F475481

General Info

Members Datasets Scaffolds Average Seq Length
690 276 1374 322

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0000470|Ga0495633_0000470_4817_5971
Length 384
Sequence MARTCKSSQISRLPRGAASSIPPQTASRGGDQIETLELDYPCFDFDPAAALSHRRSNTSHGRGKTMRLATRRDGSRDGRLILLSSDGSHFADAPVATLQAAMEAWADVHPVLSAIADFPHPLDPATLAAPLPRAWQWLDGSAFESHGALMDRVLGVVPEKTGRPLMYQGVSDHFYGPLDDVPMPDEALGIDFEGEFGVIVDTVPMGVTPDQAMAYIRLIVQINDWSLRALAGPEMKSGFGWVQAKPPCTMAPFAVTPDELGGQWRDGRVCMDLLVDWNGTRFGAANGEPMGFGFHDLVAHAARTRPLVAGTVIGSGTVSNPDFRQVGSSCIAERRGIEIVDEGAARTPFMRFGDRVRMEGRLPDGRAPFGIIDQQVVAYAGASS

Samples

Sample ID Description Type Environment
1 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
245 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
246 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
247 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
250 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
253 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
254 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
257 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
258 2643221558 Rhizobium sp. Root149 Isolate Unclassified
259 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
260 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
261 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
262 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
263 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
264 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
265 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
266 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
267 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
268 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
269 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
270 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
271 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
272 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
273 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
274 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
275 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
276 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 0
Isolates 4.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0
Rhizoplane 1.16
Rhizosphere 82.03
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495633_0000470 3300046558 Bacteria 41242
2 JGI24736J21556_1000219 3300001904 Bacteria 10342
3 JGI24741J21665_1000021 3300001915 Bacteria 37608
4 JGI24741J21665_1000068 3300001915 Bacteria 25347
5 JGI24741J21665_1000106 3300001915 Bacteria 22073
6 JGI24741J21665_1000204 3300001915 Bacteria 17636
7 JGI24741J21665_1001619 3300001915 Bacteria 6296
8 JGI24740J21852_10000043 3300001979 Bacteria 41252
9 JGI24740J21852_10001202 3300001979 Bacteria 11694
10 JGI24740J21852_10001360 3300001979 Bacteria 11160
11 JGI24740J21852_10004146 3300001979 Bacteria 6260
12 JGI24740J21852_10007599 3300001979 Bacteria 4390
13 JGI24739J22299_10001257 3300001989 Bacteria 9505
14 JGI24739J22299_10003195 3300001989 Bacteria 6247
15 JGI24739J22299_10007955 3300001989 Bacteria 3966
16 JGI24739J22299_10017169 3300001989 Bacteria 2614
17 JGI24737J22298_10000054 3300001990 Bacteria 33923
18 JGI24737J22298_10000947 3300001990 Bacteria 10302
19 JGI24737J22298_10001005 3300001990 Bacteria 9987
20 JGI24737J22298_10001250 3300001990 Bacteria 8990
21 JGI24737J22298_10003837 3300001990 Bacteria 5286
22 JGI24737J22298_10012428 3300001990 Bacteria 2776
23 JGI24737J22298_10022508 3300001990 Bacteria 2003
24 JGI24735J21928_10001235 3300002067 Bacteria 9077
25 JGI24735J21928_10003256 3300002067 Bacteria 5554
26 JGI24735J21928_10010665 3300002067 Bacteria 2924
27 JGI24738J21930_10000887 3300002075 Bacteria 8574
28 JGI24738J21930_10004705 3300002075 Bacteria 3324
29 JGI24744J21845_10004568 3300002077 Bacteria 2862
30 JGI25153J46596_10000005 3300003215 Bacteria 492839
31 rootH1_10058872 3300003316 Bacteria 9634
32 rootL2_10060416 3300003322 Bacteria 28530
33 rootL2_10095669 3300003322 Bacteria 1594
34 rootL2_10165326 3300003322 Bacteria 2278
35 rootL2_10201879 3300003322 Bacteria 2862
36 rootH1_10113965 3300003323 Bacteria 8147
37 Ga0055530_10028273 3300003791 Bacteria 1516
38 Ga0065704_10098629 3300005289 Bacteria 2345
39 Ga0070658_10000167 3300005327 Bacteria 57334
40 Ga0070658_10000180 3300005327 Bacteria 55242
41 Ga0070658_10000937 3300005327 Bacteria 24984
42 Ga0070658_10080612 3300005327 Bacteria 2673
43 Ga0070658_10153838 3300005327 Bacteria 1927
44 Ga0070658_10167781 3300005327 Bacteria 1843
45 Ga0070658_10287692 3300005327 Bacteria 1400
46 Ga0070676_10023574 3300005328 Bacteria 3460
47 Ga0070676_10210184 3300005328 Bacteria 1280
48 Ga0070683_100105391 3300005329 Bacteria 2658
49 Ga0070683_100133055 3300005329 Bacteria 2354
50 Ga0070670_100008343 3300005331 Bacteria 8831
51 Ga0070670_100036548 3300005331 Bacteria 4227
52 Ga0070670_100117660 3300005331 Bacteria 2292
53 Ga0070677_10033610 3300005333 Bacteria 1976
54 Ga0068869_100025861 3300005334 Bacteria 4080
55 Ga0070666_10036790 3300005335 Bacteria 3251
56 Ga0070666_10072946 3300005335 Bacteria 2338
57 Ga0070666_10077232 3300005335 Bacteria 2273
58 Ga0070666_10086650 3300005335 Bacteria 2146
59 Ga0070680_100000486 3300005336 Bacteria 27276
60 Ga0070660_100005124 3300005339 Bacteria 9052
61 Ga0070660_100014169 3300005339 Bacteria 5740
62 Ga0070660_100121065 3300005339 Bacteria 2088
63 Ga0070689_100030340 3300005340 Bacteria 4103
64 Ga0070691_10017513 3300005341 Bacteria 3297
65 Ga0070687_100079499 3300005343 Bacteria 1785
66 Ga0070661_100002081 3300005344 Bacteria 13777
67 Ga0070661_100015978 3300005344 Bacteria 5299
68 Ga0070661_100016878 3300005344 Bacteria 5168
69 Ga0070661_100056982 3300005344 Bacteria 2863
70 Ga0070661_100081024 3300005344 Bacteria 2396
71 Ga0070661_100111753 3300005344 Bacteria 2041
72 Ga0070661_100117773 3300005344 Bacteria 1987
73 Ga0070661_100136144 3300005344 Bacteria 1848
74 Ga0070668_100016788 3300005347 Bacteria 5474
75 Ga0070669_100034151 3300005353 Bacteria 3683
76 Ga0070675_100017384 3300005354 Bacteria 5714
77 Ga0070675_100064017 3300005354 Bacteria 3040
78 Ga0070675_100072390 3300005354 Bacteria 2861
79 Ga0070671_100011172 3300005355 Bacteria 7211
80 Ga0070671_100011225 3300005355 Bacteria 7194
81 Ga0070671_100091423 3300005355 Bacteria 2549
82 Ga0070671_100121933 3300005355 Unclassified 2194
83 Ga0070674_100000078 3300005356 Bacteria 44919
84 Ga0070674_100003725 3300005356 Bacteria 8593
85 Ga0070673_100007256 3300005364 Bacteria 7295
86 Ga0070673_100026968 3300005364 Bacteria 4253
87 Ga0070673_100082551 3300005364 Bacteria 2609
88 Ga0070673_100087594 3300005364 Bacteria 2538
89 Ga0070688_100056433 3300005365 Bacteria 2467
90 Ga0070688_100062645 3300005365 Bacteria 2355
91 Ga0070659_100000573 3300005366 Bacteria 26939
92 Ga0070659_100008652 3300005366 Bacteria 7445
93 Ga0070659_100057839 3300005366 Bacteria 3058
94 Ga0070659_100309891 3300005366 Bacteria 1318
95 Ga0070667_100012614 3300005367 Bacteria 6990
96 Ga0070667_100210924 3300005367 Bacteria 1726
97 Ga0070663_100000203 3300005455 Bacteria 29587
98 Ga0070663_100005836 3300005455 Bacteria 7356
99 Ga0070663_100017206 3300005455 Bacteria 4713
100 Ga0070663_100028464 3300005455 Bacteria 3805
101 Ga0070663_100032188 3300005455 Bacteria 3612
102 Ga0070663_100038387 3300005455 Bacteria 3341
103 Ga0070663_100038633 3300005455 Bacteria 3330
104 Ga0070678_100000005 3300005456 Bacteria 70019
105 Ga0070678_100012235 3300005456 Bacteria 5325
106 Ga0070678_100032869 3300005456 Bacteria 3595
107 Ga0070678_100107199 3300005456 Bacteria 2179
108 Ga0070662_100031732 3300005457 Bacteria 3710
109 Ga0070662_100032403 3300005457 Bacteria 3673
110 Ga0070662_100036683 3300005457 Bacteria 3470
111 Ga0070662_100040872 3300005457 Bacteria 3304
112 Ga0070662_100176791 3300005457 Bacteria 1680
113 Ga0070681_10000836 3300005458 Bacteria 25786
114 Ga0070685_10018913 3300005466 Bacteria 3711
115 Ga0070679_100002376 3300005530 Bacteria 17059
116 Ga0068853_100134268 3300005539 Bacteria 2217
117 Ga0068853_100139822 3300005539 Bacteria 2173
118 Ga0068853_100377060 3300005539 Bacteria 1324
119 Ga0070672_100000872 3300005543 Bacteria 18058
120 Ga0070672_100049640 3300005543 Unclassified 3266
121 Ga0070672_100086646 3300005543 Bacteria 2519
122 Ga0070672_100284434 3300005543 Bacteria 1399
123 Ga0070686_100099367 3300005544 Bacteria 1963
124 Ga0070665_100036260 3300005548 Bacteria 4961
125 Ga0068855_100019318 3300005563 Bacteria 8188
126 Ga0068855_100035976 3300005563 Bacteria 5896
127 Ga0068855_100083107 3300005563 Bacteria 3710
128 Ga0068855_100116698 3300005563 Bacteria 3059
129 Ga0068855_100123559 3300005563 Bacteria 2961
130 Ga0068855_100133497 3300005563 Bacteria 2833
131 Ga0070664_100005524 3300005564 Bacteria 10149
132 Ga0070664_100007441 3300005564 Bacteria 8839
133 Ga0070664_100012745 3300005564 Bacteria 6841
134 Ga0070664_100020156 3300005564 Bacteria 5490
135 Ga0070664_100033301 3300005564 Bacteria 4315
136 Ga0070664_100109707 3300005564 Bacteria 2407
137 Ga0070664_100195369 3300005564 Bacteria 1803
138 Ga0068857_100030321 3300005577 Bacteria 4775
139 Ga0068857_100030580 3300005577 Bacteria 4755
140 Ga0068857_100152583 3300005577 Bacteria 2094
141 Ga0068857_100156240 3300005577 Bacteria 2068
142 Ga0068857_100237952 3300005577 Bacteria 1666
143 Ga0068854_100026091 3300005578 Bacteria 4013
144 Ga0068854_100032228 3300005578 Bacteria 3644
145 Ga0068854_100082980 3300005578 Bacteria 2369
146 Ga0068854_100130047 3300005578 Bacteria 1921
147 Ga0068854_100211949 3300005578 Bacteria 1528
148 Ga0068856_100032979 3300005614 Bacteria 5072
149 Ga0068856_100072774 3300005614 Bacteria 3403
150 Ga0068856_100078026 3300005614 Bacteria 3283
151 Ga0068856_100148208 3300005614 Bacteria 2354
152 Ga0068856_100165658 3300005614 Bacteria 2221
153 Ga0068856_100241538 3300005614 Bacteria 1821
154 Ga0068852_100006804 3300005616 Bacteria 8299
155 Ga0068852_100136243 3300005616 Bacteria 2267
156 Ga0068852_100138971 3300005616 Bacteria 2246
157 Ga0068852_100286635 3300005616 Bacteria 1589
158 Ga0068859_100055972 3300005617 Bacteria 3969
159 Ga0068859_100108799 3300005617 Bacteria 2833
160 Ga0068864_100063466 3300005618 Bacteria 3201
161 Ga0068864_100245242 3300005618 Bacteria 1661
162 Ga0068864_100401156 3300005618 Bacteria 1303
163 Ga0068861_100000085 3300005719 Bacteria 44952
164 Ga0068861_100298297 3300005719 Bacteria 1395
165 Ga0068861_100369219 3300005719 Unclassified 1264
166 Ga0068851_10004933 3300005834 Bacteria 6044
167 Ga0068851_10007046 3300005834 Bacteria 5154
168 Ga0068851_10044065 3300005834 Bacteria 2251
169 Ga0068870_10131776 3300005840 Bacteria 1453
170 Ga0068863_100038607 3300005841 Bacteria 4542
171 Ga0068863_100336005 3300005841 Bacteria 1469
172 Ga0068863_100523626 3300005841 Bacteria 1169
173 Ga0068858_100000310 3300005842 Bacteria 51909
174 Ga0068860_100002446 3300005843 Bacteria 19513
175 Ga0068860_100230210 3300005843 Bacteria 1801
176 Ga0068862_100000699 3300005844 Bacteria 34289
177 Ga0081539_10000001 3300005985 Bacteria 808331
178 Ga0075432_10003783 3300006058 Bacteria 5156
179 Ga0075432_10011066 3300006058 Bacteria 3064
180 Ga0075362_10000040 3300006177 Bacteria 46092
181 Ga0075362_10082446 3300006177 Bacteria 1484
182 Ga0075366_10021460 3300006195 Bacteria 3753
183 Ga0097621_100004748 3300006237 Bacteria 9502
184 Ga0097621_100186645 3300006237 Bacteria 1794
185 Ga0075370_10036614 3300006353 Bacteria 2757
186 Ga0075370_10042480 3300006353 Bacteria 2568
187 Ga0068871_100013227 3300006358 Bacteria 6120
188 Ga0068871_100330004 3300006358 Bacteria 1345
189 Ga0097620_100055973 3300006931 Bacteria 3969
190 Ga0097620_100108791 3300006931 Bacteria 2833
191 Ga0105251_10001809 3300009011 Bacteria 17722
192 Ga0105240_10000121 3300009093 Bacteria 163057
193 Ga0105240_10082383 3300009093 Bacteria 3951
194 Ga0105240_10097190 3300009093 Bacteria 3589
195 Ga0105240_10211402 3300009093 Bacteria 2267
196 Ga0105240_10509329 3300009093 Bacteria 1337
197 Ga0105240_10708390 3300009093 Bacteria 1098
198 Ga0105245_10001044 3300009098 Bacteria 25061
199 Ga0105247_10001062 3300009101 Bacteria 20537
200 Ga0105243_10000030 3300009148 Bacteria 190342
201 Ga0105243_10054917 3300009148 Bacteria 3164
202 Ga0105241_10000799 3300009174 Bacteria 23921
203 Ga0105241_10000903 3300009174 Bacteria 22440
204 Ga0105241_10017577 3300009174 Bacteria 5257
205 Ga0105241_10177281 3300009174 Bacteria 1765
206 Ga0105241_10217077 3300009174 Bacteria 1605
207 Ga0105248_10015048 3300009177 Bacteria 8519
208 Ga0105248_10055553 3300009177 Bacteria 4442
209 Ga0105248_10233496 3300009177 Bacteria 2071
210 Ga0105237_10055147 3300009545 Bacteria 3981
211 Ga0105237_10361523 3300009545 Bacteria 1456
212 Ga0105238_10007472 3300009551 Bacteria 10949
213 Ga0105238_10021395 3300009551 Bacteria 6589
214 Ga0105238_10076399 3300009551 Bacteria 3340
215 Ga0105249_10000196 3300009553 Bacteria 69134
216 Ga0105249_10033714 3300009553 Bacteria 4636
217 Ga0105239_10005768 3300010375 Bacteria 14444
218 Ga0105239_10061342 3300010375 Bacteria 4127
219 Ga0105239_10166688 3300010375 Bacteria 2463
220 Ga0105239_10267262 3300010375 Bacteria 1923
221 Ga0105239_10404293 3300010375 Bacteria 1545
222 Ga0105246_10263859 3300011119 Bacteria 1373
223 Ga0157373_10018661 3300013100 Bacteria 5049
224 Ga0157373_10019281 3300013100 Bacteria 4967
225 Ga0157373_10057484 3300013100 Bacteria 2759
226 Ga0157373_10127119 3300013100 Bacteria 1793
227 Ga0157373_10280132 3300013100 Bacteria 1181
228 Ga0157371_10000111 3300013102 Bacteria 123977
229 Ga0157371_10000757 3300013102 Bacteria 37321
230 Ga0157371_10009942 3300013102 Bacteria 7446
231 Ga0157370_10042645 3300013104 Bacteria 4371
232 Ga0157369_10071138 3300013105 Bacteria 3735
233 Ga0157369_10081176 3300013105 Bacteria 3471
234 Ga0157369_10129916 3300013105 Bacteria 2670
235 Ga0157374_10167170 3300013296 Bacteria 2144
236 Ga0163162_10131849 3300013306 Bacteria 2608
237 Ga0163162_10295572 3300013306 Bacteria 1751
238 Ga0157372_10115387 3300013307 Bacteria 3079
239 Ga0157372_10165991 3300013307 Bacteria 2553
240 Ga0157372_10204213 3300013307 Bacteria 2289
241 Ga0157372_10217348 3300013307 Bacteria 2215
242 Ga0157372_10405894 3300013307 Bacteria 1588
243 Ga0157375_10037462 3300013308 Bacteria 4647
244 Ga0157375_10252678 3300013308 Bacteria 1924
245 Ga0163163_10016474 3300014325 Bacteria 6872
246 Ga0157380_10126611 3300014326 Bacteria 2172
247 Ga0157380_10147364 3300014326 Bacteria 2030
248 Ga0157377_10006308 3300014745 Bacteria 5644
249 Ga0157379_10129206 3300014968 Bacteria 2273
250 Ga0157376_10235690 3300014969 Bacteria 1702
251 Ga0163161_10002180 3300017792 Bacteria 14123
252 Ga0163161_10016322 3300017792 Bacteria 5184
253 Ga0163161_10151988 3300017792 Bacteria 1760
254 Ga0163161_10209132 3300017792 Bacteria 1507
255 Ga0213872_10041975 3300021361 Bacteria 2087
256 Ga0213872_10084398 3300021361 Bacteria 1424
257 Ga0209147_100763 3300025229 Bacteria 15759
258 Ga0209455_1010049 3300025272 Bacteria 2434
259 Ga0209758_1000001 3300025297 Bacteria 1981790
260 Ga0209050_1001048 3300025298 Bacteria 34107
261 Ga0209050_1016290 3300025298 Bacteria 3053
262 Ga0207656_10004092 3300025321 Bacteria 5060
263 Ga0207656_10012645 3300025321 Bacteria 3213
264 Ga0207656_10018676 3300025321 Bacteria 2732
265 Ga0207656_10029633 3300025321 Bacteria 2256
266 Ga0207656_10037068 3300025321 Bacteria 2050
267 Ga0207656_10038474 3300025321 Bacteria 2018
268 Ga0207682_10006701 3300025893 Bacteria 4625
269 Ga0207710_10006828 3300025900 Bacteria 4860
270 Ga0207680_10019437 3300025903 Bacteria 3633
271 Ga0207680_10082882 3300025903 Bacteria 2020
272 Ga0207647_10002614 3300025904 Bacteria 13617
273 Ga0207647_10013943 3300025904 Bacteria 5560
274 Ga0207647_10027409 3300025904 Bacteria 3713
275 Ga0207647_10067164 3300025904 Bacteria 2174
276 Ga0207647_10082511 3300025904 Bacteria 1925
277 Ga0207647_10103528 3300025904 Bacteria 1688
278 Ga0207645_10029241 3300025907 Bacteria 3553
279 Ga0207643_10132844 3300025908 Bacteria 1482
280 Ga0207705_10000004 3300025909 Bacteria 705756
281 Ga0207705_10000157 3300025909 Bacteria 73563
282 Ga0207705_10000228 3300025909 Bacteria 55776
283 Ga0207705_10000784 3300025909 Bacteria 26096
284 Ga0207654_10001685 3300025911 Bacteria 11537
285 Ga0207654_10002302 3300025911 Bacteria 9796
286 Ga0207654_10024069 3300025911 Bacteria 3270
287 Ga0207654_10040965 3300025911 Bacteria 2613
288 Ga0207654_10048834 3300025911 Bacteria 2424
289 Ga0207707_10006188 3300025912 Bacteria 10457
290 Ga0207695_10000006 3300025913 Bacteria 1135309
291 Ga0207695_10007333 3300025913 Bacteria 14081
292 Ga0207695_10010978 3300025913 Bacteria 11009
293 Ga0207695_10027051 3300025913 Bacteria 6390
294 Ga0207695_10087375 3300025913 Bacteria 3141
295 Ga0207695_10108153 3300025913 Bacteria 2765
296 Ga0207695_10255720 3300025913 Bacteria 1650
297 Ga0207671_10003767 3300025914 Bacteria 14911
298 Ga0207671_10004267 3300025914 Bacteria 13756
299 Ga0207671_10006621 3300025914 Bacteria 10278
300 Ga0207671_10120423 3300025914 Bacteria 2006
301 Ga0207660_10004609 3300025917 Bacteria 8984
302 Ga0207662_10182485 3300025918 Bacteria 1351
303 Ga0207657_10000465 3300025919 Bacteria 42880
304 Ga0207657_10001164 3300025919 Bacteria 27924
305 Ga0207657_10001229 3300025919 Bacteria 27350
306 Ga0207657_10009609 3300025919 Bacteria 9707
307 Ga0207657_10010580 3300025919 Bacteria 9199
308 Ga0207657_10014853 3300025919 Bacteria 7579
309 Ga0207649_10001601 3300025920 Bacteria 13157
310 Ga0207649_10003068 3300025920 Bacteria 9170
311 Ga0207649_10010980 3300025920 Bacteria 4982
312 Ga0207649_10098820 3300025920 Bacteria 1927
313 Ga0207652_10018418 3300025921 Bacteria 5727
314 Ga0207681_10062976 3300025923 Bacteria 2556
315 Ga0207694_10009999 3300025924 Bacteria 7152
316 Ga0207694_10031707 3300025924 Bacteria 4040
317 Ga0207694_10049311 3300025924 Bacteria 3259
318 Ga0207694_10090041 3300025924 Bacteria 2420
319 Ga0207694_10112313 3300025924 Bacteria 2168
320 Ga0207650_10016772 3300025925 Bacteria 5122
321 Ga0207650_10096157 3300025925 Bacteria 2272
322 Ga0207659_10007271 3300025926 Bacteria 6802
323 Ga0207659_10065719 3300025926 Bacteria 2629
324 Ga0207687_10002747 3300025927 Bacteria 11933
325 Ga0207644_10021555 3300025931 Bacteria 4391
326 Ga0207690_10000368 3300025932 Bacteria 29888
327 Ga0207690_10001385 3300025932 Bacteria 15233
328 Ga0207690_10003924 3300025932 Bacteria 8792
329 Ga0207690_10299924 3300025932 Bacteria 1257
330 Ga0207706_10001587 3300025933 Bacteria 22571
331 Ga0207706_10022833 3300025933 Bacteria 5613
332 Ga0207706_10024381 3300025933 Bacteria 5423
333 Ga0207706_10041335 3300025933 Bacteria 4087
334 Ga0207706_10041697 3300025933 Bacteria 4068
335 Ga0207706_10042913 3300025933 Bacteria 4008
336 Ga0207706_10180760 3300025933 Bacteria 1852
337 Ga0207709_10000137 3300025935 Bacteria 106203
338 Ga0207670_10015539 3300025936 Bacteria 4551
339 Ga0207669_10000093 3300025937 Bacteria 45459
340 Ga0207669_10003436 3300025937 Bacteria 6845
341 Ga0207691_10005079 3300025940 Bacteria 12704
342 Ga0207691_10026614 3300025940 Bacteria 5427
343 Ga0207691_10096866 3300025940 Unclassified 2637
344 Ga0207711_10008752 3300025941 Bacteria 8464
345 Ga0207711_10024045 3300025941 Bacteria 5100
346 Ga0207689_10036853 3300025942 Bacteria 4059
347 Ga0207679_10000640 3300025945 Bacteria 23345
348 Ga0207679_10054153 3300025945 Bacteria 2952
349 Ga0207679_10100615 3300025945 Bacteria 2259
350 Ga0207679_10124169 3300025945 Bacteria 2060
351 Ga0207679_10160530 3300025945 Bacteria 1840
352 Ga0207679_10334451 3300025945 Bacteria 1315
353 Ga0207667_10000004 3300025949 Bacteria 737718
354 Ga0207667_10000006 3300025949 Bacteria 679876
355 Ga0207667_10002681 3300025949 Bacteria 22015
356 Ga0207667_10016478 3300025949 Bacteria 8350
357 Ga0207667_10051010 3300025949 Bacteria 4363
358 Ga0207667_10056466 3300025949 Bacteria 4125
359 Ga0207667_10088965 3300025949 Bacteria 3193
360 Ga0207667_10120298 3300025949 Bacteria 2706
361 Ga0207651_10002413 3300025960 Bacteria 8928
362 Ga0207651_10002469 3300025960 Bacteria 8823
363 Ga0207651_10065019 3300025960 Unclassified 2556
364 Ga0207712_10000015 3300025961 Bacteria 346689
365 Ga0207668_10005778 3300025972 Bacteria 7291
366 Ga0207640_10005079 3300025981 Bacteria 7160
367 Ga0207640_10028932 3300025981 Bacteria 3395
368 Ga0207640_10071113 3300025981 Bacteria 2342
369 Ga0207640_10222105 3300025981 Bacteria 1447
370 Ga0207658_10056441 3300025986 Bacteria 2914
371 Ga0207703_10000757 3300026035 Bacteria 31884
372 Ga0207639_10000160 3300026041 Bacteria 51548
373 Ga0207639_10000185 3300026041 Bacteria 48694
374 Ga0207639_10001020 3300026041 Bacteria 19060
375 Ga0207639_10013092 3300026041 Bacteria 5792
376 Ga0207639_10050242 3300026041 Bacteria 3166
377 Ga0207639_10065385 3300026041 Bacteria 2823
378 Ga0207639_10125066 3300026041 Bacteria 2119
379 Ga0207639_10261251 3300026041 Bacteria 1514
380 Ga0207678_10000083 3300026067 Bacteria 77023
381 Ga0207678_10000491 3300026067 Bacteria 35916
382 Ga0207678_10000545 3300026067 Bacteria 34437
383 Ga0207678_10000801 3300026067 Bacteria 28842
384 Ga0207678_10008944 3300026067 Bacteria 8818
385 Ga0207678_10053121 3300026067 Bacteria 3493
386 Ga0207678_10089483 3300026067 Bacteria 2631
387 Ga0207678_10121804 3300026067 Bacteria 2226
388 Ga0207702_10004461 3300026078 Bacteria 12438
389 Ga0207702_10004499 3300026078 Bacteria 12374
390 Ga0207702_10009174 3300026078 Bacteria 8319
391 Ga0207702_10009706 3300026078 Bacteria 8083
392 Ga0207702_10016210 3300026078 Bacteria 6169
393 Ga0207702_10118736 3300026078 Bacteria 2363
394 Ga0207702_10323644 3300026078 Bacteria 1469
395 Ga0207702_10395284 3300026078 Bacteria 1332
396 Ga0207641_10001505 3300026088 Bacteria 22818
397 Ga0207641_10052577 3300026088 Bacteria 3450
398 Ga0207648_10044737 3300026089 Bacteria 3884
399 Ga0207676_10054692 3300026095 Bacteria 3129
400 Ga0207676_10145144 3300026095 Bacteria 2037
401 Ga0207676_10317648 3300026095 Bacteria 1428
402 Ga0207674_10017103 3300026116 Bacteria 7916
403 Ga0207674_10031539 3300026116 Bacteria 5566
404 Ga0207674_10033636 3300026116 Bacteria 5366
405 Ga0207674_10085338 3300026116 Bacteria 3153
406 Ga0207674_10138473 3300026116 Bacteria 2395
407 Ga0207674_10141171 3300026116 Bacteria 2368
408 Ga0207674_10446228 3300026116 Bacteria 1250
409 Ga0207675_100000012 3300026118 Bacteria 140594
410 Ga0207675_100255201 3300026118 Bacteria 1698
411 Ga0207683_10000115 3300026121 Bacteria 65630
412 Ga0207683_10053762 3300026121 Bacteria 3531
413 Ga0207683_10141231 3300026121 Bacteria 2170
414 Ga0207698_10000019 3300026142 Bacteria 145910
415 Ga0207698_10003456 3300026142 Bacteria 9511
416 Ga0207698_10007180 3300026142 Bacteria 6976
417 Ga0207698_10011849 3300026142 Bacteria 5676
418 Ga0207698_10018236 3300026142 Bacteria 4778
419 Ga0207698_10041531 3300026142 Bacteria 3428
420 Ga0207698_10077164 3300026142 Bacteria 2670
421 Ga0207698_10153584 3300026142 Bacteria 2002
422 Ga0207428_10013576 3300027907 Bacteria 7109
423 Ga0207428_10096876 3300027907 Bacteria 2284
424 Ga0268266_10119155 3300028379 Bacteria 2347
425 Ga0268266_10122130 3300028379 Bacteria 2319
426 Ga0268265_10000658 3300028380 Bacteria 34307
427 Ga0268264_10002774 3300028381 Bacteria 15281
428 Ga0268264_10028752 3300028381 Bacteria 4550
429 Ga0268264_10219456 3300028381 Bacteria 1750
430 Ga0265334_10019913 3300028573 Bacteria 2753
431 Ga0307515_10051473 3300028794 Bacteria 6139
432 Ga0307515_10140118 3300028794 Bacteria 2600
433 Ga0265338_10008334 3300028800 Bacteria 12608
434 Ga0265338_10026416 3300028800 Bacteria 5857
435 Ga0265338_10059595 3300028800 Bacteria 3362
436 Ga0265340_10019040 3300031247 Bacteria 3536
437 Ga0265340_10028348 3300031247 Bacteria 2817
438 Ga0265327_10002198 3300031251 Bacteria 21377
439 Ga0307513_10000034 3300031456 Bacteria 185012
440 Ga0307513_10057878 3300031456 Bacteria 4125
441 Ga0307513_10090272 3300031456 Bacteria 3126
442 Ga0307509_10232840 3300031507 Bacteria 1643
443 Ga0307408_100055766 3300031548 Bacteria 2862
444 Ga0307408_100079323 3300031548 Bacteria 2449
445 Ga0307508_10025651 3300031616 Bacteria 5341
446 Ga0265314_10036108 3300031711 Bacteria 3595
447 Ga0307405_10062371 3300031731 Bacteria 2360
448 Ga0307405_10062434 3300031731 Bacteria 2359
449 Ga0307413_10051151 3300031824 Bacteria 2488
450 Ga0307413_10113942 3300031824 Bacteria 1816
451 Ga0307406_10051052 3300031901 Bacteria 2624
452 Ga0307406_10064151 3300031901 Bacteria 2382
453 Ga0307407_10206864 3300031903 Bacteria 1319
454 Ga0307412_10035794 3300031911 Bacteria 3174
455 Ga0307412_10077360 3300031911 Bacteria 2288
456 Ga0307412_10099599 3300031911 Bacteria 2052
457 Ga0307412_10101111 3300031911 Bacteria 2039
458 Ga0307412_10144528 3300031911 Bacteria 1746
459 Ga0307409_100053268 3300031995 Bacteria 3108
460 Ga0307409_100209284 3300031995 Bacteria 1751
461 Ga0307409_100375577 3300031995 Bacteria 1349
462 Ga0307416_100025913 3300032002 Bacteria 4310
463 Ga0307414_10003631 3300032004 Bacteria 8266
464 Ga0307414_10012568 3300032004 Bacteria 5012
465 Ga0307414_10154722 3300032004 Bacteria 1813
466 Ga0307414_10263110 3300032004 Bacteria 1440
467 Ga0307411_10204174 3300032005 Bacteria 1520
468 Ga0307510_10002596 3300033180 Bacteria 20627
469 Ga0373931_0024623 3300035691 Bacteria 3052
470 Ga0373935_0027934 3300035692 Bacteria 3487
471 Ga0373927_0001162 3300035695 Bacteria 19918
472 Ga0316582_0000197 3300036647 Bacteria 19119
473 Ga0316584_0092524 3300036712 Unclassified 2264
474 Ga0316584_0213817 3300036712 Bacteria 1418
475 Ga0373925_0000991 3300037068 Bacteria 25768
476 Ga0400483_048519 3300039062 Bacteria 5904
477 Ga0400483_050097 3300039062 Bacteria 4038
478 Ga0400483_161893 3300039062 Bacteria 2469
479 Ga0436361_0812819 3300039447 Bacteria 11508
480 Ga0439443_004810 3300042003 Bacteria 1780
481 Ga0439435_0018676 3300042436 Bacteria 1767
482 Ga0466972_0020132 3300044658 Bacteria 3335
483 Ga0466966_0032567 3300044684 Bacteria 3377
484 Ga0466961_0091244 3300044693 Bacteria 1923
485 Ga0466960_0086101 3300044901 Bacteria 1593
486 Ga0466959_0039932 3300045049 Bacteria 3468
487 Ga0451576_0001437 3300045051 Bacteria 40602
488 Ga0451576_0051839 3300045051 Bacteria 4301
489 Ga0466958_0000355 3300045836 Bacteria 18454
490 Ga0466958_0036857 3300045836 Bacteria 2929
491 Ga0495627_000305 3300046453 Bacteria 48602
492 Ga0495627_000520 3300046453 Bacteria 31871
493 Ga0495627_000804 3300046453 Bacteria 22900
494 Ga0495627_033046 3300046453 Bacteria 1624
495 Ga0495603_0166890 3300046455 Bacteria 1276
496 Ga0495638_0000024 3300046460 Bacteria 362116
497 Ga0495638_0000074 3300046460 Bacteria 163843
498 Ga0495650_0000325 3300046471 Bacteria 85327
499 Ga0495650_0001824 3300046471 Bacteria 19114
500 Ga0495650_0073563 3300046471 Bacteria 1335
501 Ga0495584_0053281 3300046491 Bacteria 2036
502 Ga0495584_0194802 3300046491 Bacteria 1030
503 Ga0495585_0000339 3300046492 Bacteria 45404
504 Ga0495585_0001102 3300046492 Bacteria 22234
505 Ga0495585_0044720 3300046492 Bacteria 2473
506 Ga0495585_0104795 3300046492 Bacteria 1509
507 Ga0495585_0127167 3300046492 Bacteria 1344
508 Ga0495594_0051755 3300046499 Bacteria 2260
509 Ga0495596_0000136 3300046500 Bacteria 50455
510 Ga0495596_0000187 3300046500 Bacteria 43214
511 Ga0495596_0001732 3300046500 Bacteria 12249
512 Ga0495596_0002742 3300046500 Bacteria 9247
513 Ga0495583_0000275 3300046506 Bacteria 83178
514 Ga0495583_0000527 3300046506 Bacteria 54086
515 Ga0495583_0022408 3300046506 Bacteria 3223
516 Ga0495606_0027879 3300046507 Bacteria 3995
517 Ga0495610_0000034 3300046512 Bacteria 201408
518 Ga0495610_0002224 3300046512 Bacteria 16409
519 Ga0495610_0003976 3300046512 Bacteria 11174
520 Ga0495610_0005525 3300046512 Bacteria 8956
521 Ga0495610_0026473 3300046512 Bacteria 3096
522 Ga0495610_0042899 3300046512 Bacteria 2258
523 Ga0495610_0052989 3300046512 Bacteria 1967
524 Ga0495620_0001019 3300046515 Bacteria 17232
525 Ga0495632_0000001 3300046519 Bacteria 873295
526 Ga0495632_0000053 3300046519 Bacteria 131977
527 Ga0495632_0000498 3300046519 Bacteria 36972
528 Ga0495632_0000813 3300046519 Bacteria 27616
529 Ga0495632_0006591 3300046519 Bacteria 7432
530 Ga0495632_0070173 3300046519 Bacteria 1685
531 Ga0495637_0000717 3300046520 Bacteria 22702
532 Ga0495637_0000826 3300046520 Bacteria 20447
533 Ga0495637_0000850 3300046520 Bacteria 20082
534 Ga0495643_0000006 3300046522 Bacteria 419524
535 Ga0495643_0000020 3300046522 Bacteria 294973
536 Ga0495643_0000061 3300046522 Bacteria 185933
537 Ga0495643_0000859 3300046522 Bacteria 32706
538 Ga0495643_0001729 3300046522 Bacteria 18882
539 Ga0495643_0071188 3300046522 Bacteria 1826
540 Ga0495643_0099853 3300046522 Bacteria 1488
541 Ga0495648_0000005 3300046524 Bacteria 362116
542 Ga0495648_0000050 3300046524 Bacteria 163843
543 Ga0495648_0000051 3300046524 Bacteria 162502
544 Ga0495648_0005515 3300046524 Bacteria 10498
545 Ga0495648_0006642 3300046524 Bacteria 9369
546 Ga0495648_0030955 3300046524 Bacteria 3531
547 Ga0495648_0039517 3300046524 Bacteria 3002
548 Ga0495663_0000002 3300046525 Bacteria 495384
549 Ga0495663_0000012 3300046525 Bacteria 157546
550 Ga0495654_0025597 3300046530 Bacteria 3039
551 Ga0495654_0061125 3300046530 Bacteria 1810
552 Ga0495622_0042546 3300046557 Bacteria 2112
553 Ga0495633_0000208 3300046558 Bacteria 74469
554 Ga0495633_0000312 3300046558 Bacteria 55371
555 Ga0495633_0000413 3300046558 Bacteria 44456
556 Ga0495633_0004138 3300046558 Bacteria 9329
557 Ga0495633_0013178 3300046558 Bacteria 4367
558 Ga0495633_0034785 3300046558 Bacteria 2422
559 Ga0495625_0010009 3300046660 Bacteria 7885
560 Ga0495625_0032733 3300046660 Bacteria 3852
561 Ga0495625_0225685 3300046660 Bacteria 1225
562 Ga0495671_0000008 3300046692 Bacteria 419524
563 Ga0495671_0000016 3300046692 Bacteria 294821
564 Ga0495671_0000036 3300046692 Bacteria 181192
565 Ga0495671_0000096 3300046692 Bacteria 82384
566 Ga0495671_0000187 3300046692 Bacteria 54674
567 Ga0495671_0010581 3300046692 Bacteria 5101
568 Ga0495671_0017625 3300046692 Bacteria 3799
569 Ga0495673_0000157 3300047469 Bacteria 117733
570 Ga0495673_0000365 3300047469 Bacteria 54674
571 Ga0495681_0000037 3300047470 Bacteria 122686
572 Ga0495681_0000208 3300047470 Bacteria 48683
573 Ga0495681_0000437 3300047470 Bacteria 31989
574 Ga0495681_0001363 3300047470 Bacteria 18446
575 Ga0495681_0002391 3300047470 Bacteria 13438
576 Ga0495686_0009263 3300047472 Bacteria 7111
577 Ga0495686_0069693 3300047472 Bacteria 2167
578 Ga0495686_0078788 3300047472 Bacteria 2016
579 Ga0495686_0191365 3300047472 Bacteria 1179
580 Ga0495615_0000002 3300048090 Bacteria 167871
581 Ga0495626_0000852 3300048091 Bacteria 27166
582 Ga0496102_0164084 3300048905 Bacteria 2090
583 Ga0496109_0114978 3300048912 Bacteria 2503
584 Ga0496109_0146367 3300048912 Bacteria 2211
585 Ga0496110_0053470 3300048913 Bacteria 3550
586 Ga0496111_0058545 3300048914 Bacteria 2789
587 Ga0496113_0036418 3300048916 Bacteria 3605
588 Ga0496114_0006351 3300048917 Bacteria 9299
589 Ga0496116_0000093 3300048919 Bacteria 205660
590 Ga0496116_0019366 3300048919 Bacteria 5212
591 Ga0496117_0057598 3300048920 Bacteria 2697
592 Ga0496117_0062063 3300048920 Bacteria 2564
593 Ga0496117_0125437 3300048920 Bacteria 1568
594 Ga0496118_0004744 3300048921 Bacteria 15911
595 Ga0496118_0005210 3300048921 Bacteria 14872
596 Ga0496118_0033605 3300048921 Bacteria 4205
597 Ga0496118_0056320 3300048921 Bacteria 2957
598 Ga0496118_0183043 3300048921 Bacteria 1263
599 Ga0496121_0004428 3300048924 Bacteria 18910
600 Ga0496121_0014480 3300048924 Bacteria 8363
601 Ga0496121_0025046 3300048924 Bacteria 5680
602 Ga0496122_0000702 3300048925 Bacteria 66240
603 Ga0496122_0010843 3300048925 Bacteria 9330
604 Ga0496122_0017535 3300048925 Bacteria 6688
605 Ga0496122_0097126 3300048925 Bacteria 1983
606 Ga0496123_0000914 3300048926 Bacteria 46373
607 Ga0496123_0061160 3300048926 Bacteria 2422
608 Ga0496124_0000374 3300048927 Bacteria 81451
609 Ga0496124_0008549 3300048927 Bacteria 10687
610 Ga0496124_0025049 3300048927 Bacteria 5410
611 Ga0496124_0034344 3300048927 Bacteria 4452
612 Ga0496124_0095884 3300048927 Bacteria 2410
613 Ga0496125_0000373 3300048928 Bacteria 84239
614 Ga0496125_0007575 3300048928 Bacteria 11530
615 Ga0496125_0030387 3300048928 Bacteria 4834
616 Ga0496126_0000512 3300048929 Bacteria 75587
617 Ga0496126_0022194 3300048929 Bacteria 6181
618 Ga0496126_0053896 3300048929 Bacteria 3646
619 Ga0496126_0072905 3300048929 Bacteria 3053
620 Ga0496126_0301825 3300048929 Bacteria 1321
621 Ga0496126_0368496 3300048929 Bacteria 1172
622 Ga0501033_0000059 3300049570 Bacteria 105311
623 Ga0501035_0000213 3300049822 Bacteria 69670
624 nmdc:mga03683_24869_c1 3300050489 Bacteria 2346
625 nmdc:mga03683_2_c1 3300050489 Bacteria 289140
626 nmdc:mga03683_48550_c1 3300050489 Bacteria 1764
627 nmdc:mga03n38_1707_c1 3300050490 Bacteria 6471
628 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
629 nmdc:mga0k408_84305_c1 3300050493 Bacteria 1864
630 nmdc:mga0k408_85160_c1 3300050493 Bacteria 1855
631 nmdc:mga0sz30_3405_c2 3300050516 Bacteria 3961
632 Ga0500635_0001737 3300053080 Bacteria 5300
633 Ga0500643_000162 3300053087 Bacteria 66736
634 Ga0500643_020651 3300053087 Bacteria 2148
635 Ga0500562_000306 3300053108 Bacteria 11974
636 Ga0500562_004347 3300053108 Bacteria 3586
637 Ga0500594_0004429 3300053118 Bacteria 3095
638 Ga0500594_0007498 3300053118 Bacteria 2469
639 Ga0500594_0056774 3300053118 Bacteria 1117
640 Ga0500595_021185 3300053119 Bacteria 2324
641 Ga0500597_009023 3300053120 Bacteria 3486
642 Ga0500607_000045 3300053121 Bacteria 84084
643 Ga0500618_000993 3300053125 Bacteria 14349
644 Ga0500618_001122 3300053125 Bacteria 13055
645 Ga0500642_0000003 3300053130 Bacteria 544899
646 Ga0500559_0002057 3300053136 Bacteria 10771
647 Ga0500559_0012209 3300053136 Bacteria 3655
648 Ga0500559_0022654 3300053136 Bacteria 2664
649 Ga0500559_0027306 3300053136 Bacteria 2436
650 Ga0500564_001755 3300053138 Bacteria 7674
651 Ga0500624_000098 3300053157 Bacteria 42544
652 Ga0500636_0064800 3300053177 Bacteria 2128
653 Ga0500637_0000055 3300053178 Bacteria 42526
654 Ga0500637_0029458 3300053178 Bacteria 3045
655 Ga0500567_001363 3300053723 Bacteria 9772
656 Ga0500625_000012 3300053729 Bacteria 127269
657 Ga0500645_017281 3300053730 Bacteria 2263
658 2585263466 2582581305 Bacteria 4895574
659 2585264107 2582581305 Bacteria 4895574
660 2600226176 2599185359 Bacteria 4772316
661 2643814998 2643221558 Bacteria 5460675
662 2738710778 2738541275 Bacteria 4830863
663 2738712967 2738541275 Bacteria 4830863
664 2738849203 2738541301 Bacteria 4834102
665 2738851391 2738541301 Bacteria 4834102
666 2738864932 2738541304 Bacteria 4833665
667 2738867121 2738541304 Bacteria 4833665
668 2739297450 2738543022 Bacteria 4835059
669 2739299638 2738543022 Bacteria 4835059
670 2739359128 2738543033 Bacteria 4833336
671 2739361317 2738543033 Bacteria 4833336
672 2739650244 2739367664 Bacteria 4114334
673 2740028717 2739367865 Bacteria 4114482
674 2753763571 2751185897 Bacteria 5322941
675 2819555468 2818991438 Bacteria 5793701
676 2896187030 2896184354 Bacteria 3258548
677 2919139512 2919138771 Bacteria 5281312
678 2919139549 2919138771 Bacteria 5281312
679 2919709961 2919709256 Bacteria 4318106
680 2928100880 2928100450 Bacteria 4837635
681 2928103578 2928100450 Bacteria 4837635
682 2928962287 2928959182 Bacteria 4725774
683 2928963277 2928959182 Bacteria 4725774
684 3000867523 3000865235 Bacteria 3106258
685 8002747221 8002745576 Bacteria 4840272
686 8055432559 8055431914 Bacteria 4551896
687 8057102197 8057101203 Bacteria 5034064
688 Ga0495633_0000470
689 JGI24736J21556_1000219
690 JGI24741J21665_1000021
691 JGI24741J21665_1000068
692 JGI24741J21665_1000106
693 JGI24741J21665_1000204
694 JGI24741J21665_1001619
695 JGI24740J21852_10000043
696 JGI24740J21852_10001202
697 JGI24740J21852_10001360
698 JGI24740J21852_10004146
699 JGI24740J21852_10007599
700 JGI24739J22299_10001257
701 JGI24739J22299_10003195
702 JGI24739J22299_10007955
703 JGI24739J22299_10017169
704 JGI24737J22298_10000054
705 JGI24737J22298_10000947
706 JGI24737J22298_10001005
707 JGI24737J22298_10001250
708 JGI24737J22298_10003837
709 JGI24737J22298_10012428
710 JGI24737J22298_10022508
711 JGI24735J21928_10001235
712 JGI24735J21928_10003256
713 JGI24735J21928_10010665
714 JGI24738J21930_10000887
715 JGI24738J21930_10004705
716 JGI24744J21845_10004568
717 JGI25153J46596_10000005
718 rootH1_10058872
719 rootL2_10060416
720 rootL2_10095669
721 rootL2_10165326
722 rootL2_10201879
723 rootH1_10113965
724 Ga0055530_10028273
725 Ga0065704_10098629
726 Ga0070658_10000167
727 Ga0070658_10000180
728 Ga0070658_10000937
729 Ga0070658_10080612
730 Ga0070658_10153838
731 Ga0070658_10167781
732 Ga0070658_10287692
733 Ga0070676_10023574
734 Ga0070676_10210184
735 Ga0070683_100105391
736 Ga0070683_100133055
737 Ga0070670_100008343
738 Ga0070670_100036548
739 Ga0070670_100117660
740 Ga0070677_10033610
741 Ga0068869_100025861
742 Ga0070666_10036790
743 Ga0070666_10072946
744 Ga0070666_10077232
745 Ga0070666_10086650
746 Ga0070680_100000486
747 Ga0070660_100005124
748 Ga0070660_100014169
749 Ga0070660_100121065
750 Ga0070689_100030340
751 Ga0070691_10017513
752 Ga0070687_100079499
753 Ga0070661_100002081
754 Ga0070661_100015978
755 Ga0070661_100016878
756 Ga0070661_100056982
757 Ga0070661_100081024
758 Ga0070661_100111753
759 Ga0070661_100117773
760 Ga0070661_100136144
761 Ga0070668_100016788
762 Ga0070669_100034151
763 Ga0070675_100017384
764 Ga0070675_100064017
765 Ga0070675_100072390
766 Ga0070671_100011172
767 Ga0070671_100011225
768 Ga0070671_100091423
769 Ga0070671_100121933
770 Ga0070674_100000078
771 Ga0070674_100003725
772 Ga0070673_100007256
773 Ga0070673_100026968
774 Ga0070673_100082551
775 Ga0070673_100087594
776 Ga0070688_100056433
777 Ga0070688_100062645
778 Ga0070659_100000573
779 Ga0070659_100008652
780 Ga0070659_100057839
781 Ga0070659_100309891
782 Ga0070667_100012614
783 Ga0070667_100210924
784 Ga0070663_100000203
785 Ga0070663_100005836
786 Ga0070663_100017206
787 Ga0070663_100028464
788 Ga0070663_100032188
789 Ga0070663_100038387
790 Ga0070663_100038633
791 Ga0070678_100000005
792 Ga0070678_100012235
793 Ga0070678_100032869
794 Ga0070678_100107199
795 Ga0070662_100031732
796 Ga0070662_100032403
797 Ga0070662_100036683
798 Ga0070662_100040872
799 Ga0070662_100176791
800 Ga0070681_10000836
801 Ga0070685_10018913
802 Ga0070679_100002376
803 Ga0068853_100134268
804 Ga0068853_100139822
805 Ga0068853_100377060
806 Ga0070672_100000872
807 Ga0070672_100049640
808 Ga0070672_100086646
809 Ga0070672_100284434
810 Ga0070686_100099367
811 Ga0070665_100036260
812 Ga0068855_100019318
813 Ga0068855_100035976
814 Ga0068855_100083107
815 Ga0068855_100116698
816 Ga0068855_100123559
817 Ga0068855_100133497
818 Ga0070664_100005524
819 Ga0070664_100007441
820 Ga0070664_100012745
821 Ga0070664_100020156
822 Ga0070664_100033301
823 Ga0070664_100109707
824 Ga0070664_100195369
825 Ga0068857_100030321
826 Ga0068857_100030580
827 Ga0068857_100152583
828 Ga0068857_100156240
829 Ga0068857_100237952
830 Ga0068854_100026091
831 Ga0068854_100032228
832 Ga0068854_100082980
833 Ga0068854_100130047
834 Ga0068854_100211949
835 Ga0068856_100032979
836 Ga0068856_100072774
837 Ga0068856_100078026
838 Ga0068856_100148208
839 Ga0068856_100165658
840 Ga0068856_100241538
841 Ga0068852_100006804
842 Ga0068852_100136243
843 Ga0068852_100138971
844 Ga0068852_100286635
845 Ga0068859_100055972
846 Ga0068859_100108799
847 Ga0068864_100063466
848 Ga0068864_100245242
849 Ga0068864_100401156
850 Ga0068861_100000085
851 Ga0068861_100298297
852 Ga0068861_100369219
853 Ga0068851_10004933
854 Ga0068851_10007046
855 Ga0068851_10044065
856 Ga0068870_10131776
857 Ga0068863_100038607
858 Ga0068863_100336005
859 Ga0068863_100523626
860 Ga0068858_100000310
861 Ga0068860_100002446
862 Ga0068860_100230210
863 Ga0068862_100000699
864 Ga0081539_10000001
865 Ga0075432_10003783
866 Ga0075432_10011066
867 Ga0075362_10000040
868 Ga0075362_10082446
869 Ga0075366_10021460
870 Ga0097621_100004748
871 Ga0097621_100186645
872 Ga0075370_10036614
873 Ga0075370_10042480
874 Ga0068871_100013227
875 Ga0068871_100330004
876 Ga0097620_100055973
877 Ga0097620_100108791
878 Ga0105251_10001809
879 Ga0105240_10000121
880 Ga0105240_10082383
881 Ga0105240_10097190
882 Ga0105240_10211402
883 Ga0105240_10509329
884 Ga0105240_10708390
885 Ga0105245_10001044
886 Ga0105247_10001062
887 Ga0105243_10000030
888 Ga0105243_10054917
889 Ga0105241_10000799
890 Ga0105241_10000903
891 Ga0105241_10017577
892 Ga0105241_10177281
893 Ga0105241_10217077
894 Ga0105248_10015048
895 Ga0105248_10055553
896 Ga0105248_10233496
897 Ga0105237_10055147
898 Ga0105237_10361523
899 Ga0105238_10007472
900 Ga0105238_10021395
901 Ga0105238_10076399
902 Ga0105249_10000196
903 Ga0105249_10033714
904 Ga0105239_10005768
905 Ga0105239_10061342
906 Ga0105239_10166688
907 Ga0105239_10267262
908 Ga0105239_10404293
909 Ga0105246_10263859
910 Ga0157373_10018661
911 Ga0157373_10019281
912 Ga0157373_10057484
913 Ga0157373_10127119
914 Ga0157373_10280132
915 Ga0157371_10000111
916 Ga0157371_10000757
917 Ga0157371_10009942
918 Ga0157370_10042645
919 Ga0157369_10071138
920 Ga0157369_10081176
921 Ga0157369_10129916
922 Ga0157374_10167170
923 Ga0163162_10131849
924 Ga0163162_10295572
925 Ga0157372_10115387
926 Ga0157372_10165991
927 Ga0157372_10204213
928 Ga0157372_10217348
929 Ga0157372_10405894
930 Ga0157375_10037462
931 Ga0157375_10252678
932 Ga0163163_10016474
933 Ga0157380_10126611
934 Ga0157380_10147364
935 Ga0157377_10006308
936 Ga0157379_10129206
937 Ga0157376_10235690
938 Ga0163161_10002180
939 Ga0163161_10016322
940 Ga0163161_10151988
941 Ga0163161_10209132
942 Ga0213872_10041975
943 Ga0213872_10084398
944 Ga0209147_100763
945 Ga0209455_1010049
946 Ga0209758_1000001
947 Ga0209050_1001048
948 Ga0209050_1016290
949 Ga0207656_10004092
950 Ga0207656_10012645
951 Ga0207656_10018676
952 Ga0207656_10029633
953 Ga0207656_10037068
954 Ga0207656_10038474
955 Ga0207682_10006701
956 Ga0207710_10006828
957 Ga0207680_10019437
958 Ga0207680_10082882
959 Ga0207647_10002614
960 Ga0207647_10013943
961 Ga0207647_10027409
962 Ga0207647_10067164
963 Ga0207647_10082511
964 Ga0207647_10103528
965 Ga0207645_10029241
966 Ga0207643_10132844
967 Ga0207705_10000004
968 Ga0207705_10000157
969 Ga0207705_10000228
970 Ga0207705_10000784
971 Ga0207654_10001685
972 Ga0207654_10002302
973 Ga0207654_10024069
974 Ga0207654_10040965
975 Ga0207654_10048834
976 Ga0207707_10006188
977 Ga0207695_10000006
978 Ga0207695_10007333
979 Ga0207695_10010978
980 Ga0207695_10027051
981 Ga0207695_10087375
982 Ga0207695_10108153
983 Ga0207695_10255720
984 Ga0207671_10003767
985 Ga0207671_10004267
986 Ga0207671_10006621
987 Ga0207671_10120423
988 Ga0207660_10004609
989 Ga0207662_10182485
990 Ga0207657_10000465
991 Ga0207657_10001164
992 Ga0207657_10001229
993 Ga0207657_10009609
994 Ga0207657_10010580
995 Ga0207657_10014853
996 Ga0207649_10001601
997 Ga0207649_10003068
998 Ga0207649_10010980
999 Ga0207649_10098820
1000 Ga0207652_10018418
1001 Ga0207681_10062976
1002 Ga0207694_10009999
1003 Ga0207694_10031707
1004 Ga0207694_10049311
1005 Ga0207694_10090041
1006 Ga0207694_10112313
1007 Ga0207650_10016772
1008 Ga0207650_10096157
1009 Ga0207659_10007271
1010 Ga0207659_10065719
1011 Ga0207687_10002747
1012 Ga0207644_10021555
1013 Ga0207690_10000368
1014 Ga0207690_10001385
1015 Ga0207690_10003924
1016 Ga0207690_10299924
1017 Ga0207706_10001587
1018 Ga0207706_10022833
1019 Ga0207706_10024381
1020 Ga0207706_10041335
1021 Ga0207706_10041697
1022 Ga0207706_10042913
1023 Ga0207706_10180760
1024 Ga0207709_10000137
1025 Ga0207670_10015539
1026 Ga0207669_10000093
1027 Ga0207669_10003436
1028 Ga0207691_10005079
1029 Ga0207691_10026614
1030 Ga0207691_10096866
1031 Ga0207711_10008752
1032 Ga0207711_10024045
1033 Ga0207689_10036853
1034 Ga0207679_10000640
1035 Ga0207679_10054153
1036 Ga0207679_10100615
1037 Ga0207679_10124169
1038 Ga0207679_10160530
1039 Ga0207679_10334451
1040 Ga0207667_10000004
1041 Ga0207667_10000006
1042 Ga0207667_10002681
1043 Ga0207667_10016478
1044 Ga0207667_10051010
1045 Ga0207667_10056466
1046 Ga0207667_10088965
1047 Ga0207667_10120298
1048 Ga0207651_10002413
1049 Ga0207651_10002469
1050 Ga0207651_10065019
1051 Ga0207712_10000015
1052 Ga0207668_10005778
1053 Ga0207640_10005079
1054 Ga0207640_10028932
1055 Ga0207640_10071113
1056 Ga0207640_10222105
1057 Ga0207658_10056441
1058 Ga0207703_10000757
1059 Ga0207639_10000160
1060 Ga0207639_10000185
1061 Ga0207639_10001020
1062 Ga0207639_10013092
1063 Ga0207639_10050242
1064 Ga0207639_10065385
1065 Ga0207639_10125066
1066 Ga0207639_10261251
1067 Ga0207678_10000083
1068 Ga0207678_10000491
1069 Ga0207678_10000545
1070 Ga0207678_10000801
1071 Ga0207678_10008944
1072 Ga0207678_10053121
1073 Ga0207678_10089483
1074 Ga0207678_10121804
1075 Ga0207702_10004461
1076 Ga0207702_10004499
1077 Ga0207702_10009174
1078 Ga0207702_10009706
1079 Ga0207702_10016210
1080 Ga0207702_10118736
1081 Ga0207702_10323644
1082 Ga0207702_10395284
1083 Ga0207641_10001505
1084 Ga0207641_10052577
1085 Ga0207648_10044737
1086 Ga0207676_10054692
1087 Ga0207676_10145144
1088 Ga0207676_10317648
1089 Ga0207674_10017103
1090 Ga0207674_10031539
1091 Ga0207674_10033636
1092 Ga0207674_10085338
1093 Ga0207674_10138473
1094 Ga0207674_10141171
1095 Ga0207674_10446228
1096 Ga0207675_100000012
1097 Ga0207675_100255201
1098 Ga0207683_10000115
1099 Ga0207683_10053762
1100 Ga0207683_10141231
1101 Ga0207698_10000019
1102 Ga0207698_10003456
1103 Ga0207698_10007180
1104 Ga0207698_10011849
1105 Ga0207698_10018236
1106 Ga0207698_10041531
1107 Ga0207698_10077164
1108 Ga0207698_10153584
1109 Ga0207428_10013576
1110 Ga0207428_10096876
1111 Ga0268266_10119155
1112 Ga0268266_10122130
1113 Ga0268265_10000658
1114 Ga0268264_10002774
1115 Ga0268264_10028752
1116 Ga0268264_10219456
1117 Ga0265334_10019913
1118 Ga0307515_10051473
1119 Ga0307515_10140118
1120 Ga0265338_10008334
1121 Ga0265338_10026416
1122 Ga0265338_10059595
1123 Ga0265340_10019040
1124 Ga0265340_10028348
1125 Ga0265327_10002198
1126 Ga0307513_10000034
1127 Ga0307513_10057878
1128 Ga0307513_10090272
1129 Ga0307509_10232840
1130 Ga0307408_100055766
1131 Ga0307408_100079323
1132 Ga0307508_10025651
1133 Ga0265314_10036108
1134 Ga0307405_10062371
1135 Ga0307405_10062434
1136 Ga0307413_10051151
1137 Ga0307413_10113942
1138 Ga0307406_10051052
1139 Ga0307406_10064151
1140 Ga0307407_10206864
1141 Ga0307412_10035794
1142 Ga0307412_10077360
1143 Ga0307412_10099599
1144 Ga0307412_10101111
1145 Ga0307412_10144528
1146 Ga0307409_100053268
1147 Ga0307409_100209284
1148 Ga0307409_100375577
1149 Ga0307416_100025913
1150 Ga0307414_10003631
1151 Ga0307414_10012568
1152 Ga0307414_10154722
1153 Ga0307414_10263110
1154 Ga0307411_10204174
1155 Ga0307510_10002596
1156 Ga0373931_0024623
1157 Ga0373935_0027934
1158 Ga0373927_0001162
1159 Ga0316582_0000197
1160 Ga0316584_0092524
1161 Ga0316584_0213817
1162 Ga0373925_0000991
1163 Ga0400483_048519
1164 Ga0400483_050097
1165 Ga0400483_161893
1166 Ga0436361_0812819
1167 Ga0439443_004810
1168 Ga0439435_0018676
1169 Ga0466972_0020132
1170 Ga0466966_0032567
1171 Ga0466961_0091244
1172 Ga0466960_0086101
1173 Ga0466959_0039932
1174 Ga0451576_0001437
1175 Ga0451576_0051839
1176 Ga0466958_0000355
1177 Ga0466958_0036857
1178 Ga0495627_000305
1179 Ga0495627_000520
1180 Ga0495627_000804
1181 Ga0495627_033046
1182 Ga0495603_0166890
1183 Ga0495638_0000024
1184 Ga0495638_0000074
1185 Ga0495650_0000325
1186 Ga0495650_0001824
1187 Ga0495650_0073563
1188 Ga0495584_0053281
1189 Ga0495584_0194802
1190 Ga0495585_0000339
1191 Ga0495585_0001102
1192 Ga0495585_0044720
1193 Ga0495585_0104795
1194 Ga0495585_0127167
1195 Ga0495594_0051755
1196 Ga0495596_0000136
1197 Ga0495596_0000187
1198 Ga0495596_0001732
1199 Ga0495596_0002742
1200 Ga0495583_0000275
1201 Ga0495583_0000527
1202 Ga0495583_0022408
1203 Ga0495606_0027879
1204 Ga0495610_0000034
1205 Ga0495610_0002224
1206 Ga0495610_0003976
1207 Ga0495610_0005525
1208 Ga0495610_0026473
1209 Ga0495610_0042899
1210 Ga0495610_0052989
1211 Ga0495620_0001019
1212 Ga0495632_0000001
1213 Ga0495632_0000053
1214 Ga0495632_0000498
1215 Ga0495632_0000813
1216 Ga0495632_0006591
1217 Ga0495632_0070173
1218 Ga0495637_0000717
1219 Ga0495637_0000826
1220 Ga0495637_0000850
1221 Ga0495643_0000006
1222 Ga0495643_0000020
1223 Ga0495643_0000061
1224 Ga0495643_0000859
1225 Ga0495643_0001729
1226 Ga0495643_0071188
1227 Ga0495643_0099853
1228 Ga0495648_0000005
1229 Ga0495648_0000050
1230 Ga0495648_0000051
1231 Ga0495648_0005515
1232 Ga0495648_0006642
1233 Ga0495648_0030955
1234 Ga0495648_0039517
1235 Ga0495663_0000002
1236 Ga0495663_0000012
1237 Ga0495654_0025597
1238 Ga0495654_0061125
1239 Ga0495622_0042546
1240 Ga0495633_0000208
1241 Ga0495633_0000312
1242 Ga0495633_0000413
1243 Ga0495633_0004138
1244 Ga0495633_0013178
1245 Ga0495633_0034785
1246 Ga0495625_0010009
1247 Ga0495625_0032733
1248 Ga0495625_0225685
1249 Ga0495671_0000008
1250 Ga0495671_0000016
1251 Ga0495671_0000036
1252 Ga0495671_0000096
1253 Ga0495671_0000187
1254 Ga0495671_0010581
1255 Ga0495671_0017625
1256 Ga0495673_0000157
1257 Ga0495673_0000365
1258 Ga0495681_0000037
1259 Ga0495681_0000208
1260 Ga0495681_0000437
1261 Ga0495681_0001363
1262 Ga0495681_0002391
1263 Ga0495686_0009263
1264 Ga0495686_0069693
1265 Ga0495686_0078788
1266 Ga0495686_0191365
1267 Ga0495615_0000002
1268 Ga0495626_0000852
1269 Ga0496102_0164084
1270 Ga0496109_0114978
1271 Ga0496109_0146367
1272 Ga0496110_0053470
1273 Ga0496111_0058545
1274 Ga0496113_0036418
1275 Ga0496114_0006351
1276 Ga0496116_0000093
1277 Ga0496116_0019366
1278 Ga0496117_0057598
1279 Ga0496117_0062063
1280 Ga0496117_0125437
1281 Ga0496118_0004744
1282 Ga0496118_0005210
1283 Ga0496118_0033605
1284 Ga0496118_0056320
1285 Ga0496118_0183043
1286 Ga0496121_0004428
1287 Ga0496121_0014480
1288 Ga0496121_0025046
1289 Ga0496122_0000702
1290 Ga0496122_0010843
1291 Ga0496122_0017535
1292 Ga0496122_0097126
1293 Ga0496123_0000914
1294 Ga0496123_0061160
1295 Ga0496124_0000374
1296 Ga0496124_0008549
1297 Ga0496124_0025049
1298 Ga0496124_0034344
1299 Ga0496124_0095884
1300 Ga0496125_0000373
1301 Ga0496125_0007575
1302 Ga0496125_0030387
1303 Ga0496126_0000512
1304 Ga0496126_0022194
1305 Ga0496126_0053896
1306 Ga0496126_0072905
1307 Ga0496126_0301825
1308 Ga0496126_0368496
1309 Ga0501033_0000059
1310 Ga0501035_0000213
1311 nmdc:mga03683_24869_c1
1312 nmdc:mga03683_2_c1
1313 nmdc:mga03683_48550_c1
1314 nmdc:mga03n38_1707_c1
1315 nmdc:mga0k408_2_c1
1316 nmdc:mga0k408_84305_c1
1317 nmdc:mga0k408_85160_c1
1318 nmdc:mga0sz30_3405_c2
1319 Ga0500635_0001737
1320 Ga0500643_000162
1321 Ga0500643_020651
1322 Ga0500562_000306
1323 Ga0500562_004347
1324 Ga0500594_0004429
1325 Ga0500594_0007498
1326 Ga0500594_0056774
1327 Ga0500595_021185
1328 Ga0500597_009023
1329 Ga0500607_000045
1330 Ga0500618_000993
1331 Ga0500618_001122
1332 Ga0500642_0000003
1333 Ga0500559_0002057
1334 Ga0500559_0012209
1335 Ga0500559_0022654
1336 Ga0500559_0027306
1337 Ga0500564_001755
1338 Ga0500624_000098
1339 Ga0500636_0064800
1340 Ga0500637_0000055
1341 Ga0500637_0029458
1342 Ga0500567_001363
1343 Ga0500625_000012
1344 Ga0500645_017281
1345 2585263466
1346 2585264107
1347 2600226176
1348 2643814998
1349 2738710778
1350 2738712967
1351 2738849203
1352 2738851391
1353 2738864932
1354 2738867121
1355 2739297450
1356 2739299638
1357 2739359128
1358 2739361317
1359 2739650244
1360 2740028717
1361 2753763571
1362 2819555468
1363 2896187030
1364 2919139512
1365 2919139549
1366 2919709961
1367 2928100880
1368 2928103578
1369 2928962287
1370 2928963277
1371 3000867523
1372 8002747221
1373 8055432559
1374 8057102197

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18288

FAA_hydro_N_2

Fumarylacetoacetase N-terminal domain 2

66

133

0.96

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

136

377

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.9726 1 322
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.9579 1 322
6sbj-assembly1.cif.gz_B x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.8603 76 321
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.8579 76 322
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.8557 76 321
ID Description Score Start End Superfamily
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9478 2 322 3.90.850.10
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9307 2 322 3.90.850.10
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8715 76 322 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8654 78 320 3.90.850.10
af_P34673_5_211_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8629 76 315 3.90.850.10
ID Description Score Start End GO Terms
AF-I4N1P0-F1-model_v4 Hydrolase 0.9886 1 323 GO:0016787
AF-A0A520I8J2-F1-model_v4 Fumarylacetoacetate hydrolase 0.9878 1 325 GO:0003824
AF-A0A1E4MBN2-F1-model_v4 Fumarylacetoacetate hydrolase 0.9871 22 321 GO:0016787
AF-A0A7Z8LJX5-F1-model_v4 deleted 0.9866 1 321
AF-A0A519KLD5-F1-model_v4 Fumarylacetoacetate hydrolase 0.9856 172 322 GO:0016787

Map