157378_100474403 | 132 |
| 451 | 3300013306 | Ga0163162_12045174 | Ga0163162_120451741 | 132 |
| 452 | 3300013306 | Ga0163162_12352795 | Ga0163162_123527952 | 132 |
| 453 | 3300013307 | Ga0157372_10154780 | Ga0157372_101547801 | 132 |
| 454 | 3300013307 | Ga0157372_10997970 | Ga0157372_109979702 | 132 |
| 455 | 3300013307 | Ga0157372_11083179 | Ga0157372_110831792 | 132 |
| 456 | 3300013307 | Ga0157372_11165292 | Ga0157372_111652921 | 132 |
| 457 | 3300013308 | Ga0157375_10927554 | Ga0157375_109275542 | 132 |
| 458 | 3300014325 | Ga0163163_10300859 | Ga0163163_103008592 | 132 |
| 459 | 3300014968 | Ga0157379_10218083 | Ga0157379_102180832 | 132 |
| 460 | 3300014968 | Ga0157379_10475732 | Ga0157379_104757322 | 132 |
| 461 | 3300014969 | Ga0157376_10611885 | Ga0157376_106118852 | 132 |
| 462 | 3300017792 | Ga0163161_10900074 | Ga0163161_109000742 | 132 |
| 463 | 3300020081 | Ga0206354_11271362 | Ga0206354_112713622 | 132 |
| 464 | 3300025735 | Ga0207713_1177315 | Ga0207713_11773152 | 132 |
| 465 | 3300025898 | Ga0207692_10000849 | Ga0207692_100008495 | 132 |
| 466 | 3300025899 | Ga0207642_10063491 | Ga0207642_100634912 | 132 |
| 467 | 3300025900 | Ga0207710_10051963 | Ga0207710_100519632 | 132 |
| 468 | 3300025903 | Ga0207680_10227257 | Ga0207680_102272572 | 132 |
| 469 | 3300025905 | Ga0207685_10004719 | Ga0207685_100047193 | 132 |
| 470 | 3300025906 | Ga0207699_10015354 | Ga0207699_100153543 | 132 |
| 471 | 3300025909 | Ga0207705_10104154 | Ga0207705_101041542 | 132 |
| 472 | 3300025909 | Ga0207705_10364742 | Ga0207705_103647422 | 132 |
| 473 | 3300025912 | Ga0207707_10255296 | Ga0207707_102552962 | 132 |
| 474 | 3300025912 | Ga0207707_10938910 | Ga0207707_109389101 | 132 |
| 475 | 3300025913 | Ga0207695_10084346 | Ga0207695_100843463 | 132 |
| 476 | 3300025916 | Ga0207663_10010022 | Ga0207663_100100222 | 132 |
| 477 | 3300025916 | Ga0207663_10231348 | Ga0207663_102313482 | 132 |
| 478 | 3300025917 | Ga0207660_10071085 | Ga0207660_100710853 | 132 |
| 479 | 3300025918 | Ga0207662_10822231 | Ga0207662_108222312 | 132 |
| 480 | 3300025919 | Ga0207657_10030200 | Ga0207657_100302003 | 132 |
| 481 | 3300025919 | Ga0207657_10046045 | Ga0207657_100460452 | 132 |
| 482 | 3300025919 | Ga0207657_10049848 | Ga0207657_100498482 | 132 |
| 483 | 3300025920 | Ga0207649_10426105 | Ga0207649_104261052 | 132 |
| 484 | 3300025921 | Ga0207652_10045626 | Ga0207652_100456262 | 132 |
| 485 | 3300025921 | Ga0207652_10065293 | Ga0207652_100652934 | 132 |
| 486 | 3300025921 | Ga0207652_10263380 | Ga0207652_102633802 | 132 |
| 487 | 3300025921 | Ga0207652_11002585 | Ga0207652_110025852 | 132 |
| 488 | 3300025924 | Ga0207694_10018170 | Ga0207694_100181703 | 132 |
| 489 | 3300025924 | Ga0207694_11189101 | Ga0207694_111891011 | 132 |
| 490 | 3300025925 | Ga0207650_10019781 | Ga0207650_100197812 | 132 |
| 491 | 3300025927 | Ga0207687_10020528 | Ga0207687_100205284 | 132 |
| 492 | 3300025928 | Ga0207700_10000290 | Ga0207700_1000029014 | 132 |
| 493 | 3300025929 | Ga0207664_10011397 | Ga0207664_100113973 | 132 |
| 494 | 3300025929 | Ga0207664_10148360 | Ga0207664_101483602 | 132 |
| 495 | 3300025931 | Ga0207644_10114016 | Ga0207644_101140162 | 132 |
| 496 | 3300025934 | Ga0207686_10143841 | Ga0207686_101438412 | 132 |
| 497 | 3300025934 | Ga0207686_10187036 | Ga0207686_101870362 | 132 |
| 498 | 3300025935 | Ga0207709_10386909 | Ga0207709_103869092 | 132 |
| 499 | 3300025936 | Ga0207670_10066843 | Ga0207670_100668433 | 132 |
| 500 | 3300025937 | Ga0207669_10051306 | Ga0207669_100513063 | 132 |
| 501 | 3300025938 | Ga0207704_11367885 | Ga0207704_113678852 | 132 |
| 502 | 3300025939 | Ga0207665_10000719 | Ga0207665_1000071912 | 132 |
| 503 | 3300025940 | Ga0207691_10783504 | Ga0207691_107835042 | 132 |
| 504 | 3300025941 | Ga0207711_10037954 | Ga0207711_100379543 | 132 |
| 505 | 3300025942 | Ga0207689_10052656 | Ga0207689_100526562 | 132 |
| 506 | 3300025944 | Ga0207661_10115604 | Ga0207661_101156043 | 132 |
| 507 | 3300025944 | Ga0207661_10358056 | Ga0207661_103580562 | 132 |
| 508 | 3300025945 | Ga0207679_10441782 | Ga0207679_104417822 | 132 |
| 509 | 3300025949 | Ga0207667_10021843 | Ga0207667_100218436 | 132 |
| 510 | 3300025949 | Ga0207667_10119538 | Ga0207667_101195382 | 132 |
| 511 | 3300025960 | Ga0207651_10025682 | Ga0207651_100256822 | 132 |
| 512 | 3300025961 | Ga0207712_10165155 | Ga0207712_101651552 | 132 |
| 513 | 3300025972 | Ga0207668_10081158 | Ga0207668_100811582 | 132 |
| 514 | 3300025981 | Ga0207640_10444288 | Ga0207640_104442882 | 132 |
| 515 | 3300025986 | Ga0207658_10034145 | Ga0207658_100341453 | 132 |
| 516 | 3300026023 | Ga0207677_10115356 | Ga0207677_101153562 | 132 |
| 517 | 3300026035 | Ga0207703_10012561 | Ga0207703_100125614 | 132 |
| 518 | 3300026041 | Ga0207639_10415489 | Ga0207639_104154892 | 132 |
| 519 | 3300026067 | Ga0207678_10006545 | Ga0207678_100065456 | 132 |
| 520 | 3300026078 | Ga0207702_10036530 | Ga0207702_100365302 | 132 |
| 521 | 3300026078 | Ga0207702_10341752 | Ga0207702_103417522 | 132 |
| 522 | 3300026078 | Ga0207702_10647095 | Ga0207702_106470952 | 132 |
| 523 | 3300026078 | Ga0207702_11117600 | Ga0207702_111176002 | 132 |
| 524 | 3300026078 | Ga0207702_11233472 | Ga0207702_112334721 | 132 |
| 525 | 3300026095 | Ga0207676_10091150 | Ga0207676_100911502 | 132 |
| 526 | 3300026116 | Ga0207674_10390731 | Ga0207674_103907312 | 132 |
| 527 | 3300026116 | Ga0207674_11772636 | Ga0207674_117726361 | 132 |
| 528 | 3300026118 | Ga0207675_100476902 | Ga0207675_1004769022 | 132 |
| 529 | 3300026121 | Ga0207683_10001293 | Ga0207683_100012936 | 132 |
| 530 | 3300026142 | Ga0207698_10017188 | Ga0207698_100171881 | 132 |
| 531 | 3300026142 | Ga0207698_10092670 | Ga0207698_100926703 | 132 |
| 532 | 3300026142 | Ga0207698_10258184 | Ga0207698_102581842 | 132 |
| 533 | 3300027907 | Ga0207428_10000291 | Ga0207428_1000029158 | 132 |
| 534 | 3300028379 | Ga0268266_10047490 | Ga0268266_100474903 | 132 |
| 535 | 3300031235 | Ga0265330_10012435 | Ga0265330_100124353 | 132 |
| 536 | 3300031241 | Ga0265325_10008234 | Ga0265325_100082343 | 132 |
| 537 | 3300031595 | Ga0265313_10010630 | Ga0265313_100106305 | 132 |
| 538 | 3300031595 | Ga0265313_10095574 | Ga0265313_100955741 | 132 |
| 539 | 3300031712 | Ga0265342_10001132 | Ga0265342_100011323 | 132 |
| 540 | 3300034816 | Ga0373930_0010716 | Ga0373930_0010716_750_1175 | 132 |
| 541 | 3300034957 | Ga0373938_0012517 | Ga0373938_0012517_1046_1471 | 132 |
| 542 | 3300035083 | Ga0373926_0003254 | Ga0373926_0003254_1529_1954 | 132 |
| 543 | 3300035084 | Ga0373928_0003461 | Ga0373928_0003461_1057_1482 | 132 |
| 544 | 3300035085 | Ga0373929_0071923 | Ga0373929_0071923_39_464 | 132 |
| 545 | 3300035089 | Ga0373944_0002442 | Ga0373944_0002442_602_1027 | 132 |
| 546 | 3300035090 | Ga0373949_0007797 | Ga0373949_0007797_850_1275 | 132 |
| 547 | 3300035091 | Ga0373951_0048220 | Ga0373951_0048220_440_865 | 132 |
| 548 | 3300035112 | Ga0373932_0008691 | Ga0373932_0008691_1398_1823 | 132 |
| 549 | 3300035113 | Ga0373936_0001218 | Ga0373936_0001218_3031_3456 | 132 |
| 550 | 3300035115 | Ga0373941_0049948 | Ga0373941_0049948_294_719 | 132 |
| 551 | 3300035116 | Ga0373945_0025022 | Ga0373945_0025022_742_1167 | 132 |
| 552 | 3300035120 | Ga0373957_0021460 | Ga0373957_0021460_1319_1744 | 132 |
| 553 | 3300035121 | Ga0373960_0002561 | Ga0373960_0002561_3048_3473 | 132 |
| 554 | 3300035170 | Ga0373943_0007114 | Ga0373943_0007114_431_856 | 132 |
| 555 | 3300035170 | Ga0373943_0034507 | Ga0373943_0034507_622_1047 | 132 |
| 556 | 3300035171 | Ga0373946_0001618 | Ga0373946_0001618_5086_5511 | 132 |
| 557 | 3300035171 | Ga0373946_0024824 | Ga0373946_0024824_1257_1682 | 132 |
| 558 | 3300035172 | Ga0373955_0005754 | Ga0373955_0005754_3394_3819 | 132 |
| 559 | 3300035207 | Ga0373942_0001847 | Ga0373942_0001847_4665_5090 | 132 |
| 560 | 3300035241 | Ga0373961_0033656 | Ga0373961_0033656_197_622 | 132 |
| 561 | 3300035242 | Ga0373962_0128593 | Ga0373962_0128593_298_723 | 132 |
| 562 | 3300035410 | Ga0373924_0088592 | Ga0373924_0088592_510_935 | 132 |
| 563 | 3300035691 | Ga0373931_0009468 | Ga0373931_0009468_3993_4418 | 132 |
| 564 | 3300035692 | Ga0373935_0015189 | Ga0373935_0015189_1739_2164 | 132 |
| 565 | 3300035692 | Ga0373935_0209387 | Ga0373935_0209387_730_1155 | 132 |
| 566 | 3300035695 | Ga0373927_0023883 | Ga0373927_0023883_2208_2633 | 132 |
| 567 | 3300035724 | Ga0373933_0124674 | Ga0373933_0124674_936_1361 | 132 |
| 568 | 3300035725 | Ga0373947_0000874 | Ga0373947_0000874_405_830 | 132 |
| 569 | 3300035725 | Ga0373947_0148838 | Ga0373947_0148838_601_1026 | 132 |
| 570 | 3300037068 | Ga0373925_0013063 | Ga0373925_0013063_5573_5998 | 132 |
| 571 | 3300037068 | Ga0373925_0033677 | Ga0373925_0033677_233_658 | 132 |
| 572 | 3300044842 | Ga0466957_0579864 | Ga0466957_0579864_214_639 | 132 |
| 573 | 3300046452 | Ga0495617_038309 | Ga0495617_038309_1028_1453 | 132 |
| 574 | 3300046454 | Ga0495592_0086248 | Ga0495592_0086248_795_1220 | 132 |
| 575 | 3300046455 | Ga0495603_0005459 | Ga0495603_0005459_2292_2717 | 132 |
| 576 | 3300046455 | Ga0495603_0049120 | Ga0495603_0049120_1381_1806 | 132 |
| 577 | 3300046459 | Ga0495629_0000329 | Ga0495629_0000329_9826_10251 | 132 |
| 578 | 3300046459 | Ga0495629_0063291 | Ga0495629_0063291_601_1026 | 132 |
| 579 | 3300046461 | Ga0495641_0009078 | Ga0495641_0009078_1277_1702 | 132 |
| 580 | 3300046461 | Ga0495641_0050896 | Ga0495641_0050896_578_1003 | 132 |
| 581 | 3300046462 | Ga0495651_0008552 | Ga0495651_0008552_2375_2800 | 132 |
| 582 | 3300046463 | Ga0495653_0112173 | Ga0495653_0112173_1489_1914 | 132 |
| 583 | 3300046472 | Ga0495580_0003611 | Ga0495580_0003611_6294_6719 | 132 |
| 584 | 3300046473 | Ga0495582_0054817 | Ga0495582_0054817_1729_2154 | 132 |
| 585 | 3300046473 | Ga0495582_0083289 | Ga0495582_0083289_307_732 | 132 |
| 586 | 3300046475 | Ga0495639_0007456 | Ga0495639_0007456_1393_1818 | 132 |
| 587 | 3300046476 | Ga0495662_0033343 | Ga0495662_0033343_172_597 | 132 |
| 588 | 3300046477 | Ga0495664_0009503 | Ga0495664_0009503_3040_3465 | 132 |
| 589 | 3300046491 | Ga0495584_0015175 | Ga0495584_0015175_275_700 | 132 |
| 590 | 3300046499 | Ga0495594_0028755 | Ga0495594_0028755_1558_1983 | 132 |
| 591 | 3300046499 | Ga0495594_0127347 | Ga0495594_0127347_126_551 | 132 |
| 592 | 3300046500 | Ga0495596_0260973 | Ga0495596_0260973_177_602 | 132 |
| 593 | 3300046511 | Ga0495608_0146790 | Ga0495608_0146790_917_1342 | 132 |
| 594 | 3300046517 | Ga0495630_0067980 | Ga0495630_0067980_1773_2198 | 132 |
| 595 | 3300046518 | Ga0495631_0098585 | Ga0495631_0098585_543_968 | 132 |
| 596 | 3300046523 | Ga0495644_0000434 | Ga0495644_0000434_15224_15649 | 132 |
| 597 | 3300046526 | Ga0495666_0015395 | Ga0495666_0015395_1891_2316 | 132 |
| 598 | 3300046529 | Ga0495652_0013346 | Ga0495652_0013346_5865_6290 | 132 |
| 599 | 3300046531 | Ga0495665_0026914 | Ga0495665_0026914_2281_2706 | 132 |
| 600 | 3300046533 | Ga0495640_0056948 | Ga0495640_0056948_481_906 | 132 |
| 601 | 3300046535 | Ga0495586_0028072 | Ga0495586_0028072_2305_2730 | 132 |
| 602 | 3300046536 | Ga0495587_0018879 | Ga0495587_0018879_285_710 | 132 |
| 603 | 3300046537 | Ga0495598_0003767 | Ga0495598_0003767_1320_1745 | 132 |
| 604 | 3300046557 | Ga0495622_0003676 | Ga0495622_0003676_2027_2452 | 132 |
| 605 | 3300046558 | Ga0495633_0000643 | Ga0495633_0000643_3080_3505 | 132 |
| 606 | 3300046559 | Ga0495667_0005122 | Ga0495667_0005122_5737_6162 | 132 |
| 607 | 3300046615 | Ga0495656_0000842 | Ga0495656_0000842_7249_7674 | 132 |
| 608 | 3300046648 | Ga0495611_0004301 | Ga0495611_0004301_2089_2514 | 132 |
| 609 | 3300046663 | Ga0495635_0001379 | Ga0495635_0001379_15028_15453 | 132 |
| 610 | 3300046664 | Ga0495659_0001236 | Ga0495659_0001236_2044_2469 | 132 |
| 611 | 3300046674 | Ga0495588_0025967 | Ga0495588_0025967_1320_1745 | 132 |
| 612 | 3300046678 | Ga0495599_0018912 | Ga0495599_0018912_3460_3885 | 132 |
| 613 | 3300046680 | Ga0495646_0006527 | Ga0495646_0006527_3636_4061 | 132 |
| 614 | 3300046681 | Ga0495647_0002668 | Ga0495647_0002668_1538_1963 | 132 |
| 615 | 3300046681 | Ga0495647_0005000 | Ga0495647_0005000_3316_3741 | 132 |
| 616 | 3300046683 | Ga0495658_0019600 | Ga0495658_0019600_1232_1657 | 132 |
| 617 | 3300046683 | Ga0495658_0032637 | Ga0495658_0032637_1018_1443 | 132 |
| 618 | 3300046683 | Ga0495658_0102097 | Ga0495658_0102097_262_687 | 132 |
| 619 | 3300046689 | Ga0495613_0002281 | Ga0495613_0002281_9043_9468 | 132 |
| 620 | 3300046689 | Ga0495613_0020424 | Ga0495613_0020424_3135_3560 | 132 |
| 621 | 3300046689 | Ga0495613_0095407 | Ga0495613_0095407_1481_1906 | 132 |
| 622 | 3300046690 | Ga0495624_0017283 | Ga0495624_0017283_4248_4673 | 132 |
| 623 | 3300046690 | Ga0495624_0630233 | Ga0495624_0630233_115_540 | 132 |
| 624 | 3300046691 | Ga0495670_0008704 | Ga0495670_0008704_3400_3825 | 132 |
| 625 | 3300046794 | Ga0495589_0109481 | Ga0495589_0109481_130_555 | 132 |
| 626 | 3300046809 | Ga0495600_0007387 | Ga0495600_0007387_129_554 | 132 |
| 627 | 3300046809 | Ga0495600_0131647 | Ga0495600_0131647_368_793 | 132 |
| 628 | 3300047315 | Ga0495581_0061310 | Ga0495581_0061310_353_778 | 132 |
| 629 | 3300047317 | Ga0495604_0033622 | Ga0495604_0033622_3504_3929 | 132 |
| 630 | 3300047318 | Ga0495636_0080604 | Ga0495636_0080604_712_1137 | 132 |
| 631 | 3300047319 | Ga0495674_0028368 | Ga0495674_0028368_283_708 | 132 |
| 632 | 3300047321 | Ga0495676_0314303 | Ga0495676_0314303_346_771 | 132 |
| 633 | 3300047322 | Ga0495680_0033843 | Ga0495680_0033843_3581_4006 | 132 |
| 634 | 3300047446 | Ga0495679_081250 | Ga0495679_081250_283_708 | 132 |
| 635 | 3300047470 | Ga0495681_0064951 | Ga0495681_0064951_253_678 | 132 |
| 636 | 3300047471 | Ga0495684_0035502 | Ga0495684_0035502_2207_2632 | 132 |
| 637 | 3300047673 | Ga0495593_0012135 | Ga0495593_0012135_4223_4648 | 132 |
| 638 | 3300047673 | Ga0495593_0038715 | Ga0495593_0038715_527_952 | 132 |
| 639 | 3300048089 | Ga0495614_0088465 | Ga0495614_0088465_215_640 | 132 |
| 640 | 3300048903 | Ga0496100_0144215 | Ga0496100_0144215_1195_1620 | 132 |
| 641 | 3300048903 | Ga0496100_0367840 | Ga0496100_0367840_266_691 | 132 |
| 642 | 3300048904 | Ga0496101_0304570 | Ga0496101_0304570_795_1220 | 132 |
| 643 | 3300048904 | Ga0496101_0574367 | Ga0496101_0574367_395_820 | 132 |
| 644 | 3300048905 | Ga0496102_0154819 | Ga0496102_0154819_395_820 | 132 |
| 645 | 3300048906 | Ga0496103_0062407 | Ga0496103_0062407_559_984 | 132 |
| 646 | 3300048906 | Ga0496103_0214867 | Ga0496103_0214867_795_1220 | 132 |
| 647 | 3300048907 | Ga0496104_0150356 | Ga0496104_0150356_1299_1724 | 132 |
| 648 | 3300048907 | Ga0496104_0301127 | Ga0496104_0301127_35_460 | 132 |
| 649 | 3300048908 | Ga0496105_0225419 | Ga0496105_0225419_705_1130 | 132 |
| 650 | 3300048908 | Ga0496105_0701845 | Ga0496105_0701845_156_581 | 132 |
| 651 | 3300048909 | Ga0496106_0018998 | Ga0496106_0018998_3334_3759 | 132 |
| 652 | 3300048910 | Ga0496107_0410147 | Ga0496107_0410147_481_906 | 132 |
| 653 | 3300048911 | Ga0496108_0327544 | Ga0496108_0327544_516_941 | 132 |
| 654 | 3300048911 | Ga0496108_0540885 | Ga0496108_0540885_473_898 | 132 |
| 655 | 3300048912 | Ga0496109_0042157 | Ga0496109_0042157_2185_2610 | 132 |
| 656 | 3300048913 | Ga0496110_0122545 | Ga0496110_0122545_1524_1949 | 132 |
| 657 | 3300048913 | Ga0496110_0138319 | Ga0496110_0138319_118_543 | 132 |
| 658 | 3300048914 | Ga0496111_0040897 | Ga0496111_0040897_1255_1680 | 132 |
| 659 | 3300048915 | Ga0496112_0131407 | Ga0496112_0131407_1183_1608 | 132 |
| 660 | 3300048915 | Ga0496112_0169516 | Ga0496112_0169516_1329_1754 | 132 |
| 661 | 3300048916 | Ga0496113_0445340 | Ga0496113_0445340_156_581 | 132 |
| 662 | 3300048917 | Ga0496114_0008606 | Ga0496114_0008606_2076_2501 | 132 |
| 663 | 3300048918 | Ga0496115_0051251 | Ga0496115_0051251_102_527 | 132 |
| 664 | 3300048918 | Ga0496115_0260056 | Ga0496115_0260056_208_633 | 132 |
| 665 | 3300048928 | Ga0496125_0388504 | Ga0496125_0388504_18_443 | 132 |
| 666 | 3300049571 | Ga0501034_0353702 | Ga0501034_0353702_418_843 | 132 |
| 667 | 3300049571 | Ga0501034_0813078 | Ga0501034_0813078_34_459 | 132 |
| 668 | 3300049581 | Ga0501047_0482356 | Ga0501047_0482356_261_686 | 132 |
| 669 | 3300049585 | Ga0501069_0004336 | Ga0501069_0004336_862_1287 | 132 |
| 670 | 3300049586 | Ga0501070_0003447 | Ga0501070_0003447_8189_8614 | 132 |
| 671 | 3300049742 | Ga0501080_0434103 | Ga0501080_0434103_347_772 | 132 |
| 672 | 3300049823 | Ga0501044_1115430 | Ga0501044_1115430_79_504 | 132 |
| 673 | 3300050496 | nmdc:mga07m45_315047_c1 | nmdc:mga07m45_315047_c1_156_581 | 132 |
| 674 | 3300050507 | nmdc:mga05p37_262_c1 | nmdc:mga05p37_262_c1_43450_43875 | 132 |
| 675 | 3300050508 | nmdc:mga09592_1228_c1 | nmdc:mga09592_1228_c1_18753_19178 | 132 |
| 676 | 3300050509 | nmdc:mga0qj67_1310_c1 | nmdc:mga0qj67_1310_c1_12494_12919 | 132 |
| 677 | 3300050510 | nmdc:mga06r32_510_c1 | nmdc:mga06r32_510_c1_12127_12552 | 132 |
| 678 | 3300050511 | nmdc:mga08y16_3743_c2 | nmdc:mga08y16_3743_c2_5270_5695 | 132 |
| 679 | 3300050512 | nmdc:mga0n895_106_c1 | nmdc:mga0n895_106_c1_43799_44224 | 132 |
| 680 | 3300050512 | nmdc:mga0n895_217352_c1 | nmdc:mga0n895_217352_c1_264_689 | 132 |
| 681 | 3300050513 | nmdc:mga0rr50_1148_c1 | nmdc:mga0rr50_1148_c1_10075_10500 | 132 |
| 682 | 3300050513 | nmdc:mga0rr50_81239_c1 | nmdc:mga0rr50_81239_c1_1401_1826 | 132 |
| 683 | 3300050514 | nmdc:mga08x19_161049_c1 | nmdc:mga08x19_161049_c1_107_532 | 132 |
| 684 | 3300050515 | nmdc:mga0a205_1112_c1 | nmdc:mga0a205_1112_c1_12995_13420 | 132 |
| 685 | 3300053077 | Ga0495601_0018697 | Ga0495601_0018697_1904_2329 | 132 |
| 686 | 3300053078 | Ga0495612_0001704 | Ga0495612_0001704_7102_7527 | 132 |
| 687 | 3300053084 | Ga0495595_0258506 | Ga0495595_0258506_44_469 | 132 |
| 688 | 3300053085 | Ga0495619_0000609 | Ga0495619_0000609_11970_12395 | 132 |
| 689 | 3300053085 | Ga0495619_0093004 | Ga0495619_0093004_1401_1826 | 132 |
| 690 | 3300060353 | Ga0501082_0888920 | Ga0501082_0888920_173_598 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bqg-assembly1.cif.gz_A | crystal structure of mpges-1 bound to an inhibitor | 0.695 | 9 | 129 |
| 4bpm-assembly1.cif.gz_A | crystal structure of a human integral membrane enzyme | 0.6949 | 9 | 129 |
| 5bqg-assembly1.cif.gz_A | crystal structure of mpges-1 bound to an inhibitor | 0.6419 | 9 | 129 |
| 4bpm-assembly1.cif.gz_A | crystal structure of a human integral membrane enzyme | 0.6415 | 9 | 129 |
| 3dww-assembly1.cif.gz_C | electron crystallographic structure of human microsomal prostaglandin e synthase 1 | 0.5688 | 6 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P64515_1_129_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7983 | 5 | 129 | 1.20.120.550 |
| af_P64515_1_129_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7125 | 5 | 129 | 1.20.120.550 |
| af_Q4CY37_50_170_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.7065 | 60 | 132 | 1.20.1250.20 |
| 4yl1A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6956 | 9 | 129 | 1.20.120.550 |
| af_Q8N4S7_43_254_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.6819 | 52 | 128 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6S6QSA7-F1-model_v4 | MAPEG family protein | 0.9752 | 1 | 129 |
GO:0016020
|
| AF-A0A6P1B7G6-F1-model_v4 | deleted | 0.9739 | 50 | 132 |
|
| AF-A0A0P7YBX8-F1-model_v4 | MAPEG family protein | 0.9672 | 17 | 129 |
GO:0016020
|
| AF-A0A4Q6BXS5-F1-model_v4 | MAPEG family protein | 0.9658 | 54 | 129 |
GO:0016020
|
| AF-A0A1I3UQ71-F1-model_v4 | MAPEG family protein | 0.9656 | 2 | 129 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar