F475470

General Info

Members Datasets Scaffolds Average Seq Length
690 379 689 137

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0130337|Ga0436365_0130337_455_898
Length 147
Sequence MLQGEFAMSIQAVLLPLFVEVLLTFVLLYGMAYTRTRAFRTGEVKARDVALREPNWPPHIIQIGNAYHNQLELPVLFYVLTILAWVTRHADLLFVVLAWIFVVSRLAHAYIHVTDNDVNRRGPAFGVGALVLSIMWLIFMIRILLGV

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
212 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
249 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
250 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
251 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
284 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
311 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
312 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
313 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.14
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0
Rhizoplane 6.96
Rhizosphere 89.42
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c013089 3300000041 Bacteria 711
2 JGI24752J21851_1011925 3300001976 Bacteria 1137
3 JGI24750J21931_1022732 3300002070 Bacteria 887
4 JGI24033J26618_1034978 3300002155 Bacteria 686
5 JGI24034J26672_10006795 3300002239 Bacteria 1654
6 JGI24742J22300_10006754 3300002244 Bacteria 1892
7 Ga0065704_10756000 3300005289 Unclassified 540
8 Ga0065707_10141329 3300005295 Bacteria 1768
9 Ga0070658_10079763 3300005327 Bacteria 2688
10 Ga0070658_10267551 3300005327 Bacteria 1453
11 Ga0070658_10338868 3300005327 Bacteria 1286
12 Ga0070676_10410820 3300005328 Bacteria 944
13 Ga0070683_100089578 3300005329 Bacteria 2887
14 Ga0070683_100713126 3300005329 Bacteria 961
15 Ga0070683_101019127 3300005329 Bacteria 795
16 Ga0070690_100004750 3300005330 Bacteria 7581
17 Ga0070690_100272104 3300005330 Bacteria 1205
18 Ga0070670_100077822 3300005331 Bacteria 2849
19 Ga0070670_100193646 3300005331 Unclassified 1766
20 Ga0068869_100160140 3300005334 Bacteria 1752
21 Ga0070666_10005333 3300005335 Bacteria 7881
22 Ga0070666_10100412 3300005335 Bacteria 1994
23 Ga0070680_100011041 3300005336 Bacteria 6980
24 Ga0070680_100048701 3300005336 Bacteria 3454
25 Ga0070682_100153679 3300005337 Bacteria 1582
26 Ga0070682_100754479 3300005337 Bacteria 786
27 Ga0068868_100009579 3300005338 Bacteria 6982
28 Ga0068868_100203154 3300005338 Bacteria 1653
29 Ga0070660_100026110 3300005339 Bacteria 4347
30 Ga0070660_100704625 3300005339 Bacteria 847
31 Ga0070689_100326574 3300005340 Bacteria 1283
32 Ga0070691_10060524 3300005341 Bacteria 1820
33 Ga0070687_100001901 3300005343 Bacteria 7599
34 Ga0070668_100147565 3300005347 Bacteria 1899
35 Ga0070668_100516722 3300005347 Bacteria 1036
36 Ga0070669_100018044 3300005353 Bacteria 5040
37 Ga0070675_100073782 3300005354 Bacteria 2833
38 Ga0070671_100013696 3300005355 Bacteria 6539
39 Ga0070671_100111917 3300005355 Bacteria 2293
40 Ga0070674_100216482 3300005356 Bacteria 1488
41 Ga0070673_100055829 3300005364 Bacteria 3113
42 Ga0070688_100005391 3300005365 Bacteria 6731
43 Ga0070688_100025542 3300005365 Bacteria 3498
44 Ga0070659_100202939 3300005366 Bacteria 1632
45 Ga0070667_100015010 3300005367 Bacteria 6400
46 Ga0070709_10011165 3300005434 Bacteria 4996
47 Ga0070714_100051098 3300005435 Bacteria 3524
48 Ga0070714_101522846 3300005435 Unclassified 653
49 Ga0070713_100012585 3300005436 Bacteria 6213
50 Ga0070710_10008108 3300005437 Bacteria 5107
51 Ga0070710_10128963 3300005437 Bacteria 1540
52 Ga0070701_10037248 3300005438 Bacteria 2455
53 Ga0070701_10534913 3300005438 Bacteria 766
54 Ga0070711_100124408 3300005439 Bacteria 1912
55 Ga0070705_100377861 3300005440 Unclassified 1042
56 Ga0070700_100032022 3300005441 Bacteria 3157
57 Ga0070700_100202336 3300005441 Bacteria 1396
58 Ga0070663_100097264 3300005455 Bacteria 2191
59 Ga0070663_100260532 3300005455 Bacteria 1375
60 Ga0070663_100347875 3300005455 Bacteria 1199
61 Ga0070678_100046523 3300005456 Bacteria 3111
62 Ga0070662_101160230 3300005457 Bacteria 663
63 Ga0070681_10040444 3300005458 Bacteria 4671
64 Ga0070681_10406289 3300005458 Bacteria 1273
65 Ga0070681_10539591 3300005458 Bacteria 1080
66 Ga0070681_10700047 3300005458 Bacteria 929
67 Ga0070681_10798478 3300005458 Bacteria 861
68 Ga0068867_100158454 3300005459 Bacteria 1783
69 Ga0068867_100418996 3300005459 Bacteria 1134
70 Ga0070685_10009588 3300005466 Bacteria 5007
71 Ga0070685_10244574 3300005466 Bacteria 1186
72 Ga0070698_101832010 3300005471 Unclassified 560
73 Ga0070679_100082606 3300005530 Bacteria 3202
74 Ga0070679_100252520 3300005530 Bacteria 1719
75 Ga0070679_100277019 3300005530 Bacteria 1630
76 Ga0070679_100564379 3300005530 Bacteria 1082
77 Ga0070684_100311377 3300005535 Bacteria 1446
78 Ga0068853_100328557 3300005539 Bacteria 1419
79 Ga0068853_100418783 3300005539 Bacteria 1256
80 Ga0070686_100021647 3300005544 Bacteria 3827
81 Ga0070686_100047753 3300005544 Bacteria 2708
82 Ga0070696_100309883 3300005546 Bacteria 1212
83 Ga0070696_100530008 3300005546 Bacteria 941
84 Ga0070693_100491668 3300005547 Bacteria 869
85 Ga0070665_100234794 3300005548 Bacteria 1834
86 Ga0070704_100296399 3300005549 Bacteria 1346
87 Ga0070704_100739494 3300005549 Bacteria 875
88 Ga0068855_100028877 3300005563 Bacteria 6636
89 Ga0068855_100034429 3300005563 Bacteria 6041
90 Ga0068855_100046361 3300005563 Bacteria 5139
91 Ga0068855_100454307 3300005563 Bacteria 1397
92 Ga0068855_102419626 3300005563 Bacteria 524
93 Ga0070664_100055015 3300005564 Bacteria 3377
94 Ga0070664_100096824 3300005564 Bacteria 2561
95 Ga0070664_101950108 3300005564 Bacteria 557
96 Ga0068857_100508115 3300005577 Bacteria 1132
97 Ga0068854_100053757 3300005578 Bacteria 2893
98 Ga0068854_101150832 3300005578 Unclassified 693
99 Ga0068856_100059622 3300005614 Bacteria 3770
100 Ga0068856_100069685 3300005614 Bacteria 3477
101 Ga0068856_101116249 3300005614 Bacteria 806
102 Ga0068856_101281959 3300005614 Bacteria 748
103 Ga0070702_100019921 3300005615 Bacteria 3507
104 Ga0070702_100457235 3300005615 Bacteria 927
105 Ga0068852_100015569 3300005616 Bacteria 5905
106 Ga0068852_100015717 3300005616 Bacteria 5882
107 Ga0068852_100491691 3300005616 Bacteria 1220
108 Ga0068859_100046985 3300005617 Bacteria 4336
109 Ga0068859_100077641 3300005617 Bacteria 3361
110 Ga0068864_100178406 3300005618 Bacteria 1940
111 Ga0068864_101321907 3300005618 Bacteria 721
112 Ga0068864_101321909 3300005618 Bacteria 721
113 Ga0068866_10194272 3300005718 Bacteria 1208
114 Ga0068861_100023990 3300005719 Bacteria 4406
115 Ga0068861_100465344 3300005719 Bacteria 1136
116 Ga0068851_10250166 3300005834 Bacteria 1005
117 Ga0068851_10301002 3300005834 Bacteria 922
118 Ga0068870_10024950 3300005840 Bacteria 2963
119 Ga0068863_100007995 3300005841 Bacteria 10337
120 Ga0068863_100177973 3300005841 Bacteria 2041
121 Ga0068858_100051014 3300005842 Bacteria 3828
122 Ga0068858_100413605 3300005842 Bacteria 1296
123 Ga0068860_100024209 3300005843 Bacteria 5870
124 Ga0068860_100132560 3300005843 Bacteria 2392
125 Ga0068860_100167186 3300005843 Bacteria 2123
126 Ga0068862_100042098 3300005844 Bacteria 3889
127 Ga0081455_10016444 3300005937 Bacteria 7143
128 Ga0081455_10092919 3300005937 Bacteria 2440
129 Ga0081540_1005514 3300005983 Bacteria 9433
130 Ga0070717_10001862 3300006028 Bacteria 14744
131 Ga0070717_11208937 3300006028 Bacteria 688
132 Ga0075365_10157008 3300006038 Bacteria 1584
133 Ga0075365_10164267 3300006038 Bacteria 1548
134 Ga0075365_10690221 3300006038 Bacteria 721
135 Ga0075432_10003683 3300006058 Bacteria 5217
136 Ga0070716_100003599 3300006173 Bacteria 7323
137 Ga0070716_100510115 3300006173 Bacteria 889
138 Ga0070712_100029025 3300006175 Bacteria 3706
139 Ga0070712_100365986 3300006175 Bacteria 1184
140 Ga0075362_10153827 3300006177 Bacteria 1105
141 Ga0075367_10206271 3300006178 Bacteria 1228
142 Ga0075369_10269022 3300006186 Bacteria 793
143 Ga0075427_10006245 3300006194 Bacteria 1721
144 Ga0075366_10175307 3300006195 Bacteria 1302
145 Ga0097621_100014218 3300006237 Bacteria 5953
146 Ga0075370_10590528 3300006353 Bacteria 673
147 Ga0068871_100120498 3300006358 Bacteria 2216
148 Ga0068871_100197665 3300006358 Bacteria 1735
149 Ga0075428_100016183 3300006844 Bacteria 8245
150 Ga0075428_101182159 3300006844 Unclassified 807
151 Ga0075430_100002056 3300006846 Bacteria 16585
152 Ga0075431_100003489 3300006847 Bacteria 15246
153 Ga0075431_100015898 3300006847 Bacteria 7632
154 Ga0075431_100564421 3300006847 Bacteria 1125
155 Ga0075433_10000975 3300006852 Bacteria 20309
156 Ga0075433_10083868 3300006852 Bacteria 2813
157 Ga0075434_100009141 3300006871 Bacteria 9233
158 Ga0075434_100043125 3300006871 Bacteria 4473
159 Ga0075434_100097339 3300006871 Bacteria 2947
160 Ga0075429_100003309 3300006880 Bacteria 13720
161 Ga0075429_100305503 3300006880 Bacteria 1393
162 Ga0068865_100025798 3300006881 Bacteria 3870
163 Ga0075436_100782623 3300006914 Unclassified 710
164 Ga0097620_100046986 3300006931 Bacteria 4336
165 Ga0097620_100077644 3300006931 Bacteria 3361
166 Ga0075435_100013273 3300007076 Bacteria 6121
167 Ga0075435_100142893 3300007076 Bacteria 2009
168 Ga0099795_10057260 3300007788 Bacteria 1436
169 Ga0105251_10076254 3300009011 Bacteria 1556
170 Ga0105251_10390841 3300009011 Unclassified 638
171 Ga0105250_10126230 3300009092 Bacteria 1054
172 Ga0105250_10228553 3300009092 Bacteria 791
173 Ga0105240_10139397 3300009093 Bacteria 2901
174 Ga0105240_10448727 3300009093 Bacteria 1444
175 Ga0105240_10625281 3300009093 Bacteria 1183
176 Ga0105240_11479306 3300009093 Unclassified 712
177 Ga0111539_10000528 3300009094 Bacteria 48456
178 Ga0111539_10186184 3300009094 Bacteria 2424
179 Ga0111539_11376270 3300009094 Bacteria 819
180 Ga0111539_12509515 3300009094 Unclassified 598
181 Ga0105245_10068932 3300009098 Bacteria 3206
182 Ga0105245_10106651 3300009098 Bacteria 2600
183 Ga0105245_10567994 3300009098 Bacteria 1158
184 Ga0105247_10048801 3300009101 Bacteria 2601
185 Ga0105247_10079448 3300009101 Bacteria 2064
186 Ga0114129_10001477 3300009147 Bacteria 31843
187 Ga0114129_10007748 3300009147 Bacteria 15282
188 Ga0105243_10038896 3300009148 Bacteria 3707
189 Ga0105243_10130437 3300009148 Bacteria 2132
190 Ga0105242_10012341 3300009176 Bacteria 6574
191 Ga0105242_10039122 3300009176 Bacteria 3816
192 Ga0105248_10013945 3300009177 Bacteria 8843
193 Ga0105248_10241572 3300009177 Bacteria 2033
194 Ga0105237_10504905 3300009545 Bacteria 1216
195 Ga0105237_10901945 3300009545 Bacteria 891
196 Ga0105238_10018493 3300009551 Bacteria 7090
197 Ga0105238_10403418 3300009551 Bacteria 1360
198 Ga0105238_10698658 3300009551 Bacteria 1026
199 Ga0105249_10029823 3300009553 Bacteria 4928
200 Ga0105239_10228481 3300010375 Bacteria 2088
201 Ga0105239_10434164 3300010375 Bacteria 1489
202 Ga0105246_10122755 3300011119 Bacteria 1927
203 Ga0105246_10188248 3300011119 Unclassified 1595
204 Ga0105246_10982887 3300011119 Bacteria 763
205 Ga0157337_1000643 3300012483 Bacteria 1649
206 Ga0157373_10067799 3300013100 Bacteria 2523
207 Ga0157373_10667678 3300013100 Bacteria 760
208 Ga0157371_10109500 3300013102 Bacteria 1961
209 Ga0157371_10322111 3300013102 Bacteria 1122
210 Ga0157371_10368375 3300013102 Bacteria 1048
211 Ga0157370_10137309 3300013104 Bacteria 2278
212 Ga0157370_10759041 3300013104 Bacteria 884
213 Ga0157370_11423349 3300013104 Bacteria 624
214 Ga0157369_10119677 3300013105 Bacteria 2794
215 Ga0157369_10295835 3300013105 Bacteria 1685
216 Ga0157374_10018913 3300013296 Bacteria 6090
217 Ga0157374_10890242 3300013296 Bacteria 908
218 Ga0157378_10047440 3300013297 Bacteria 3820
219 Ga0163162_12045174 3300013306 Bacteria 657
220 Ga0163162_12352795 3300013306 Unclassified 612
221 Ga0157372_10154780 3300013307 Bacteria 2647
222 Ga0157372_10997970 3300013307 Bacteria 970
223 Ga0157372_11083179 3300013307 Bacteria 927
224 Ga0157372_11165292 3300013307 Unclassified 891
225 Ga0157375_10927554 3300013308 Bacteria 1014
226 Ga0163163_10060186 3300014325 Bacteria 3759
227 Ga0163163_10152441 3300014325 Bacteria 2355
228 Ga0163163_10300859 3300014325 Bacteria 1657
229 Ga0157380_10064729 3300014326 Bacteria 2936
230 Ga0157380_10643400 3300014326 Bacteria 1056
231 Ga0157377_10024449 3300014745 Bacteria 3211
232 Ga0157379_10097715 3300014968 Bacteria 2636
233 Ga0157379_10218083 3300014968 Bacteria 1728
234 Ga0157379_10475732 3300014968 Bacteria 1156
235 Ga0157376_10076919 3300014969 Bacteria 2853
236 Ga0157376_10611885 3300014969 Bacteria 1085
237 Ga0163161_10008394 3300017792 Bacteria 7148
238 Ga0163161_10900074 3300017792 Bacteria 750
239 Ga0206354_11271362 3300020081 Bacteria 1380
240 Ga0213872_10023205 3300021361 Bacteria 2855
241 Ga0209233_1023036 3300025261 Bacteria 1584
242 Ga0207656_10096009 3300025321 Bacteria 1352
243 Ga0207713_1177315 3300025735 Unclassified 668
244 Ga0207682_10076333 3300025893 Bacteria 1428
245 Ga0207692_10000849 3300025898 Bacteria 10974
246 Ga0207692_10085845 3300025898 Bacteria 1694
247 Ga0207642_10063491 3300025899 Bacteria 1728
248 Ga0207710_10005282 3300025900 Bacteria 5582
249 Ga0207710_10051963 3300025900 Bacteria 1842
250 Ga0207688_10000263 3300025901 Bacteria 23901
251 Ga0207680_10227257 3300025903 Bacteria 1281
252 Ga0207647_10122036 3300025904 Bacteria 1536
253 Ga0207685_10004719 3300025905 Bacteria 3504
254 Ga0207699_10015354 3300025906 Bacteria 3975
255 Ga0207643_10000889 3300025908 Bacteria 18002
256 Ga0207705_10104154 3300025909 Bacteria 2090
257 Ga0207705_10364742 3300025909 Bacteria 1114
258 Ga0207654_10353721 3300025911 Bacteria 1012
259 Ga0207707_10255296 3300025912 Bacteria 1522
260 Ga0207707_10663306 3300025912 Bacteria 878
261 Ga0207707_10938910 3300025912 Bacteria 713
262 Ga0207695_10084346 3300025913 Bacteria 3208
263 Ga0207693_10027936 3300025915 Bacteria 4460
264 Ga0207693_10313014 3300025915 Bacteria 1229
265 Ga0207663_10010022 3300025916 Bacteria 5022
266 Ga0207663_10129408 3300025916 Bacteria 1742
267 Ga0207663_10187916 3300025916 Bacteria 1481
268 Ga0207663_10231348 3300025916 Bacteria 1351
269 Ga0207660_10071085 3300025917 Bacteria 2531
270 Ga0207662_10000154 3300025918 Bacteria 32501
271 Ga0207662_10822231 3300025918 Unclassified 655
272 Ga0207657_10030200 3300025919 Bacteria 4922
273 Ga0207657_10039476 3300025919 Bacteria 4195
274 Ga0207657_10046045 3300025919 Bacteria 3822
275 Ga0207657_10049848 3300025919 Bacteria 3646
276 Ga0207649_10426105 3300025920 Bacteria 997
277 Ga0207649_10503202 3300025920 Bacteria 922
278 Ga0207652_10045626 3300025921 Bacteria 3737
279 Ga0207652_10065293 3300025921 Bacteria 3151
280 Ga0207652_10263380 3300025921 Bacteria 1555
281 Ga0207652_10408728 3300025921 Bacteria 1225
282 Ga0207652_11002585 3300025921 Bacteria 734
283 Ga0207681_10377907 3300025923 Bacteria 1140
284 Ga0207694_10018170 3300025924 Bacteria 5317
285 Ga0207694_11189101 3300025924 Unclassified 645
286 Ga0207650_10019781 3300025925 Bacteria 4736
287 Ga0207650_11168550 3300025925 Bacteria 655
288 Ga0207687_10008325 3300025927 Bacteria 6787
289 Ga0207687_10020528 3300025927 Bacteria 4383
290 Ga0207700_10000290 3300025928 Bacteria 29736
291 Ga0207664_10011397 3300025929 Bacteria 6318
292 Ga0207664_10148360 3300025929 Bacteria 1990
293 Ga0207644_10023219 3300025931 Bacteria 4245
294 Ga0207644_10114016 3300025931 Bacteria 2047
295 Ga0207706_10020484 3300025933 Bacteria 5944
296 Ga0207686_10143841 3300025934 Bacteria 1652
297 Ga0207686_10187036 3300025934 Bacteria 1473
298 Ga0207709_10075832 3300025935 Bacteria 2151
299 Ga0207709_10386909 3300025935 Bacteria 1066
300 Ga0207670_10020290 3300025936 Bacteria 4081
301 Ga0207670_10066843 3300025936 Bacteria 2471
302 Ga0207669_10051306 3300025937 Bacteria 2471
303 Ga0207704_10037137 3300025938 Bacteria 2811
304 Ga0207704_11367885 3300025938 Unclassified 606
305 Ga0207665_10000719 3300025939 Bacteria 22485
306 Ga0207691_10783504 3300025940 Bacteria 802
307 Ga0207711_10037954 3300025941 Bacteria 4095
308 Ga0207689_10003869 3300025942 Bacteria 13641
309 Ga0207689_10052656 3300025942 Bacteria 3353
310 Ga0207661_10115604 3300025944 Bacteria 2276
311 Ga0207661_10358056 3300025944 Bacteria 1318
312 Ga0207679_10135099 3300025945 Unclassified 1985
313 Ga0207679_10441782 3300025945 Bacteria 1152
314 Ga0207667_10021843 3300025949 Bacteria 7083
315 Ga0207667_10056762 3300025949 Bacteria 4112
316 Ga0207667_10119538 3300025949 Bacteria 2715
317 Ga0207667_10459653 3300025949 Bacteria 1293
318 Ga0207651_10000900 3300025960 Bacteria 13066
319 Ga0207651_10025682 3300025960 Bacteria 3666
320 Ga0207712_10010883 3300025961 Bacteria 5790
321 Ga0207712_10165155 3300025961 Bacteria 1725
322 Ga0207668_10081158 3300025972 Bacteria 2352
323 Ga0207668_10739485 3300025972 Bacteria 867
324 Ga0207668_10895402 3300025972 Bacteria 789
325 Ga0207640_10025032 3300025981 Bacteria 3608
326 Ga0207640_10444288 3300025981 Bacteria 1067
327 Ga0207658_10018594 3300025986 Bacteria 4802
328 Ga0207658_10034145 3300025986 Bacteria 3633
329 Ga0207677_10010239 3300026023 Bacteria 5300
330 Ga0207677_10115356 3300026023 Bacteria 2009
331 Ga0207703_10012561 3300026035 Bacteria 6602
332 Ga0207703_10013883 3300026035 Bacteria 6279
333 Ga0207639_10093434 3300026041 Bacteria 2412
334 Ga0207639_10415489 3300026041 Bacteria 1215
335 Ga0207678_10006545 3300026067 Bacteria 10328
336 Ga0207678_10029694 3300026067 Bacteria 4773
337 Ga0207708_10006322 3300026075 Bacteria 8779
338 Ga0207702_10036530 3300026078 Bacteria 4110
339 Ga0207702_10115998 3300026078 Bacteria 2389
340 Ga0207702_10341752 3300026078 Bacteria 1430
341 Ga0207702_10647095 3300026078 Bacteria 1039
342 Ga0207702_11117600 3300026078 Bacteria 782
343 Ga0207702_11233472 3300026078 Bacteria 742
344 Ga0207641_10135346 3300026088 Bacteria 2217
345 Ga0207648_10001639 3300026089 Bacteria 24530
346 Ga0207676_10031583 3300026095 Bacteria 3983
347 Ga0207676_10091150 3300026095 Bacteria 2503
348 Ga0207674_10390731 3300026116 Bacteria 1345
349 Ga0207674_11772636 3300026116 Bacteria 585
350 Ga0207675_100008008 3300026118 Bacteria 9959
351 Ga0207675_100476902 3300026118 Bacteria 1239
352 Ga0207683_10001293 3300026121 Bacteria 22621
353 Ga0207683_10035723 3300026121 Bacteria 4323
354 Ga0207698_10004120 3300026142 Bacteria 8830
355 Ga0207698_10017188 3300026142 Bacteria 4900
356 Ga0207698_10092670 3300026142 Bacteria 2478
357 Ga0207698_10258184 3300026142 Bacteria 1599
358 Ga0209981_1014619 3300027378 Bacteria 1096
359 Ga0209996_1004003 3300027395 Bacteria 1867
360 Ga0209995_1060903 3300027471 Unclassified 643
361 Ga0209999_1068974 3300027543 Bacteria 677
362 Ga0210002_1013355 3300027617 Bacteria 1281
363 Ga0209971_1005532 3300027682 Bacteria 2999
364 Ga0209974_10029129 3300027876 Bacteria 1829
365 Ga0209974_10070872 3300027876 Bacteria 1189
366 Ga0207428_10000291 3300027907 Bacteria 67245
367 Ga0268266_10047490 3300028379 Bacteria 3678
368 Ga0268266_10098922 3300028379 Bacteria 2567
369 Ga0265330_10012435 3300031235 Bacteria 3979
370 Ga0265325_10008234 3300031241 Bacteria 6166
371 Ga0265339_10177578 3300031249 Bacteria 1062
372 Ga0265313_10010630 3300031595 Bacteria 5796
373 Ga0265313_10095574 3300031595 Bacteria 1326
374 Ga0265342_10001132 3300031712 Bacteria 25514
375 Ga0373930_0010716 3300034816 Bacteria 1644
376 Ga0373930_0061651 3300034816 Bacteria 838
377 Ga0373938_0012517 3300034957 Bacteria 1593
378 Ga0373938_0182322 3300034957 Bacteria 574
379 Ga0373926_0003254 3300035083 Bacteria 5219
380 Ga0373926_0033420 3300035083 Bacteria 1818
381 Ga0373928_0003461 3300035084 Bacteria 3006
382 Ga0373928_0235041 3300035084 Unclassified 541
383 Ga0373929_0071923 3300035085 Bacteria 828
384 Ga0373944_0002442 3300035089 Bacteria 4718
385 Ga0373944_0041525 3300035089 Bacteria 1423
386 Ga0373949_0007797 3300035090 Bacteria 2345
387 Ga0373951_0048220 3300035091 Bacteria 1043
388 Ga0373932_0008691 3300035112 Bacteria 2430
389 Ga0373932_0072417 3300035112 Bacteria 1072
390 Ga0373932_0195610 3300035112 Bacteria 716
391 Ga0373936_0001218 3300035113 Bacteria 9265
392 Ga0373936_0472281 3300035113 Bacteria 581
393 Ga0373941_0049948 3300035115 Bacteria 1326
394 Ga0373945_0025022 3300035116 Bacteria 2071
395 Ga0373945_0029135 3300035116 Bacteria 1938
396 Ga0373957_0021460 3300035120 Bacteria 2293
397 Ga0373960_0002561 3300035121 Bacteria 4103
398 Ga0373943_0007114 3300035170 Bacteria 5021
399 Ga0373943_0022381 3300035170 Bacteria 2928
400 Ga0373943_0034507 3300035170 Bacteria 2413
401 Ga0373946_0001618 3300035171 Bacteria 7840
402 Ga0373946_0024824 3300035171 Bacteria 2353
403 Ga0373946_0147382 3300035171 Bacteria 1095
404 Ga0373955_0005754 3300035172 Bacteria 5591
405 Ga0373942_0001847 3300035207 Bacteria 5335
406 Ga0373961_0033656 3300035241 Bacteria 1444
407 Ga0373962_0076346 3300035242 Bacteria 1010
408 Ga0373962_0128593 3300035242 Bacteria 813
409 Ga0373924_0088592 3300035410 Bacteria 1322
410 Ga0373924_0344291 3300035410 Bacteria 664
411 Ga0373931_0009468 3300035691 Bacteria 4658
412 Ga0373931_0085084 3300035691 Bacteria 1752
413 Ga0373931_0184127 3300035691 Bacteria 1239
414 Ga0373935_0015189 3300035692 Bacteria 4651
415 Ga0373935_0021688 3300035692 Bacteria 3934
416 Ga0373935_0209387 3300035692 Bacteria 1350
417 Ga0373927_0023883 3300035695 Bacteria 3999
418 Ga0373927_0210982 3300035695 Bacteria 1275
419 Ga0373933_0124674 3300035724 Bacteria 1615
420 Ga0373947_0000874 3300035725 Bacteria 18211
421 Ga0373947_0042141 3300035725 Bacteria 2724
422 Ga0373947_0148838 3300035725 Bacteria 1506
423 Ga0373925_0013063 3300037068 Bacteria 6011
424 Ga0373925_0033677 3300037068 Bacteria 3775
425 Ga0373925_0331648 3300037068 Bacteria 1232
426 Ga0373925_0608263 3300037068 Unclassified 900
427 Ga0395899_0007661 3300037312 Bacteria 8324
428 Ga0395900_0002820 3300037418 Bacteria 18968
429 Ga0395898_0106187 3300037466 Bacteria 2693
430 Ga0436364_1286367 3300037853 Bacteria 4237
431 Ga0395901_0127978 3300038443 Bacteria 2669
432 Ga0436365_0130337 3300039437 Bacteria 926
433 Ga0436365_0722556 3300039437 Unclassified 914
434 Ga0436360_0717772 3300039438 Bacteria 1978
435 Ga0436361_0476110 3300039447 Bacteria 14479
436 Ga0436363_1057531 3300039450 Bacteria 2280
437 Ga0439453_0165428 3300041408 Unclassified 532
438 Ga0451853_3077804 3300041512 Bacteria 824
439 Ga0439441_087049 3300042001 Bacteria 687
440 Ga0439448_0127148 3300042005 Unclassified 877
441 Ga0439463_036157 3300042016 Bacteria 1251
442 Ga0439458_0065671 3300042157 Bacteria 911
443 Ga0439464_0034619 3300042439 Bacteria 1424
444 Ga0439440_0082861 3300042993 Bacteria 851
445 Ga0466957_0579864 3300044842 Bacteria 784
446 Ga0495617_038309 3300046452 Bacteria 1604
447 Ga0495592_0086248 3300046454 Bacteria 2261
448 Ga0495603_0005459 3300046455 Bacteria 7590
449 Ga0495603_0019346 3300046455 Bacteria 4121
450 Ga0495603_0049120 3300046455 Bacteria 2511
451 Ga0495629_0000329 3300046459 Bacteria 40545
452 Ga0495629_0063291 3300046459 Bacteria 2583
453 Ga0495641_0009078 3300046461 Bacteria 5957
454 Ga0495641_0050896 3300046461 Bacteria 1892
455 Ga0495641_0133445 3300046461 Bacteria 1108
456 Ga0495651_0008552 3300046462 Bacteria 7843
457 Ga0495653_0112173 3300046463 Bacteria 1957
458 Ga0495653_0844471 3300046463 Unclassified 548
459 Ga0495580_0003611 3300046472 Bacteria 13108
460 Ga0495580_0227297 3300046472 Bacteria 1281
461 Ga0495582_0018577 3300046473 Bacteria 3801
462 Ga0495582_0054817 3300046473 Bacteria 2197
463 Ga0495582_0083289 3300046473 Bacteria 1777
464 Ga0495639_0007456 3300046475 Bacteria 4695
465 Ga0495662_0033343 3300046476 Bacteria 2487
466 Ga0495664_0009503 3300046477 Bacteria 5444
467 Ga0495584_0015175 3300046491 Bacteria 3924
468 Ga0495584_0074841 3300046491 Bacteria 1702
469 Ga0495584_0127545 3300046491 Bacteria 1290
470 Ga0495585_0066829 3300046492 Bacteria 1968
471 Ga0495585_0149042 3300046492 Bacteria 1221
472 Ga0495585_0556189 3300046492 Bacteria 542
473 Ga0495594_0028755 3300046499 Bacteria 3000
474 Ga0495594_0127347 3300046499 Bacteria 1441
475 Ga0495594_0295731 3300046499 Bacteria 922
476 Ga0495596_0260973 3300046500 Unclassified 672
477 Ga0495607_0055693 3300046501 Bacteria 2274
478 Ga0495608_0146790 3300046511 Bacteria 1504
479 Ga0495616_0282392 3300046513 Bacteria 705
480 Ga0495620_0049417 3300046515 Bacteria 1800
481 Ga0495630_0067980 3300046517 Bacteria 2678
482 Ga0495630_0353611 3300046517 Bacteria 1124
483 Ga0495631_0098585 3300046518 Bacteria 1258
484 Ga0495637_0244169 3300046520 Bacteria 648
485 Ga0495644_0000434 3300046523 Bacteria 18447
486 Ga0495644_0121756 3300046523 Bacteria 993
487 Ga0495666_0015395 3300046526 Bacteria 3807
488 Ga0495666_0085502 3300046526 Bacteria 1490
489 Ga0495652_0013346 3300046529 Bacteria 7393
490 Ga0495652_0477563 3300046529 Bacteria 868
491 Ga0495665_0026914 3300046531 Bacteria 3087
492 Ga0495665_0427889 3300046531 Bacteria 670
493 Ga0495640_0056948 3300046533 Bacteria 2668
494 Ga0495586_0028072 3300046535 Bacteria 3011
495 Ga0495587_0018879 3300046536 Bacteria 4274
496 Ga0495598_0003767 3300046537 Bacteria 3240
497 Ga0495598_0040231 3300046537 Bacteria 1362
498 Ga0495598_0060701 3300046537 Bacteria 1166
499 Ga0495621_0122795 3300046539 Bacteria 1005
500 Ga0495645_0185944 3300046543 Bacteria 1420
501 Ga0495622_0003676 3300046557 Bacteria 7191
502 Ga0495633_0000643 3300046558 Bacteria 32448
503 Ga0495667_0005122 3300046559 Bacteria 8854
504 Ga0495656_0000842 3300046615 Bacteria 9892
505 Ga0495656_0009556 3300046615 Bacteria 3491
506 Ga0495656_0420483 3300046615 Bacteria 701
507 Ga0495668_0087643 3300046616 Bacteria 1707
508 Ga0495611_0004301 3300046648 Bacteria 6186
509 Ga0495635_0001379 3300046663 Bacteria 16201
510 Ga0495659_0001236 3300046664 Bacteria 8840
511 Ga0495588_0025967 3300046674 Bacteria 2922
512 Ga0495599_0018912 3300046678 Bacteria 4294
513 Ga0495646_0006527 3300046680 Bacteria 7401
514 Ga0495647_0002668 3300046681 Bacteria 5665
515 Ga0495647_0005000 3300046681 Bacteria 4342
516 Ga0495647_0026623 3300046681 Bacteria 2120
517 Ga0495658_0019600 3300046683 Bacteria 3533
518 Ga0495658_0032637 3300046683 Bacteria 2844
519 Ga0495658_0102097 3300046683 Bacteria 1713
520 Ga0495658_0142187 3300046683 Bacteria 1468
521 Ga0495613_0002281 3300046689 Bacteria 14509
522 Ga0495613_0020424 3300046689 Bacteria 4937
523 Ga0495613_0095407 3300046689 Bacteria 2151
524 Ga0495624_0017283 3300046690 Bacteria 4844
525 Ga0495624_0053551 3300046690 Bacteria 2547
526 Ga0495624_0630233 3300046690 Unclassified 638
527 Ga0495670_0008704 3300046691 Bacteria 4996
528 Ga0495670_0191884 3300046691 Bacteria 1080
529 Ga0495589_0040148 3300046794 Bacteria 2338
530 Ga0495589_0109481 3300046794 Bacteria 1334
531 Ga0495600_0007387 3300046809 Bacteria 6720
532 Ga0495600_0131647 3300046809 Bacteria 1626
533 Ga0495581_0061310 3300047315 Bacteria 2173
534 Ga0495581_0161655 3300047315 Unclassified 1309
535 Ga0495604_0033622 3300047317 Bacteria 4058
536 Ga0495604_0105809 3300047317 Bacteria 2059
537 Ga0495636_0080604 3300047318 Bacteria 1401
538 Ga0495636_0133774 3300047318 Bacteria 1104
539 Ga0495674_0028368 3300047319 Bacteria 5103
540 Ga0495676_0095528 3300047321 Bacteria 2211
541 Ga0495676_0314303 3300047321 Bacteria 1053
542 Ga0495680_0033843 3300047322 Bacteria 4134
543 Ga0495683_0152824 3300047323 Bacteria 1073
544 Ga0495677_0061234 3300047445 Bacteria 1396
545 Ga0495679_066200 3300047446 Bacteria 1050
546 Ga0495679_081250 3300047446 Bacteria 920
547 Ga0495681_0064951 3300047470 Bacteria 1670
548 Ga0495684_0035502 3300047471 Bacteria 3823
549 Ga0495593_0012135 3300047673 Bacteria 4929
550 Ga0495593_0038715 3300047673 Bacteria 2574
551 Ga0495614_0088465 3300048089 Bacteria 1346
552 Ga0495615_0227393 3300048090 Bacteria 584
553 Ga0496100_0089349 3300048903 Bacteria 2098
554 Ga0496100_0144215 3300048903 Bacteria 1691
555 Ga0496100_0367840 3300048903 Bacteria 1089
556 Ga0496101_0004213 3300048904 Bacteria 9009
557 Ga0496101_0304570 3300048904 Bacteria 1248
558 Ga0496101_0574367 3300048904 Bacteria 891
559 Ga0496102_0092434 3300048905 Bacteria 2801
560 Ga0496102_0154819 3300048905 Bacteria 2154
561 Ga0496103_0003429 3300048906 Bacteria 9692
562 Ga0496103_0062407 3300048906 Bacteria 2319
563 Ga0496103_0214867 3300048906 Bacteria 1236
564 Ga0496104_0006123 3300048907 Bacteria 10560
565 Ga0496104_0149939 3300048907 Bacteria 2239
566 Ga0496104_0150356 3300048907 Bacteria 2235
567 Ga0496104_0168778 3300048907 Bacteria 2098
568 Ga0496104_0301127 3300048907 Bacteria 1515
569 Ga0496105_0004225 3300048908 Bacteria 10790
570 Ga0496105_0225419 3300048908 Bacteria 1524
571 Ga0496105_0701845 3300048908 Bacteria 776
572 Ga0496106_0018998 3300048909 Bacteria 5093
573 Ga0496107_0008057 3300048910 Bacteria 7275
574 Ga0496107_0410147 3300048910 Bacteria 1007
575 Ga0496108_0008243 3300048911 Bacteria 8457
576 Ga0496108_0021192 3300048911 Bacteria 5341
577 Ga0496108_0327544 3300048911 Bacteria 1335
578 Ga0496108_0540885 3300048911 Bacteria 1016
579 Ga0496108_1148920 3300048911 Unclassified 658
580 Ga0496109_0001287 3300048912 Bacteria 20815
581 Ga0496109_0023515 3300048912 Bacteria 5471
582 Ga0496109_0042157 3300048912 Bacteria 4133
583 Ga0496110_0122545 3300048913 Bacteria 2343
584 Ga0496110_0138319 3300048913 Bacteria 2202
585 Ga0496110_0558874 3300048913 Bacteria 1040
586 Ga0496111_0003286 3300048914 Bacteria 9989
587 Ga0496111_0040897 3300048914 Bacteria 3325
588 Ga0496111_0123339 3300048914 Bacteria 1914
589 Ga0496111_0761276 3300048914 Bacteria 702
590 Ga0496112_0017567 3300048915 Bacteria 6724
591 Ga0496112_0034589 3300048915 Bacteria 4917
592 Ga0496112_0131407 3300048915 Bacteria 2475
593 Ga0496112_0169516 3300048915 Bacteria 2148
594 Ga0496112_0672495 3300048915 Bacteria 964
595 Ga0496113_0002800 3300048916 Bacteria 10265
596 Ga0496113_0445340 3300048916 Bacteria 1040
597 Ga0496114_0008606 3300048917 Bacteria 8086
598 Ga0496115_0051251 3300048918 Bacteria 3309
599 Ga0496115_0061200 3300048918 Bacteria 3035
600 Ga0496115_0260056 3300048918 Bacteria 1427
601 Ga0496125_0388504 3300048928 Bacteria 820
602 Ga0501031_0098852 3300049568 Bacteria 1904
603 Ga0501032_0015269 3300049569 Bacteria 5422
604 Ga0501032_0044630 3300049569 Bacteria 3000
605 Ga0501032_0195859 3300049569 Bacteria 1320
606 Ga0501032_0840002 3300049569 Bacteria 579
607 Ga0501033_0025535 3300049570 Bacteria 4451
608 Ga0501033_0526089 3300049570 Bacteria 816
609 Ga0501034_0027313 3300049571 Bacteria 5806
610 Ga0501034_0282954 3300049571 Bacteria 1597
611 Ga0501034_0353702 3300049571 Bacteria 1397
612 Ga0501034_0813078 3300049571 Bacteria 827
613 Ga0501036_0066228 3300049572 Bacteria 3056
614 Ga0501036_0110127 3300049572 Bacteria 2327
615 Ga0501037_0044108 3300049573 Bacteria 3276
616 Ga0501037_0143953 3300049573 Bacteria 1705
617 Ga0501037_0150424 3300049573 Bacteria 1664
618 Ga0501038_0047718 3300049574 Bacteria 3709
619 Ga0501039_0032188 3300049575 Bacteria 4042
620 Ga0501043_0065506 3300049579 Bacteria 2853
621 Ga0501043_0153705 3300049579 Bacteria 1800
622 Ga0501043_0407565 3300049579 Bacteria 1026
623 Ga0501043_0899213 3300049579 Bacteria 635
624 Ga0501047_0054286 3300049581 Bacteria 3875
625 Ga0501047_0058262 3300049581 Bacteria 3731
626 Ga0501047_0320760 3300049581 Bacteria 1389
627 Ga0501047_0482356 3300049581 Bacteria 1067
628 Ga0501067_0203003 3300049583 Bacteria 1104
629 Ga0501068_0085093 3300049584 Bacteria 1946
630 Ga0501069_0004336 3300049585 Bacteria 7326
631 Ga0501069_0121497 3300049585 Bacteria 1492
632 Ga0501069_0420652 3300049585 Bacteria 792
633 Ga0501070_0003447 3300049586 Bacteria 13708
634 Ga0501070_0071101 3300049586 Bacteria 2881
635 Ga0501070_0100722 3300049586 Bacteria 2390
636 Ga0501070_0940342 3300049586 Bacteria 673
637 Ga0501071_0324175 3300049587 Bacteria 1170
638 Ga0501073_0015858 3300049589 Bacteria 5460
639 Ga0501074_0162484 3300049590 Bacteria 1595
640 Ga0501074_0911273 3300049590 Archaea 619
641 Ga0501076_0747978 3300049592 Bacteria 807
642 Ga0501077_0016202 3300049593 Bacteria 4695
643 Ga0501077_0046592 3300049593 Bacteria 2754
644 Ga0501079_0376994 3300049741 Bacteria 1112
645 Ga0501080_0087621 3300049742 Bacteria 2892
646 Ga0501080_0113880 3300049742 Bacteria 2507
647 Ga0501080_0434103 3300049742 Bacteria 1179
648 Ga0501083_0025847 3300049744 Bacteria 4064
649 Ga0501083_0101701 3300049744 Bacteria 1894
650 Ga0501035_0064401 3300049822 Bacteria 3258
651 Ga0501035_1250133 3300049822 Unclassified 574
652 Ga0501044_0081705 3300049823 Bacteria 3270
653 Ga0501044_0107001 3300049823 Bacteria 2808
654 Ga0501044_0149655 3300049823 Bacteria 2317
655 Ga0501044_0471796 3300049823 Unclassified 1159
656 Ga0501044_1115430 3300049823 Unclassified 658
657 nmdc:mga00v17_252254_c1 3300050491 Bacteria 1144
658 nmdc:mga0yw44_1008_c1 3300050492 Bacteria 10779
659 nmdc:mga0yw44_157337_c1 3300050492 Bacteria 1486
660 nmdc:mga0yw44_81393_c1 3300050492 Bacteria 2030
661 nmdc:mga06z11_137950_c1 3300050494 Bacteria 1376
662 nmdc:mga07m45_315047_c1 3300050496 Bacteria 909
663 nmdc:mga07m45_355593_c1 3300050496 Bacteria 851
664 nmdc:mga05p37_262_c1 3300050507 Bacteria 49144
665 nmdc:mga05p37_62866_c1 3300050507 Bacteria 4569
666 nmdc:mga09592_1228_c1 3300050508 Bacteria 20528
667 nmdc:mga09592_887928_c1 3300050508 Bacteria 750
668 nmdc:mga0qj67_1310_c1 3300050509 Bacteria 17456
669 nmdc:mga06r32_510_c1 3300050510 Bacteria 33391
670 nmdc:mga06r32_68955_c1 3300050510 Bacteria 3417
671 nmdc:mga08y16_170558_c1 3300050511 Bacteria 2260
672 nmdc:mga08y16_3743_c2 3300050511 Bacteria 7173
673 nmdc:mga0n895_106_c1 3300050512 Bacteria 49191
674 nmdc:mga0n895_217352_c1 3300050512 Bacteria 1941
675 nmdc:mga0rr50_1148_c1 3300050513 Bacteria 14394
676 nmdc:mga0rr50_614393_c1 3300050513 Bacteria 927
677 nmdc:mga0rr50_81239_c1 3300050513 Bacteria 2501
678 nmdc:mga08x19_161049_c1 3300050514 Bacteria 1524
679 nmdc:mga0a205_1112_c1 3300050515 Bacteria 22250
680 Ga0495601_0018697 3300053077 Bacteria 4218
681 Ga0495612_0001704 3300053078 Bacteria 9020
682 Ga0495595_0249666 3300053084 Bacteria 888
683 Ga0495595_0258506 3300053084 Bacteria 872
684 Ga0495619_0000609 3300053085 Bacteria 23652
685 Ga0495619_0093004 3300053085 Bacteria 2043
686 Ga0500616_0004537 3300053153 Bacteria 9843
687 Ga0500599_067584 3300053736 Bacteria 590
688 Ga0501084_0637963 3300054114 Bacteria 899
689 Ga0501082_0888920 3300060353 Bacteria 779

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0717772 Ga0436360_0717772_650_1072 105
2 3300049586 Ga0501070_0940342 Ga0501070_0940342_309_653 105
3 3300039450 Ga0436363_1057531 Ga0436363_1057531_428_781 108
4 3300049587 Ga0501071_0324175 Ga0501071_0324175_750_1157 111
5 3300021361 Ga0213872_10023205 Ga0213872_100232053 114
6 3300039447 Ga0436361_0476110 Ga0436361_0476110_3841_4263 114
7 3300005843 Ga0068860_100167186 Ga0068860_1001671862 116
8 3300035113 Ga0373936_0472281 Ga0373936_0472281_176_553 116
9 3300046461 Ga0495641_0133445 Ga0495641_0133445_693_1070 116
10 3300046517 Ga0495630_0353611 Ga0495630_0353611_710_1087 116
11 3300025919 Ga0207657_10039476 Ga0207657_100394761 117
12 3300025972 Ga0207668_10739485 Ga0207668_107394852 117
13 3300042005 Ga0439448_0127148 Ga0439448_0127148_442_867 117
14 3300049593 Ga0501077_0046592 Ga0501077_0046592_1419_1844 117
15 3300049822 Ga0501035_1250133 Ga0501035_1250133_105_530 117
16 3300013104 Ga0157370_10759041 Ga0157370_107590412 118
17 3300005458 Ga0070681_10539591 Ga0070681_105395912 119
18 3300005530 Ga0070679_100564379 Ga0070679_1005643792 119
19 3300025912 Ga0207707_10663306 Ga0207707_106633062 119
20 3300025921 Ga0207652_10408728 Ga0207652_104087282 119
21 3300027378 Ga0209981_1014619 Ga0209981_10146192 119
22 3300027395 Ga0209996_1004003 Ga0209996_10040032 119
23 3300027471 Ga0209995_1060903 Ga0209995_10609032 119
24 3300027543 Ga0209999_1068974 Ga0209999_10689742 119
25 3300027617 Ga0210002_1013355 Ga0210002_10133552 119
26 3300027876 Ga0209974_10070872 Ga0209974_100708722 119
27 3300041408 Ga0439453_0165428 Ga0439453_0165428_55_480 119
28 3300042016 Ga0439463_036157 Ga0439463_036157_468_893 119
29 3300042157 Ga0439458_0065671 Ga0439458_0065671_305_730 119
30 3300042439 Ga0439464_0034619 Ga0439464_0034619_303_728 119
31 3300005471 Ga0070698_101832010 Ga0070698_1018320101 120
32 3300027682 Ga0209971_1005532 Ga0209971_10055322 120
33 3300027876 Ga0209974_10029129 Ga0209974_100291292 120
34 3300049585 Ga0501069_0420652 Ga0501069_0420652_201_626 120
35 3300049569 Ga0501032_0195859 Ga0501032_0195859_30_422 121
36 3300005563 Ga0068855_100028877 Ga0068855_1000288774 122
37 3300025949 Ga0207667_10056762 Ga0207667_100567622 122
38 3300006038 Ga0075365_10157008 Ga0075365_101570082 125
39 3300006847 Ga0075431_100564421 Ga0075431_1005644211 125
40 3300046463 Ga0495653_0844471 Ga0495653_0844471_132_536 125
41 3300050492 nmdc:mga0yw44_81393_c1 nmdc:mga0yw44_81393_c1_1532_1954 125
42 iso_pu_bacteria 2643221547 2643756714 127
43 3300005331 Ga0070670_100193646 Ga0070670_1001936461 129
44 3300005435 Ga0070714_101522846 Ga0070714_1015228462 129
45 3300006028 Ga0070717_11208937 Ga0070717_112089372 129
46 3300006852 Ga0075433_10083868 Ga0075433_100838682 129
47 3300007076 Ga0075435_100142893 Ga0075435_1001428932 129
48 3300009094 Ga0111539_12509515 Ga0111539_125095152 129
49 3300011119 Ga0105246_10188248 Ga0105246_101882482 129
50 3300014325 Ga0163163_10060186 Ga0163163_100601862 129
51 3300005937 Ga0081455_10016444 Ga0081455_100164442 130
52 3300006844 Ga0075428_101182159 Ga0075428_1011821592 130
53 3300006871 Ga0075434_100043125 Ga0075434_1000431253 130
54 3300009094 Ga0111539_11376270 Ga0111539_113762701 130
55 3300009147 Ga0114129_10007748 Ga0114129_100077486 130
56 3300025945 Ga0207679_10135099 Ga0207679_101350992 130
57 3300037068 Ga0373925_0608263 Ga0373925_0608263_189_611 130
58 3300042001 Ga0439441_087049 Ga0439441_087049_246_665 130
59 3300042993 Ga0439440_0082861 Ga0439440_0082861_59_484 130
60 3300047315 Ga0495581_0161655 Ga0495581_0161655_115_537 130
61 3300047318 Ga0495636_0133774 Ga0495636_0133774_21_446 130
62 3300048907 Ga0496104_0006123 Ga0496104_0006123_6787_7209 130
63 3300048908 Ga0496105_0004225 Ga0496105_0004225_8741_9163 130
64 3300048911 Ga0496108_0021192 Ga0496108_0021192_3354_3776 130
65 3300048912 Ga0496109_0001287 Ga0496109_0001287_15448_15870 130
66 3300048914 Ga0496111_0123339 Ga0496111_0123339_111_533 130
67 3300048915 Ga0496112_0017567 Ga0496112_0017567_2917_3339 130
68 3300048916 Ga0496113_0002800 Ga0496113_0002800_7877_8299 130
69 3300048918 Ga0496115_0061200 Ga0496115_0061200_1023_1445 130
70 3300049568 Ga0501031_0098852 Ga0501031_0098852_369_794 130
71 3300049569 Ga0501032_0015269 Ga0501032_0015269_2320_2745 130
72 3300049569 Ga0501032_0044630 Ga0501032_0044630_1781_2200 130
73 3300049569 Ga0501032_0840002 Ga0501032_0840002_133_558 130
74 3300049570 Ga0501033_0025535 Ga0501033_0025535_213_638 130
75 3300049570 Ga0501033_0526089 Ga0501033_0526089_372_797 130
76 3300049571 Ga0501034_0027313 Ga0501034_0027313_1827_2252 130
77 3300049571 Ga0501034_0282954 Ga0501034_0282954_1048_1467 130
78 3300049572 Ga0501036_0066228 Ga0501036_0066228_487_912 130
79 3300049572 Ga0501036_0110127 Ga0501036_0110127_1295_1720 130
80 3300049573 Ga0501037_0044108 Ga0501037_0044108_308_733 130
81 3300049573 Ga0501037_0143953 Ga0501037_0143953_782_1207 130
82 3300049573 Ga0501037_0150424 Ga0501037_0150424_317_736 130
83 3300049574 Ga0501038_0047718 Ga0501038_0047718_1558_1983 130
84 3300049575 Ga0501039_0032188 Ga0501039_0032188_3021_3446 130
85 3300049579 Ga0501043_0065506 Ga0501043_0065506_1045_1464 130
86 3300049579 Ga0501043_0153705 Ga0501043_0153705_581_1006 130
87 3300049579 Ga0501043_0407565 Ga0501043_0407565_44_469 130
88 3300049581 Ga0501047_0054286 Ga0501047_0054286_1418_1837 130
89 3300049581 Ga0501047_0058262 Ga0501047_0058262_987_1412 130
90 3300049581 Ga0501047_0320760 Ga0501047_0320760_728_1153 130
91 3300049583 Ga0501067_0203003 Ga0501067_0203003_199_624 130
92 3300049584 Ga0501068_0085093 Ga0501068_0085093_588_1007 130
93 3300049585 Ga0501069_0121497 Ga0501069_0121497_293_718 130
94 3300049586 Ga0501070_0071101 Ga0501070_0071101_1866_2291 130
95 3300049586 Ga0501070_0100722 Ga0501070_0100722_1801_2226 130
96 3300049589 Ga0501073_0015858 Ga0501073_0015858_1890_2309 130
97 3300049590 Ga0501074_0162484 Ga0501074_0162484_386_811 130
98 3300049590 Ga0501074_0911273 Ga0501074_0911273_112_537 130
99 3300049741 Ga0501079_0376994 Ga0501079_0376994_287_712 130
100 3300049742 Ga0501080_0087621 Ga0501080_0087621_372_797 130
101 3300049742 Ga0501080_0113880 Ga0501080_0113880_1835_2260 130
102 3300049744 Ga0501083_0101701 Ga0501083_0101701_858_1277 130
103 3300049822 Ga0501035_0064401 Ga0501035_0064401_1860_2285 130
104 3300049823 Ga0501044_0081705 Ga0501044_0081705_525_950 130
105 3300049823 Ga0501044_0107001 Ga0501044_0107001_930_1355 130
106 3300049823 Ga0501044_0149655 Ga0501044_0149655_1280_1699 130
107 3300049823 Ga0501044_0471796 Ga0501044_0471796_334_753 130
108 3300050507 nmdc:mga05p37_62866_c1 nmdc:mga05p37_62866_c1_1697_2122 130
109 3300050508 nmdc:mga09592_887928_c1 nmdc:mga09592_887928_c1_60_485 130
110 3300050513 nmdc:mga0rr50_614393_c1 nmdc:mga0rr50_614393_c1_445_870 130
111 3300053153 Ga0500616_0004537 Ga0500616_0004537_1045_1464 130
112 3300053736 Ga0500599_067584 Ga0500599_067584_20_439 130
113 3300001976 JGI24752J21851_1011925 JGI24752J21851_10119252 131
114 3300002070 JGI24750J21931_1022732 JGI24750J21931_10227322 131
115 3300002155 JGI24033J26618_1034978 JGI24033J26618_10349782 131
116 3300002239 JGI24034J26672_10006795 JGI24034J26672_100067952 131
117 3300002244 JGI24742J22300_10006754 JGI24742J22300_100067542 131
118 3300005295 Ga0065707_10141329 Ga0065707_101413292 131
119 3300005327 Ga0070658_10338868 Ga0070658_103388682 131
120 3300005328 Ga0070676_10410820 Ga0070676_104108202 131
121 3300005329 Ga0070683_100713126 Ga0070683_1007131262 131
122 3300005330 Ga0070690_100004750 Ga0070690_1000047503 131
123 3300005331 Ga0070670_100077822 Ga0070670_1000778222 131
124 3300005335 Ga0070666_10100412 Ga0070666_101004122 131
125 3300005337 Ga0070682_100754479 Ga0070682_1007544792 131
126 3300005338 Ga0068868_100009579 Ga0068868_1000095794 131
127 3300005339 Ga0070660_100704625 Ga0070660_1007046251 131
128 3300005341 Ga0070691_10060524 Ga0070691_100605242 131
129 3300005343 Ga0070687_100001901 Ga0070687_1000019012 131
130 3300005347 Ga0070668_100147565 Ga0070668_1001475652 131
131 3300005353 Ga0070669_100018044 Ga0070669_1000180445 131
132 3300005354 Ga0070675_100073782 Ga0070675_1000737822 131
133 3300005355 Ga0070671_100013696 Ga0070671_1000136966 131
134 3300005364 Ga0070673_100055829 Ga0070673_1000558293 131
135 3300005365 Ga0070688_100005391 Ga0070688_1000053913 131
136 3300005366 Ga0070659_100202939 Ga0070659_1002029392 131
137 3300005437 Ga0070710_10128963 Ga0070710_101289632 131
138 3300005438 Ga0070701_10037248 Ga0070701_100372482 131
139 3300005441 Ga0070700_100032022 Ga0070700_1000320222 131
140 3300005455 Ga0070663_100097264 Ga0070663_1000972642 131
141 3300005455 Ga0070663_100347875 Ga0070663_1003478752 131
142 3300005456 Ga0070678_100046523 Ga0070678_1000465232 131
143 3300005457 Ga0070662_101160230 Ga0070662_1011602301 131
144 3300005458 Ga0070681_10798478 Ga0070681_107984782 131
145 3300005459 Ga0068867_100158454 Ga0068867_1001584542 131
146 3300005466 Ga0070685_10009588 Ga0070685_100095883 131
147 3300005544 Ga0070686_100047753 Ga0070686_1000477532 131
148 3300005546 Ga0070696_100530008 Ga0070696_1005300082 131
149 3300005549 Ga0070704_100296399 Ga0070704_1002963992 131
150 3300005563 Ga0068855_102419626 Ga0068855_1024196261 131
151 3300005564 Ga0070664_100055015 Ga0070664_1000550153 131
152 3300005578 Ga0068854_100053757 Ga0068854_1000537572 131
153 3300005614 Ga0068856_100069685 Ga0068856_1000696853 131
154 3300005615 Ga0070702_100457235 Ga0070702_1004572352 131
155 3300005616 Ga0068852_100015717 Ga0068852_1000157172 131
156 3300005617 Ga0068859_100046985 Ga0068859_1000469854 131
157 3300005618 Ga0068864_101321907 Ga0068864_1013219072 131
158 3300005618 Ga0068864_101321909 Ga0068864_1013219092 131
159 3300005719 Ga0068861_100023990 Ga0068861_1000239902 131
160 3300005834 Ga0068851_10301002 Ga0068851_103010022 131
161 3300005840 Ga0068870_10024950 Ga0068870_100249502 131
162 3300005841 Ga0068863_100007995 Ga0068863_1000079955 131
163 3300005842 Ga0068858_100051014 Ga0068858_1000510143 131
164 3300005843 Ga0068860_100024209 Ga0068860_1000242092 131
165 3300005844 Ga0068862_100042098 Ga0068862_1000420982 131
166 3300005937 Ga0081455_10092919 Ga0081455_100929193 131
167 3300006038 Ga0075365_10164267 Ga0075365_101642672 131
168 3300006038 Ga0075365_10690221 Ga0075365_106902211 131
169 3300006173 Ga0070716_100510115 Ga0070716_1005101151 131
170 3300006175 Ga0070712_100029025 Ga0070712_1000290252 131
171 3300006177 Ga0075362_10153827 Ga0075362_101538272 131
172 3300006178 Ga0075367_10206271 Ga0075367_102062711 131
173 3300006186 Ga0075369_10269022 Ga0075369_102690221 131
174 3300006195 Ga0075366_10175307 Ga0075366_101753072 131
175 3300006353 Ga0075370_10590528 Ga0075370_105905281 131
176 3300006358 Ga0068871_100197665 Ga0068871_1001976651 131
177 3300006847 Ga0075431_100015898 Ga0075431_1000158984 131
178 3300006880 Ga0075429_100305503 Ga0075429_1003055032 131
179 3300006881 Ga0068865_100025798 Ga0068865_1000257982 131
180 3300006914 Ga0075436_100782623 Ga0075436_1007826231 131
181 3300006931 Ga0097620_100046986 Ga0097620_1000469862 131
182 3300007788 Ga0099795_10057260 Ga0099795_100572602 131
183 3300009011 Ga0105251_10076254 Ga0105251_100762542 131
184 3300009092 Ga0105250_10126230 Ga0105250_101262302 131
185 3300009093 Ga0105240_11479306 Ga0105240_114793062 131
186 3300009094 Ga0111539_10186184 Ga0111539_101861841 131
187 3300009098 Ga0105245_10106651 Ga0105245_101066511 131
188 3300009098 Ga0105245_10567994 Ga0105245_105679942 131
189 3300009101 Ga0105247_10079448 Ga0105247_100794482 131
190 3300009148 Ga0105243_10130437 Ga0105243_101304372 131
191 3300009176 Ga0105242_10012341 Ga0105242_100123415 131
192 3300009177 Ga0105248_10013945 Ga0105248_100139453 131
193 3300009545 Ga0105237_10901945 Ga0105237_109019451 131
194 3300009551 Ga0105238_10018493 Ga0105238_100184932 131
195 3300009553 Ga0105249_10029823 Ga0105249_100298232 131
196 3300010375 Ga0105239_10434164 Ga0105239_104341642 131
197 3300011119 Ga0105246_10122755 Ga0105246_101227552 131
198 3300013102 Ga0157371_10109500 Ga0157371_101095002 131
199 3300013296 Ga0157374_10018913 Ga0157374_100189132 131
200 3300014325 Ga0163163_10152441 Ga0163163_101524412 131
201 3300014326 Ga0157380_10064729 Ga0157380_100647294 131
202 3300014326 Ga0157380_10643400 Ga0157380_106434002 131
203 3300014745 Ga0157377_10024449 Ga0157377_100244492 131
204 3300014968 Ga0157379_10097715 Ga0157379_100977152 131
205 3300014969 Ga0157376_10076919 Ga0157376_100769192 131
206 3300017792 Ga0163161_10008394 Ga0163161_100083945 131
207 3300025261 Ga0209233_1023036 Ga0209233_10230363 131
208 3300025321 Ga0207656_10096009 Ga0207656_100960092 131
209 3300025893 Ga0207682_10076333 Ga0207682_100763332 131
210 3300025898 Ga0207692_10085845 Ga0207692_100858452 131
211 3300025900 Ga0207710_10005282 Ga0207710_100052825 131
212 3300025901 Ga0207688_10000263 Ga0207688_100002638 131
213 3300025904 Ga0207647_10122036 Ga0207647_101220362 131
214 3300025908 Ga0207643_10000889 Ga0207643_100008896 131
215 3300025911 Ga0207654_10353721 Ga0207654_103537212 131
216 3300025915 Ga0207693_10027936 Ga0207693_100279362 131
217 3300025915 Ga0207693_10313014 Ga0207693_103130142 131
218 3300025916 Ga0207663_10129408 Ga0207663_101294082 131
219 3300025916 Ga0207663_10187916 Ga0207663_101879162 131
220 3300025918 Ga0207662_10000154 Ga0207662_1000015410 131
221 3300025920 Ga0207649_10503202 Ga0207649_105032021 131
222 3300025923 Ga0207681_10377907 Ga0207681_103779072 131
223 3300025925 Ga0207650_11168550 Ga0207650_111685501 131
224 3300025927 Ga0207687_10008325 Ga0207687_100083255 131
225 3300025931 Ga0207644_10023219 Ga0207644_100232192 131
226 3300025933 Ga0207706_10020484 Ga0207706_100204848 131
227 3300025935 Ga0207709_10075832 Ga0207709_100758321 131
228 3300025936 Ga0207670_10020290 Ga0207670_100202902 131
229 3300025938 Ga0207704_10037137 Ga0207704_100371372 131
230 3300025942 Ga0207689_10003869 Ga0207689_100038692 131
231 3300025949 Ga0207667_10459653 Ga0207667_104596531 131
232 3300025960 Ga0207651_10000900 Ga0207651_100009006 131
233 3300025961 Ga0207712_10010883 Ga0207712_100108835 131
234 3300025972 Ga0207668_10895402 Ga0207668_108954022 131
235 3300025981 Ga0207640_10025032 Ga0207640_100250322 131
236 3300025986 Ga0207658_10018594 Ga0207658_100185943 131
237 3300026023 Ga0207677_10010239 Ga0207677_100102393 131
238 3300026035 Ga0207703_10013883 Ga0207703_100138832 131
239 3300026041 Ga0207639_10093434 Ga0207639_100934342 131
240 3300026067 Ga0207678_10029694 Ga0207678_100296942 131
241 3300026075 Ga0207708_10006322 Ga0207708_1000632210 131
242 3300026078 Ga0207702_10115998 Ga0207702_101159982 131
243 3300026088 Ga0207641_10135346 Ga0207641_101353462 131
244 3300026089 Ga0207648_10001639 Ga0207648_100016396 131
245 3300026095 Ga0207676_10031583 Ga0207676_100315831 131
246 3300026118 Ga0207675_100008008 Ga0207675_1000080086 131
247 3300026121 Ga0207683_10035723 Ga0207683_100357232 131
248 3300026142 Ga0207698_10004120 Ga0207698_100041209 131
249 3300028379 Ga0268266_10098922 Ga0268266_100989222 131
250 3300031249 Ga0265339_10177578 Ga0265339_101775782 131
251 3300034816 Ga0373930_0061651 Ga0373930_0061651_127_549 131
252 3300034957 Ga0373938_0182322 Ga0373938_0182322_84_506 131
253 3300035083 Ga0373926_0033420 Ga0373926_0033420_1106_1528 131
254 3300035084 Ga0373928_0235041 Ga0373928_0235041_104_526 131
255 3300035089 Ga0373944_0041525 Ga0373944_0041525_397_819 131
256 3300035112 Ga0373932_0072417 Ga0373932_0072417_170_592 131
257 3300035112 Ga0373932_0195610 Ga0373932_0195610_21_446 131
258 3300035116 Ga0373945_0029135 Ga0373945_0029135_815_1237 131
259 3300035170 Ga0373943_0022381 Ga0373943_0022381_70_492 131
260 3300035171 Ga0373946_0147382 Ga0373946_0147382_111_533 131
261 3300035242 Ga0373962_0076346 Ga0373962_0076346_141_563 131
262 3300035410 Ga0373924_0344291 Ga0373924_0344291_96_518 131
263 3300035691 Ga0373931_0085084 Ga0373931_0085084_575_1000 131
264 3300035691 Ga0373931_0184127 Ga0373931_0184127_314_736 131
265 3300035692 Ga0373935_0021688 Ga0373935_0021688_2724_3146 131
266 3300035695 Ga0373927_0210982 Ga0373927_0210982_256_678 131
267 3300035725 Ga0373947_0042141 Ga0373947_0042141_627_1049 131
268 3300037068 Ga0373925_0331648 Ga0373925_0331648_22_444 131
269 3300037312 Ga0395899_0007661 Ga0395899_0007661_1528_1953 131
270 3300037418 Ga0395900_0002820 Ga0395900_0002820_13694_14119 131
271 3300037466 Ga0395898_0106187 Ga0395898_0106187_711_1136 131
272 3300037853 Ga0436364_1286367 Ga0436364_1286367_2346_2768 131
273 3300038443 Ga0395901_0127978 Ga0395901_0127978_815_1240 131
274 3300039437 Ga0436365_0130337 Ga0436365_0130337_455_898 131
275 3300039437 Ga0436365_0722556 Ga0436365_0722556_31_453 131
276 3300041512 Ga0451853_3077804 Ga0451853_3077804_174_596 131
277 3300046455 Ga0495603_0019346 Ga0495603_0019346_984_1406 131
278 3300046472 Ga0495580_0227297 Ga0495580_0227297_789_1211 131
279 3300046473 Ga0495582_0018577 Ga0495582_0018577_1898_2320 131
280 3300046491 Ga0495584_0074841 Ga0495584_0074841_116_538 131
281 3300046491 Ga0495584_0127545 Ga0495584_0127545_720_1142 131
282 3300046492 Ga0495585_0066829 Ga0495585_0066829_682_1104 131
283 3300046492 Ga0495585_0149042 Ga0495585_0149042_764_1186 131
284 3300046492 Ga0495585_0556189 Ga0495585_0556189_85_507 131
285 3300046499 Ga0495594_0295731 Ga0495594_0295731_443_865 131
286 3300046501 Ga0495607_0055693 Ga0495607_0055693_232_654 131
287 3300046513 Ga0495616_0282392 Ga0495616_0282392_189_611 131
288 3300046515 Ga0495620_0049417 Ga0495620_0049417_1340_1762 131
289 3300046520 Ga0495637_0244169 Ga0495637_0244169_177_599 131
290 3300046523 Ga0495644_0121756 Ga0495644_0121756_407_829 131
291 3300046526 Ga0495666_0085502 Ga0495666_0085502_75_497 131
292 3300046529 Ga0495652_0477563 Ga0495652_0477563_291_713 131
293 3300046531 Ga0495665_0427889 Ga0495665_0427889_127_549 131
294 3300046537 Ga0495598_0040231 Ga0495598_0040231_778_1200 131
295 3300046537 Ga0495598_0060701 Ga0495598_0060701_183_605 131
296 3300046539 Ga0495621_0122795 Ga0495621_0122795_362_784 131
297 3300046543 Ga0495645_0185944 Ga0495645_0185944_542_964 131
298 3300046615 Ga0495656_0009556 Ga0495656_0009556_2286_2708 131
299 3300046615 Ga0495656_0420483 Ga0495656_0420483_183_605 131
300 3300046616 Ga0495668_0087643 Ga0495668_0087643_64_486 131
301 3300046681 Ga0495647_0026623 Ga0495647_0026623_1228_1650 131
302 3300046683 Ga0495658_0142187 Ga0495658_0142187_387_809 131
303 3300046690 Ga0495624_0053551 Ga0495624_0053551_1611_2033 131
304 3300046691 Ga0495670_0191884 Ga0495670_0191884_564_986 131
305 3300046794 Ga0495589_0040148 Ga0495589_0040148_1603_2025 131
306 3300047317 Ga0495604_0105809 Ga0495604_0105809_1197_1619 131
307 3300047321 Ga0495676_0095528 Ga0495676_0095528_115_537 131
308 3300047323 Ga0495683_0152824 Ga0495683_0152824_302_724 131
309 3300047445 Ga0495677_0061234 Ga0495677_0061234_468_890 131
310 3300047446 Ga0495679_066200 Ga0495679_066200_40_462 131
311 3300048090 Ga0495615_0227393 Ga0495615_0227393_139_561 131
312 3300048903 Ga0496100_0089349 Ga0496100_0089349_1121_1543 131
313 3300048904 Ga0496101_0004213 Ga0496101_0004213_2908_3330 131
314 3300048905 Ga0496102_0092434 Ga0496102_0092434_232_654 131
315 3300048906 Ga0496103_0003429 Ga0496103_0003429_684_1106 131
316 3300048907 Ga0496104_0149939 Ga0496104_0149939_1377_1799 131
317 3300048907 Ga0496104_0168778 Ga0496104_0168778_1121_1543 131
318 3300048910 Ga0496107_0008057 Ga0496107_0008057_4822_5244 131
319 3300048911 Ga0496108_0008243 Ga0496108_0008243_684_1106 131
320 3300048911 Ga0496108_1148920 Ga0496108_1148920_93_515 131
321 3300048912 Ga0496109_0023515 Ga0496109_0023515_54_476 131
322 3300048913 Ga0496110_0558874 Ga0496110_0558874_409_831 131
323 3300048914 Ga0496111_0003286 Ga0496111_0003286_2859_3281 131
324 3300048914 Ga0496111_0761276 Ga0496111_0761276_22_444 131
325 3300048915 Ga0496112_0034589 Ga0496112_0034589_3656_4078 131
326 3300048915 Ga0496112_0672495 Ga0496112_0672495_211_633 131
327 3300049579 Ga0501043_0899213 Ga0501043_0899213_23_445 131
328 3300049592 Ga0501076_0747978 Ga0501076_0747978_20_442 131
329 3300049593 Ga0501077_0016202 Ga0501077_0016202_583_1005 131
330 3300049744 Ga0501083_0025847 Ga0501083_0025847_1618_2040 131
331 3300050491 nmdc:mga00v17_252254_c1 nmdc:mga00v17_252254_c1_190_612 131
332 3300050492 nmdc:mga0yw44_1008_c1 nmdc:mga0yw44_1008_c1_1497_1919 131
333 3300050492 nmdc:mga0yw44_157337_c1 nmdc:mga0yw44_157337_c1_407_829 131
334 3300050494 nmdc:mga06z11_137950_c1 nmdc:mga06z11_137950_c1_324_746 131
335 3300050496 nmdc:mga07m45_355593_c1 nmdc:mga07m45_355593_c1_375_797 131
336 3300050510 nmdc:mga06r32_68955_c1 nmdc:mga06r32_68955_c1_1385_1807 131
337 3300050511 nmdc:mga08y16_170558_c1 nmdc:mga08y16_170558_c1_1267_1689 131
338 3300053084 Ga0495595_0249666 Ga0495595_0249666_243_665 131
339 3300054114 Ga0501084_0637963 Ga0501084_0637963_288_710 131
340 3300000041 ARcpr5oldR_c013089 ARcpr5oldR_0130892 132
341 3300005289 Ga0065704_10756000 Ga0065704_107560001 132
342 3300005327 Ga0070658_10079763 Ga0070658_100797634 132
343 3300005327 Ga0070658_10267551 Ga0070658_102675512 132
344 3300005329 Ga0070683_100089578 Ga0070683_1000895782 132
345 3300005329 Ga0070683_101019127 Ga0070683_1010191271 132
346 3300005330 Ga0070690_100272104 Ga0070690_1002721042 132
347 3300005334 Ga0068869_100160140 Ga0068869_1001601402 132
348 3300005335 Ga0070666_10005333 Ga0070666_100053333 132
349 3300005336 Ga0070680_100011041 Ga0070680_1000110414 132
350 3300005336 Ga0070680_100048701 Ga0070680_1000487012 132
351 3300005337 Ga0070682_100153679 Ga0070682_1001536792 132
352 3300005338 Ga0068868_100203154 Ga0068868_1002031542 132
353 3300005339 Ga0070660_100026110 Ga0070660_1000261103 132
354 3300005340 Ga0070689_100326574 Ga0070689_1003265742 132
355 3300005347 Ga0070668_100516722 Ga0070668_1005167222 132
356 3300005355 Ga0070671_100111917 Ga0070671_1001119172 132
357 3300005356 Ga0070674_100216482 Ga0070674_1002164822 132
358 3300005365 Ga0070688_100025542 Ga0070688_1000255423 132
359 3300005367 Ga0070667_100015010 Ga0070667_1000150104 132
360 3300005434 Ga0070709_10011165 Ga0070709_100111653 132
361 3300005435 Ga0070714_100051098 Ga0070714_1000510983 132
362 3300005436 Ga0070713_100012585 Ga0070713_1000125852 132
363 3300005437 Ga0070710_10008108 Ga0070710_100081082 132
364 3300005438 Ga0070701_10534913 Ga0070701_105349132 132
365 3300005439 Ga0070711_100124408 Ga0070711_1001244082 132
366 3300005440 Ga0070705_100377861 Ga0070705_1003778611 132
367 3300005441 Ga0070700_100202336 Ga0070700_1002023362 132
368 3300005455 Ga0070663_100260532 Ga0070663_1002605322 132
369 3300005458 Ga0070681_10040444 Ga0070681_100404444 132
370 3300005458 Ga0070681_10406289 Ga0070681_104062891 132
371 3300005458 Ga0070681_10700047 Ga0070681_107000471 132
372 3300005459 Ga0068867_100418996 Ga0068867_1004189962 132
373 3300005466 Ga0070685_10244574 Ga0070685_102445742 132
374 3300005530 Ga0070679_100082606 Ga0070679_1000826064 132
375 3300005530 Ga0070679_100252520 Ga0070679_1002525202 132
376 3300005530 Ga0070679_100277019 Ga0070679_1002770192 132
377 3300005535 Ga0070684_100311377 Ga0070684_1003113772 132
378 3300005539 Ga0068853_100328557 Ga0068853_1003285572 132
379 3300005539 Ga0068853_100418783 Ga0068853_1004187832 132
380 3300005544 Ga0070686_100021647 Ga0070686_1000216473 132
381 3300005546 Ga0070696_100309883 Ga0070696_1003098831 132
382 3300005547 Ga0070693_100491668 Ga0070693_1004916682 132
383 3300005548 Ga0070665_100234794 Ga0070665_1002347942 132
384 3300005549 Ga0070704_100739494 Ga0070704_1007394942 132
385 3300005563 Ga0068855_100034429 Ga0068855_1000344296 132
386 3300005563 Ga0068855_100046361 Ga0068855_1000463613 132
387 3300005563 Ga0068855_100454307 Ga0068855_1004543072 132
388 3300005564 Ga0070664_100096824 Ga0070664_1000968242 132
389 3300005564 Ga0070664_101950108 Ga0070664_1019501081 132
390 3300005577 Ga0068857_100508115 Ga0068857_1005081152 132
391 3300005578 Ga0068854_101150832 Ga0068854_1011508321 132
392 3300005614 Ga0068856_100059622 Ga0068856_1000596225 132
393 3300005614 Ga0068856_101116249 Ga0068856_1011162491 132
394 3300005614 Ga0068856_101281959 Ga0068856_1012819592 132
395 3300005615 Ga0070702_100019921 Ga0070702_1000199212 132
396 3300005616 Ga0068852_100015569 Ga0068852_1000155695 132
397 3300005616 Ga0068852_100491691 Ga0068852_1004916912 132
398 3300005617 Ga0068859_100077641 Ga0068859_1000776412 132
399 3300005618 Ga0068864_100178406 Ga0068864_1001784062 132
400 3300005718 Ga0068866_10194272 Ga0068866_101942722 132
401 3300005719 Ga0068861_100465344 Ga0068861_1004653442 132
402 3300005834 Ga0068851_10250166 Ga0068851_102501662 132
403 3300005841 Ga0068863_100177973 Ga0068863_1001779732 132
404 3300005842 Ga0068858_100413605 Ga0068858_1004136052 132
405 3300005843 Ga0068860_100132560 Ga0068860_1001325602 132
406 3300005983 Ga0081540_1005514 Ga0081540_10055142 132
407 3300006028 Ga0070717_10001862 Ga0070717_100018624 132
408 3300006058 Ga0075432_10003683 Ga0075432_100036834 132
409 3300006173 Ga0070716_100003599 Ga0070716_1000035992 132
410 3300006175 Ga0070712_100365986 Ga0070712_1003659862 132
411 3300006194 Ga0075427_10006245 Ga0075427_100062452 132
412 3300006237 Ga0097621_100014218 Ga0097621_1000142182 132
413 3300006358 Ga0068871_100120498 Ga0068871_1001204982 132
414 3300006844 Ga0075428_100016183 Ga0075428_1000161835 132
415 3300006846 Ga0075430_100002056 Ga0075430_1000020563 132
416 3300006847 Ga0075431_100003489 Ga0075431_1000034893 132
417 3300006852 Ga0075433_10000975 Ga0075433_100009752 132
418 3300006871 Ga0075434_100009141 Ga0075434_1000091415 132
419 3300006871 Ga0075434_100097339 Ga0075434_1000973392 132
420 3300006880 Ga0075429_100003309 Ga0075429_1000033096 132
421 3300006931 Ga0097620_100077644 Ga0097620_1000776442 132
422 3300007076 Ga0075435_100013273 Ga0075435_1000132733 132
423 3300009011 Ga0105251_10390841 Ga0105251_103908412 132
424 3300009092 Ga0105250_10228553 Ga0105250_102285532 132
425 3300009093 Ga0105240_10139397 Ga0105240_101393972 132
426 3300009093 Ga0105240_10448727 Ga0105240_104487271 132
427 3300009093 Ga0105240_10625281 Ga0105240_106252812 132
428 3300009094 Ga0111539_10000528 Ga0111539_100005285 132
429 3300009098 Ga0105245_10068932 Ga0105245_100689323 132
430 3300009101 Ga0105247_10048801 Ga0105247_100488013 132
431 3300009147 Ga0114129_10001477 Ga0114129_100014775 132
432 3300009148 Ga0105243_10038896 Ga0105243_100388962 132
433 3300009176 Ga0105242_10039122 Ga0105242_100391222 132
434 3300009177 Ga0105248_10241572 Ga0105248_102415722 132
435 3300009545 Ga0105237_10504905 Ga0105237_105049052 132
436 3300009551 Ga0105238_10403418 Ga0105238_104034181 132
437 3300009551 Ga0105238_10698658 Ga0105238_106986582 132
438 3300010375 Ga0105239_10228481 Ga0105239_102284812 132
439 3300011119 Ga0105246_10982887 Ga0105246_109828871 132
440 3300012483 Ga0157337_1000643 Ga0157337_10006432 132
441 3300013100 Ga0157373_10067799 Ga0157373_100677993 132
442 3300013100 Ga0157373_10667678 Ga0157373_106676782 132
443 3300013102 Ga0157371_10322111 Ga0157371_103221111 132
444 3300013102 Ga0157371_10368375 Ga0157371_103683752 132
445 3300013104 Ga0157370_10137309 Ga0157370_101373092 132
446 3300013104 Ga0157370_11423349 Ga0157370_114233492 132
447 3300013105 Ga0157369_10119677 Ga0157369_101196772 132
448 3300013105 Ga0157369_10295835 Ga0157369_102958352 132
449 3300013296 Ga0157374_10890242 Ga0157374_108902422 132
450 3300013297 Ga0157378_10047440 Ga0157378_100474403 132
451 3300013306 Ga0163162_12045174 Ga0163162_120451741 132
452 3300013306 Ga0163162_12352795 Ga0163162_123527952 132
453 3300013307 Ga0157372_10154780 Ga0157372_101547801 132
454 3300013307 Ga0157372_10997970 Ga0157372_109979702 132
455 3300013307 Ga0157372_11083179 Ga0157372_110831792 132
456 3300013307 Ga0157372_11165292 Ga0157372_111652921 132
457 3300013308 Ga0157375_10927554 Ga0157375_109275542 132
458 3300014325 Ga0163163_10300859 Ga0163163_103008592 132
459 3300014968 Ga0157379_10218083 Ga0157379_102180832 132
460 3300014968 Ga0157379_10475732 Ga0157379_104757322 132
461 3300014969 Ga0157376_10611885 Ga0157376_106118852 132
462 3300017792 Ga0163161_10900074 Ga0163161_109000742 132
463 3300020081 Ga0206354_11271362 Ga0206354_112713622 132
464 3300025735 Ga0207713_1177315 Ga0207713_11773152 132
465 3300025898 Ga0207692_10000849 Ga0207692_100008495 132
466 3300025899 Ga0207642_10063491 Ga0207642_100634912 132
467 3300025900 Ga0207710_10051963 Ga0207710_100519632 132
468 3300025903 Ga0207680_10227257 Ga0207680_102272572 132
469 3300025905 Ga0207685_10004719 Ga0207685_100047193 132
470 3300025906 Ga0207699_10015354 Ga0207699_100153543 132
471 3300025909 Ga0207705_10104154 Ga0207705_101041542 132
472 3300025909 Ga0207705_10364742 Ga0207705_103647422 132
473 3300025912 Ga0207707_10255296 Ga0207707_102552962 132
474 3300025912 Ga0207707_10938910 Ga0207707_109389101 132
475 3300025913 Ga0207695_10084346 Ga0207695_100843463 132
476 3300025916 Ga0207663_10010022 Ga0207663_100100222 132
477 3300025916 Ga0207663_10231348 Ga0207663_102313482 132
478 3300025917 Ga0207660_10071085 Ga0207660_100710853 132
479 3300025918 Ga0207662_10822231 Ga0207662_108222312 132
480 3300025919 Ga0207657_10030200 Ga0207657_100302003 132
481 3300025919 Ga0207657_10046045 Ga0207657_100460452 132
482 3300025919 Ga0207657_10049848 Ga0207657_100498482 132
483 3300025920 Ga0207649_10426105 Ga0207649_104261052 132
484 3300025921 Ga0207652_10045626 Ga0207652_100456262 132
485 3300025921 Ga0207652_10065293 Ga0207652_100652934 132
486 3300025921 Ga0207652_10263380 Ga0207652_102633802 132
487 3300025921 Ga0207652_11002585 Ga0207652_110025852 132
488 3300025924 Ga0207694_10018170 Ga0207694_100181703 132
489 3300025924 Ga0207694_11189101 Ga0207694_111891011 132
490 3300025925 Ga0207650_10019781 Ga0207650_100197812 132
491 3300025927 Ga0207687_10020528 Ga0207687_100205284 132
492 3300025928 Ga0207700_10000290 Ga0207700_1000029014 132
493 3300025929 Ga0207664_10011397 Ga0207664_100113973 132
494 3300025929 Ga0207664_10148360 Ga0207664_101483602 132
495 3300025931 Ga0207644_10114016 Ga0207644_101140162 132
496 3300025934 Ga0207686_10143841 Ga0207686_101438412 132
497 3300025934 Ga0207686_10187036 Ga0207686_101870362 132
498 3300025935 Ga0207709_10386909 Ga0207709_103869092 132
499 3300025936 Ga0207670_10066843 Ga0207670_100668433 132
500 3300025937 Ga0207669_10051306 Ga0207669_100513063 132
501 3300025938 Ga0207704_11367885 Ga0207704_113678852 132
502 3300025939 Ga0207665_10000719 Ga0207665_1000071912 132
503 3300025940 Ga0207691_10783504 Ga0207691_107835042 132
504 3300025941 Ga0207711_10037954 Ga0207711_100379543 132
505 3300025942 Ga0207689_10052656 Ga0207689_100526562 132
506 3300025944 Ga0207661_10115604 Ga0207661_101156043 132
507 3300025944 Ga0207661_10358056 Ga0207661_103580562 132
508 3300025945 Ga0207679_10441782 Ga0207679_104417822 132
509 3300025949 Ga0207667_10021843 Ga0207667_100218436 132
510 3300025949 Ga0207667_10119538 Ga0207667_101195382 132
511 3300025960 Ga0207651_10025682 Ga0207651_100256822 132
512 3300025961 Ga0207712_10165155 Ga0207712_101651552 132
513 3300025972 Ga0207668_10081158 Ga0207668_100811582 132
514 3300025981 Ga0207640_10444288 Ga0207640_104442882 132
515 3300025986 Ga0207658_10034145 Ga0207658_100341453 132
516 3300026023 Ga0207677_10115356 Ga0207677_101153562 132
517 3300026035 Ga0207703_10012561 Ga0207703_100125614 132
518 3300026041 Ga0207639_10415489 Ga0207639_104154892 132
519 3300026067 Ga0207678_10006545 Ga0207678_100065456 132
520 3300026078 Ga0207702_10036530 Ga0207702_100365302 132
521 3300026078 Ga0207702_10341752 Ga0207702_103417522 132
522 3300026078 Ga0207702_10647095 Ga0207702_106470952 132
523 3300026078 Ga0207702_11117600 Ga0207702_111176002 132
524 3300026078 Ga0207702_11233472 Ga0207702_112334721 132
525 3300026095 Ga0207676_10091150 Ga0207676_100911502 132
526 3300026116 Ga0207674_10390731 Ga0207674_103907312 132
527 3300026116 Ga0207674_11772636 Ga0207674_117726361 132
528 3300026118 Ga0207675_100476902 Ga0207675_1004769022 132
529 3300026121 Ga0207683_10001293 Ga0207683_100012936 132
530 3300026142 Ga0207698_10017188 Ga0207698_100171881 132
531 3300026142 Ga0207698_10092670 Ga0207698_100926703 132
532 3300026142 Ga0207698_10258184 Ga0207698_102581842 132
533 3300027907 Ga0207428_10000291 Ga0207428_1000029158 132
534 3300028379 Ga0268266_10047490 Ga0268266_100474903 132
535 3300031235 Ga0265330_10012435 Ga0265330_100124353 132
536 3300031241 Ga0265325_10008234 Ga0265325_100082343 132
537 3300031595 Ga0265313_10010630 Ga0265313_100106305 132
538 3300031595 Ga0265313_10095574 Ga0265313_100955741 132
539 3300031712 Ga0265342_10001132 Ga0265342_100011323 132
540 3300034816 Ga0373930_0010716 Ga0373930_0010716_750_1175 132
541 3300034957 Ga0373938_0012517 Ga0373938_0012517_1046_1471 132
542 3300035083 Ga0373926_0003254 Ga0373926_0003254_1529_1954 132
543 3300035084 Ga0373928_0003461 Ga0373928_0003461_1057_1482 132
544 3300035085 Ga0373929_0071923 Ga0373929_0071923_39_464 132
545 3300035089 Ga0373944_0002442 Ga0373944_0002442_602_1027 132
546 3300035090 Ga0373949_0007797 Ga0373949_0007797_850_1275 132
547 3300035091 Ga0373951_0048220 Ga0373951_0048220_440_865 132
548 3300035112 Ga0373932_0008691 Ga0373932_0008691_1398_1823 132
549 3300035113 Ga0373936_0001218 Ga0373936_0001218_3031_3456 132
550 3300035115 Ga0373941_0049948 Ga0373941_0049948_294_719 132
551 3300035116 Ga0373945_0025022 Ga0373945_0025022_742_1167 132
552 3300035120 Ga0373957_0021460 Ga0373957_0021460_1319_1744 132
553 3300035121 Ga0373960_0002561 Ga0373960_0002561_3048_3473 132
554 3300035170 Ga0373943_0007114 Ga0373943_0007114_431_856 132
555 3300035170 Ga0373943_0034507 Ga0373943_0034507_622_1047 132
556 3300035171 Ga0373946_0001618 Ga0373946_0001618_5086_5511 132
557 3300035171 Ga0373946_0024824 Ga0373946_0024824_1257_1682 132
558 3300035172 Ga0373955_0005754 Ga0373955_0005754_3394_3819 132
559 3300035207 Ga0373942_0001847 Ga0373942_0001847_4665_5090 132
560 3300035241 Ga0373961_0033656 Ga0373961_0033656_197_622 132
561 3300035242 Ga0373962_0128593 Ga0373962_0128593_298_723 132
562 3300035410 Ga0373924_0088592 Ga0373924_0088592_510_935 132
563 3300035691 Ga0373931_0009468 Ga0373931_0009468_3993_4418 132
564 3300035692 Ga0373935_0015189 Ga0373935_0015189_1739_2164 132
565 3300035692 Ga0373935_0209387 Ga0373935_0209387_730_1155 132
566 3300035695 Ga0373927_0023883 Ga0373927_0023883_2208_2633 132
567 3300035724 Ga0373933_0124674 Ga0373933_0124674_936_1361 132
568 3300035725 Ga0373947_0000874 Ga0373947_0000874_405_830 132
569 3300035725 Ga0373947_0148838 Ga0373947_0148838_601_1026 132
570 3300037068 Ga0373925_0013063 Ga0373925_0013063_5573_5998 132
571 3300037068 Ga0373925_0033677 Ga0373925_0033677_233_658 132
572 3300044842 Ga0466957_0579864 Ga0466957_0579864_214_639 132
573 3300046452 Ga0495617_038309 Ga0495617_038309_1028_1453 132
574 3300046454 Ga0495592_0086248 Ga0495592_0086248_795_1220 132
575 3300046455 Ga0495603_0005459 Ga0495603_0005459_2292_2717 132
576 3300046455 Ga0495603_0049120 Ga0495603_0049120_1381_1806 132
577 3300046459 Ga0495629_0000329 Ga0495629_0000329_9826_10251 132
578 3300046459 Ga0495629_0063291 Ga0495629_0063291_601_1026 132
579 3300046461 Ga0495641_0009078 Ga0495641_0009078_1277_1702 132
580 3300046461 Ga0495641_0050896 Ga0495641_0050896_578_1003 132
581 3300046462 Ga0495651_0008552 Ga0495651_0008552_2375_2800 132
582 3300046463 Ga0495653_0112173 Ga0495653_0112173_1489_1914 132
583 3300046472 Ga0495580_0003611 Ga0495580_0003611_6294_6719 132
584 3300046473 Ga0495582_0054817 Ga0495582_0054817_1729_2154 132
585 3300046473 Ga0495582_0083289 Ga0495582_0083289_307_732 132
586 3300046475 Ga0495639_0007456 Ga0495639_0007456_1393_1818 132
587 3300046476 Ga0495662_0033343 Ga0495662_0033343_172_597 132
588 3300046477 Ga0495664_0009503 Ga0495664_0009503_3040_3465 132
589 3300046491 Ga0495584_0015175 Ga0495584_0015175_275_700 132
590 3300046499 Ga0495594_0028755 Ga0495594_0028755_1558_1983 132
591 3300046499 Ga0495594_0127347 Ga0495594_0127347_126_551 132
592 3300046500 Ga0495596_0260973 Ga0495596_0260973_177_602 132
593 3300046511 Ga0495608_0146790 Ga0495608_0146790_917_1342 132
594 3300046517 Ga0495630_0067980 Ga0495630_0067980_1773_2198 132
595 3300046518 Ga0495631_0098585 Ga0495631_0098585_543_968 132
596 3300046523 Ga0495644_0000434 Ga0495644_0000434_15224_15649 132
597 3300046526 Ga0495666_0015395 Ga0495666_0015395_1891_2316 132
598 3300046529 Ga0495652_0013346 Ga0495652_0013346_5865_6290 132
599 3300046531 Ga0495665_0026914 Ga0495665_0026914_2281_2706 132
600 3300046533 Ga0495640_0056948 Ga0495640_0056948_481_906 132
601 3300046535 Ga0495586_0028072 Ga0495586_0028072_2305_2730 132
602 3300046536 Ga0495587_0018879 Ga0495587_0018879_285_710 132
603 3300046537 Ga0495598_0003767 Ga0495598_0003767_1320_1745 132
604 3300046557 Ga0495622_0003676 Ga0495622_0003676_2027_2452 132
605 3300046558 Ga0495633_0000643 Ga0495633_0000643_3080_3505 132
606 3300046559 Ga0495667_0005122 Ga0495667_0005122_5737_6162 132
607 3300046615 Ga0495656_0000842 Ga0495656_0000842_7249_7674 132
608 3300046648 Ga0495611_0004301 Ga0495611_0004301_2089_2514 132
609 3300046663 Ga0495635_0001379 Ga0495635_0001379_15028_15453 132
610 3300046664 Ga0495659_0001236 Ga0495659_0001236_2044_2469 132
611 3300046674 Ga0495588_0025967 Ga0495588_0025967_1320_1745 132
612 3300046678 Ga0495599_0018912 Ga0495599_0018912_3460_3885 132
613 3300046680 Ga0495646_0006527 Ga0495646_0006527_3636_4061 132
614 3300046681 Ga0495647_0002668 Ga0495647_0002668_1538_1963 132
615 3300046681 Ga0495647_0005000 Ga0495647_0005000_3316_3741 132
616 3300046683 Ga0495658_0019600 Ga0495658_0019600_1232_1657 132
617 3300046683 Ga0495658_0032637 Ga0495658_0032637_1018_1443 132
618 3300046683 Ga0495658_0102097 Ga0495658_0102097_262_687 132
619 3300046689 Ga0495613_0002281 Ga0495613_0002281_9043_9468 132
620 3300046689 Ga0495613_0020424 Ga0495613_0020424_3135_3560 132
621 3300046689 Ga0495613_0095407 Ga0495613_0095407_1481_1906 132
622 3300046690 Ga0495624_0017283 Ga0495624_0017283_4248_4673 132
623 3300046690 Ga0495624_0630233 Ga0495624_0630233_115_540 132
624 3300046691 Ga0495670_0008704 Ga0495670_0008704_3400_3825 132
625 3300046794 Ga0495589_0109481 Ga0495589_0109481_130_555 132
626 3300046809 Ga0495600_0007387 Ga0495600_0007387_129_554 132
627 3300046809 Ga0495600_0131647 Ga0495600_0131647_368_793 132
628 3300047315 Ga0495581_0061310 Ga0495581_0061310_353_778 132
629 3300047317 Ga0495604_0033622 Ga0495604_0033622_3504_3929 132
630 3300047318 Ga0495636_0080604 Ga0495636_0080604_712_1137 132
631 3300047319 Ga0495674_0028368 Ga0495674_0028368_283_708 132
632 3300047321 Ga0495676_0314303 Ga0495676_0314303_346_771 132
633 3300047322 Ga0495680_0033843 Ga0495680_0033843_3581_4006 132
634 3300047446 Ga0495679_081250 Ga0495679_081250_283_708 132
635 3300047470 Ga0495681_0064951 Ga0495681_0064951_253_678 132
636 3300047471 Ga0495684_0035502 Ga0495684_0035502_2207_2632 132
637 3300047673 Ga0495593_0012135 Ga0495593_0012135_4223_4648 132
638 3300047673 Ga0495593_0038715 Ga0495593_0038715_527_952 132
639 3300048089 Ga0495614_0088465 Ga0495614_0088465_215_640 132
640 3300048903 Ga0496100_0144215 Ga0496100_0144215_1195_1620 132
641 3300048903 Ga0496100_0367840 Ga0496100_0367840_266_691 132
642 3300048904 Ga0496101_0304570 Ga0496101_0304570_795_1220 132
643 3300048904 Ga0496101_0574367 Ga0496101_0574367_395_820 132
644 3300048905 Ga0496102_0154819 Ga0496102_0154819_395_820 132
645 3300048906 Ga0496103_0062407 Ga0496103_0062407_559_984 132
646 3300048906 Ga0496103_0214867 Ga0496103_0214867_795_1220 132
647 3300048907 Ga0496104_0150356 Ga0496104_0150356_1299_1724 132
648 3300048907 Ga0496104_0301127 Ga0496104_0301127_35_460 132
649 3300048908 Ga0496105_0225419 Ga0496105_0225419_705_1130 132
650 3300048908 Ga0496105_0701845 Ga0496105_0701845_156_581 132
651 3300048909 Ga0496106_0018998 Ga0496106_0018998_3334_3759 132
652 3300048910 Ga0496107_0410147 Ga0496107_0410147_481_906 132
653 3300048911 Ga0496108_0327544 Ga0496108_0327544_516_941 132
654 3300048911 Ga0496108_0540885 Ga0496108_0540885_473_898 132
655 3300048912 Ga0496109_0042157 Ga0496109_0042157_2185_2610 132
656 3300048913 Ga0496110_0122545 Ga0496110_0122545_1524_1949 132
657 3300048913 Ga0496110_0138319 Ga0496110_0138319_118_543 132
658 3300048914 Ga0496111_0040897 Ga0496111_0040897_1255_1680 132
659 3300048915 Ga0496112_0131407 Ga0496112_0131407_1183_1608 132
660 3300048915 Ga0496112_0169516 Ga0496112_0169516_1329_1754 132
661 3300048916 Ga0496113_0445340 Ga0496113_0445340_156_581 132
662 3300048917 Ga0496114_0008606 Ga0496114_0008606_2076_2501 132
663 3300048918 Ga0496115_0051251 Ga0496115_0051251_102_527 132
664 3300048918 Ga0496115_0260056 Ga0496115_0260056_208_633 132
665 3300048928 Ga0496125_0388504 Ga0496125_0388504_18_443 132
666 3300049571 Ga0501034_0353702 Ga0501034_0353702_418_843 132
667 3300049571 Ga0501034_0813078 Ga0501034_0813078_34_459 132
668 3300049581 Ga0501047_0482356 Ga0501047_0482356_261_686 132
669 3300049585 Ga0501069_0004336 Ga0501069_0004336_862_1287 132
670 3300049586 Ga0501070_0003447 Ga0501070_0003447_8189_8614 132
671 3300049742 Ga0501080_0434103 Ga0501080_0434103_347_772 132
672 3300049823 Ga0501044_1115430 Ga0501044_1115430_79_504 132
673 3300050496 nmdc:mga07m45_315047_c1 nmdc:mga07m45_315047_c1_156_581 132
674 3300050507 nmdc:mga05p37_262_c1 nmdc:mga05p37_262_c1_43450_43875 132
675 3300050508 nmdc:mga09592_1228_c1 nmdc:mga09592_1228_c1_18753_19178 132
676 3300050509 nmdc:mga0qj67_1310_c1 nmdc:mga0qj67_1310_c1_12494_12919 132
677 3300050510 nmdc:mga06r32_510_c1 nmdc:mga06r32_510_c1_12127_12552 132
678 3300050511 nmdc:mga08y16_3743_c2 nmdc:mga08y16_3743_c2_5270_5695 132
679 3300050512 nmdc:mga0n895_106_c1 nmdc:mga0n895_106_c1_43799_44224 132
680 3300050512 nmdc:mga0n895_217352_c1 nmdc:mga0n895_217352_c1_264_689 132
681 3300050513 nmdc:mga0rr50_1148_c1 nmdc:mga0rr50_1148_c1_10075_10500 132
682 3300050513 nmdc:mga0rr50_81239_c1 nmdc:mga0rr50_81239_c1_1401_1826 132
683 3300050514 nmdc:mga08x19_161049_c1 nmdc:mga08x19_161049_c1_107_532 132
684 3300050515 nmdc:mga0a205_1112_c1 nmdc:mga0a205_1112_c1_12995_13420 132
685 3300053077 Ga0495601_0018697 Ga0495601_0018697_1904_2329 132
686 3300053078 Ga0495612_0001704 Ga0495612_0001704_7102_7527 132
687 3300053084 Ga0495595_0258506 Ga0495595_0258506_44_469 132
688 3300053085 Ga0495619_0000609 Ga0495619_0000609_11970_12395 132
689 3300053085 Ga0495619_0093004 Ga0495619_0093004_1401_1826 132
690 3300060353 Ga0501082_0888920 Ga0501082_0888920_173_598 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

13

141

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.695 9 129
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.6949 9 129
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.6419 9 129
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.6415 9 129
3dww-assembly1.cif.gz_C electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.5688 6 128
ID Description Score Start End Superfamily
af_P64515_1_129_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7983 5 129 1.20.120.550
af_P64515_1_129_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7125 5 129 1.20.120.550
af_Q4CY37_50_170_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7065 60 132 1.20.1250.20
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6956 9 129 1.20.120.550
af_Q8N4S7_43_254_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6819 52 128 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A6S6QSA7-F1-model_v4 MAPEG family protein 0.9752 1 129 GO:0016020
AF-A0A6P1B7G6-F1-model_v4 deleted 0.9739 50 132
AF-A0A0P7YBX8-F1-model_v4 MAPEG family protein 0.9672 17 129 GO:0016020
AF-A0A4Q6BXS5-F1-model_v4 MAPEG family protein 0.9658 54 129 GO:0016020
AF-A0A1I3UQ71-F1-model_v4 MAPEG family protein 0.9656 2 129 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.26 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map