F475481
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 276 | 1374 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0000470|Ga0495633_0000470_4817_5971 |
| Length | 384 |
| Sequence | MARTCKSSQISRLPRGAASSIPPQTASRGGDQIETLELDYPCFDFDPAAALSHRRSNTSHGRGKTMRLATRRDGSRDGRLILLSSDGSHFADAPVATLQAAMEAWADVHPVLSAIADFPHPLDPATLAAPLPRAWQWLDGSAFESHGALMDRVLGVVPEKTGRPLMYQGVSDHFYGPLDDVPMPDEALGIDFEGEFGVIVDTVPMGVTPDQAMAYIRLIVQINDWSLRALAGPEMKSGFGWVQAKPPCTMAPFAVTPDELGGQWRDGRVCMDLLVDWNGTRFGAANGEPMGFGFHDLVAHAARTRPLVAGTVIGSGTVSNPDFRQVGSSCIAERRGIEIVDEGAARTPFMRFGDRVRMEGRLPDGRAPFGIIDQQVVAYAGASS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 98 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 157 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 173 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 174 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 179 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 182 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 183 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 184 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 225 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 226 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 227 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 228 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 229 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 230 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 231 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 232 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 237 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 238 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 239 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 240 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 241 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 242 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 243 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 244 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 245 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 246 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 247 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 248 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 249 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 250 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 251 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 253 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 254 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 255 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 256 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 257 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 258 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 259 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 260 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 261 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 262 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 263 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 264 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 265 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 266 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 267 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 268 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 269 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 270 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 271 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 272 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 273 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 274 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 275 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 276 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.65 |
| Metatranscriptomes | 0 |
| Isolates | 4.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.67 |
| Nodule | 0 |
| Rhizoplane | 1.16 |
| Rhizosphere | 82.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495633_0000470 | 3300046558 | Bacteria | 41242 |
| 2 | JGI24736J21556_1000219 | 3300001904 | Bacteria | 10342 |
| 3 | JGI24741J21665_1000021 | 3300001915 | Bacteria | 37608 |
| 4 | JGI24741J21665_1000068 | 3300001915 | Bacteria | 25347 |
| 5 | JGI24741J21665_1000106 | 3300001915 | Bacteria | 22073 |
| 6 | JGI24741J21665_1000204 | 3300001915 | Bacteria | 17636 |
| 7 | JGI24741J21665_1001619 | 3300001915 | Bacteria | 6296 |
| 8 | JGI24740J21852_10000043 | 3300001979 | Bacteria | 41252 |
| 9 | JGI24740J21852_10001202 | 3300001979 | Bacteria | 11694 |
| 10 | JGI24740J21852_10001360 | 3300001979 | Bacteria | 11160 |
| 11 | JGI24740J21852_10004146 | 3300001979 | Bacteria | 6260 |
| 12 | JGI24740J21852_10007599 | 3300001979 | Bacteria | 4390 |
| 13 | JGI24739J22299_10001257 | 3300001989 | Bacteria | 9505 |
| 14 | JGI24739J22299_10003195 | 3300001989 | Bacteria | 6247 |
| 15 | JGI24739J22299_10007955 | 3300001989 | Bacteria | 3966 |
| 16 | JGI24739J22299_10017169 | 3300001989 | Bacteria | 2614 |
| 17 | JGI24737J22298_10000054 | 3300001990 | Bacteria | 33923 |
| 18 | JGI24737J22298_10000947 | 3300001990 | Bacteria | 10302 |
| 19 | JGI24737J22298_10001005 | 3300001990 | Bacteria | 9987 |
| 20 | JGI24737J22298_10001250 | 3300001990 | Bacteria | 8990 |
| 21 | JGI24737J22298_10003837 | 3300001990 | Bacteria | 5286 |
| 22 | JGI24737J22298_10012428 | 3300001990 | Bacteria | 2776 |
| 23 | JGI24737J22298_10022508 | 3300001990 | Bacteria | 2003 |
| 24 | JGI24735J21928_10001235 | 3300002067 | Bacteria | 9077 |
| 25 | JGI24735J21928_10003256 | 3300002067 | Bacteria | 5554 |
| 26 | JGI24735J21928_10010665 | 3300002067 | Bacteria | 2924 |
| 27 | JGI24738J21930_10000887 | 3300002075 | Bacteria | 8574 |
| 28 | JGI24738J21930_10004705 | 3300002075 | Bacteria | 3324 |
| 29 | JGI24744J21845_10004568 | 3300002077 | Bacteria | 2862 |
| 30 | JGI25153J46596_10000005 | 3300003215 | Bacteria | 492839 |
| 31 | rootH1_10058872 | 3300003316 | Bacteria | 9634 |
| 32 | rootL2_10060416 | 3300003322 | Bacteria | 28530 |
| 33 | rootL2_10095669 | 3300003322 | Bacteria | 1594 |
| 34 | rootL2_10165326 | 3300003322 | Bacteria | 2278 |
| 35 | rootL2_10201879 | 3300003322 | Bacteria | 2862 |
| 36 | rootH1_10113965 | 3300003323 | Bacteria | 8147 |
| 37 | Ga0055530_10028273 | 3300003791 | Bacteria | 1516 |
| 38 | Ga0065704_10098629 | 3300005289 | Bacteria | 2345 |
| 39 | Ga0070658_10000167 | 3300005327 | Bacteria | 57334 |
| 40 | Ga0070658_10000180 | 3300005327 | Bacteria | 55242 |
| 41 | Ga0070658_10000937 | 3300005327 | Bacteria | 24984 |
| 42 | Ga0070658_10080612 | 3300005327 | Bacteria | 2673 |
| 43 | Ga0070658_10153838 | 3300005327 | Bacteria | 1927 |
| 44 | Ga0070658_10167781 | 3300005327 | Bacteria | 1843 |
| 45 | Ga0070658_10287692 | 3300005327 | Bacteria | 1400 |
| 46 | Ga0070676_10023574 | 3300005328 | Bacteria | 3460 |
| 47 | Ga0070676_10210184 | 3300005328 | Bacteria | 1280 |
| 48 | Ga0070683_100105391 | 3300005329 | Bacteria | 2658 |
| 49 | Ga0070683_100133055 | 3300005329 | Bacteria | 2354 |
| 50 | Ga0070670_100008343 | 3300005331 | Bacteria | 8831 |
| 51 | Ga0070670_100036548 | 3300005331 | Bacteria | 4227 |
| 52 | Ga0070670_100117660 | 3300005331 | Bacteria | 2292 |
| 53 | Ga0070677_10033610 | 3300005333 | Bacteria | 1976 |
| 54 | Ga0068869_100025861 | 3300005334 | Bacteria | 4080 |
| 55 | Ga0070666_10036790 | 3300005335 | Bacteria | 3251 |
| 56 | Ga0070666_10072946 | 3300005335 | Bacteria | 2338 |
| 57 | Ga0070666_10077232 | 3300005335 | Bacteria | 2273 |
| 58 | Ga0070666_10086650 | 3300005335 | Bacteria | 2146 |
| 59 | Ga0070680_100000486 | 3300005336 | Bacteria | 27276 |
| 60 | Ga0070660_100005124 | 3300005339 | Bacteria | 9052 |
| 61 | Ga0070660_100014169 | 3300005339 | Bacteria | 5740 |
| 62 | Ga0070660_100121065 | 3300005339 | Bacteria | 2088 |
| 63 | Ga0070689_100030340 | 3300005340 | Bacteria | 4103 |
| 64 | Ga0070691_10017513 | 3300005341 | Bacteria | 3297 |
| 65 | Ga0070687_100079499 | 3300005343 | Bacteria | 1785 |
| 66 | Ga0070661_100002081 | 3300005344 | Bacteria | 13777 |
| 67 | Ga0070661_100015978 | 3300005344 | Bacteria | 5299 |
| 68 | Ga0070661_100016878 | 3300005344 | Bacteria | 5168 |
| 69 | Ga0070661_100056982 | 3300005344 | Bacteria | 2863 |
| 70 | Ga0070661_100081024 | 3300005344 | Bacteria | 2396 |
| 71 | Ga0070661_100111753 | 3300005344 | Bacteria | 2041 |
| 72 | Ga0070661_100117773 | 3300005344 | Bacteria | 1987 |
| 73 | Ga0070661_100136144 | 3300005344 | Bacteria | 1848 |
| 74 | Ga0070668_100016788 | 3300005347 | Bacteria | 5474 |
| 75 | Ga0070669_100034151 | 3300005353 | Bacteria | 3683 |
| 76 | Ga0070675_100017384 | 3300005354 | Bacteria | 5714 |
| 77 | Ga0070675_100064017 | 3300005354 | Bacteria | 3040 |
| 78 | Ga0070675_100072390 | 3300005354 | Bacteria | 2861 |
| 79 | Ga0070671_100011172 | 3300005355 | Bacteria | 7211 |
| 80 | Ga0070671_100011225 | 3300005355 | Bacteria | 7194 |
| 81 | Ga0070671_100091423 | 3300005355 | Bacteria | 2549 |
| 82 | Ga0070671_100121933 | 3300005355 | Unclassified | 2194 |
| 83 | Ga0070674_100000078 | 3300005356 | Bacteria | 44919 |
| 84 | Ga0070674_100003725 | 3300005356 | Bacteria | 8593 |
| 85 | Ga0070673_100007256 | 3300005364 | Bacteria | 7295 |
| 86 | Ga0070673_100026968 | 3300005364 | Bacteria | 4253 |
| 87 | Ga0070673_100082551 | 3300005364 | Bacteria | 2609 |
| 88 | Ga0070673_100087594 | 3300005364 | Bacteria | 2538 |
| 89 | Ga0070688_100056433 | 3300005365 | Bacteria | 2467 |
| 90 | Ga0070688_100062645 | 3300005365 | Bacteria | 2355 |
| 91 | Ga0070659_100000573 | 3300005366 | Bacteria | 26939 |
| 92 | Ga0070659_100008652 | 3300005366 | Bacteria | 7445 |
| 93 | Ga0070659_100057839 | 3300005366 | Bacteria | 3058 |
| 94 | Ga0070659_100309891 | 3300005366 | Bacteria | 1318 |
| 95 | Ga0070667_100012614 | 3300005367 | Bacteria | 6990 |
| 96 | Ga0070667_100210924 | 3300005367 | Bacteria | 1726 |
| 97 | Ga0070663_100000203 | 3300005455 | Bacteria | 29587 |
| 98 | Ga0070663_100005836 | 3300005455 | Bacteria | 7356 |
| 99 | Ga0070663_100017206 | 3300005455 | Bacteria | 4713 |
| 100 | Ga0070663_100028464 | 3300005455 | Bacteria | 3805 |
| 101 | Ga0070663_100032188 | 3300005455 | Bacteria | 3612 |
| 102 | Ga0070663_100038387 | 3300005455 | Bacteria | 3341 |
| 103 | Ga0070663_100038633 | 3300005455 | Bacteria | 3330 |
| 104 | Ga0070678_100000005 | 3300005456 | Bacteria | 70019 |
| 105 | Ga0070678_100012235 | 3300005456 | Bacteria | 5325 |
| 106 | Ga0070678_100032869 | 3300005456 | Bacteria | 3595 |
| 107 | Ga0070678_100107199 | 3300005456 | Bacteria | 2179 |
| 108 | Ga0070662_100031732 | 3300005457 | Bacteria | 3710 |
| 109 | Ga0070662_100032403 | 3300005457 | Bacteria | 3673 |
| 110 | Ga0070662_100036683 | 3300005457 | Bacteria | 3470 |
| 111 | Ga0070662_100040872 | 3300005457 | Bacteria | 3304 |
| 112 | Ga0070662_100176791 | 3300005457 | Bacteria | 1680 |
| 113 | Ga0070681_10000836 | 3300005458 | Bacteria | 25786 |
| 114 | Ga0070685_10018913 | 3300005466 | Bacteria | 3711 |
| 115 | Ga0070679_100002376 | 3300005530 | Bacteria | 17059 |
| 116 | Ga0068853_100134268 | 3300005539 | Bacteria | 2217 |
| 117 | Ga0068853_100139822 | 3300005539 | Bacteria | 2173 |
| 118 | Ga0068853_100377060 | 3300005539 | Bacteria | 1324 |
| 119 | Ga0070672_100000872 | 3300005543 | Bacteria | 18058 |
| 120 | Ga0070672_100049640 | 3300005543 | Unclassified | 3266 |
| 121 | Ga0070672_100086646 | 3300005543 | Bacteria | 2519 |
| 122 | Ga0070672_100284434 | 3300005543 | Bacteria | 1399 |
| 123 | Ga0070686_100099367 | 3300005544 | Bacteria | 1963 |
| 124 | Ga0070665_100036260 | 3300005548 | Bacteria | 4961 |
| 125 | Ga0068855_100019318 | 3300005563 | Bacteria | 8188 |
| 126 | Ga0068855_100035976 | 3300005563 | Bacteria | 5896 |
| 127 | Ga0068855_100083107 | 3300005563 | Bacteria | 3710 |
| 128 | Ga0068855_100116698 | 3300005563 | Bacteria | 3059 |
| 129 | Ga0068855_100123559 | 3300005563 | Bacteria | 2961 |
| 130 | Ga0068855_100133497 | 3300005563 | Bacteria | 2833 |
| 131 | Ga0070664_100005524 | 3300005564 | Bacteria | 10149 |
| 132 | Ga0070664_100007441 | 3300005564 | Bacteria | 8839 |
| 133 | Ga0070664_100012745 | 3300005564 | Bacteria | 6841 |
| 134 | Ga0070664_100020156 | 3300005564 | Bacteria | 5490 |
| 135 | Ga0070664_100033301 | 3300005564 | Bacteria | 4315 |
| 136 | Ga0070664_100109707 | 3300005564 | Bacteria | 2407 |
| 137 | Ga0070664_100195369 | 3300005564 | Bacteria | 1803 |
| 138 | Ga0068857_100030321 | 3300005577 | Bacteria | 4775 |
| 139 | Ga0068857_100030580 | 3300005577 | Bacteria | 4755 |
| 140 | Ga0068857_100152583 | 3300005577 | Bacteria | 2094 |
| 141 | Ga0068857_100156240 | 3300005577 | Bacteria | 2068 |
| 142 | Ga0068857_100237952 | 3300005577 | Bacteria | 1666 |
| 143 | Ga0068854_100026091 | 3300005578 | Bacteria | 4013 |
| 144 | Ga0068854_100032228 | 3300005578 | Bacteria | 3644 |
| 145 | Ga0068854_100082980 | 3300005578 | Bacteria | 2369 |
| 146 | Ga0068854_100130047 | 3300005578 | Bacteria | 1921 |
| 147 | Ga0068854_100211949 | 3300005578 | Bacteria | 1528 |
| 148 | Ga0068856_100032979 | 3300005614 | Bacteria | 5072 |
| 149 | Ga0068856_100072774 | 3300005614 | Bacteria | 3403 |
| 150 | Ga0068856_100078026 | 3300005614 | Bacteria | 3283 |
| 151 | Ga0068856_100148208 | 3300005614 | Bacteria | 2354 |
| 152 | Ga0068856_100165658 | 3300005614 | Bacteria | 2221 |
| 153 | Ga0068856_100241538 | 3300005614 | Bacteria | 1821 |
| 154 | Ga0068852_100006804 | 3300005616 | Bacteria | 8299 |
| 155 | Ga0068852_100136243 | 3300005616 | Bacteria | 2267 |
| 156 | Ga0068852_100138971 | 3300005616 | Bacteria | 2246 |
| 157 | Ga0068852_100286635 | 3300005616 | Bacteria | 1589 |
| 158 | Ga0068859_100055972 | 3300005617 | Bacteria | 3969 |
| 159 | Ga0068859_100108799 | 3300005617 | Bacteria | 2833 |
| 160 | Ga0068864_100063466 | 3300005618 | Bacteria | 3201 |
| 161 | Ga0068864_100245242 | 3300005618 | Bacteria | 1661 |
| 162 | Ga0068864_100401156 | 3300005618 | Bacteria | 1303 |
| 163 | Ga0068861_100000085 | 3300005719 | Bacteria | 44952 |
| 164 | Ga0068861_100298297 | 3300005719 | Bacteria | 1395 |
| 165 | Ga0068861_100369219 | 3300005719 | Unclassified | 1264 |
| 166 | Ga0068851_10004933 | 3300005834 | Bacteria | 6044 |
| 167 | Ga0068851_10007046 | 3300005834 | Bacteria | 5154 |
| 168 | Ga0068851_10044065 | 3300005834 | Bacteria | 2251 |
| 169 | Ga0068870_10131776 | 3300005840 | Bacteria | 1453 |
| 170 | Ga0068863_100038607 | 3300005841 | Bacteria | 4542 |
| 171 | Ga0068863_100336005 | 3300005841 | Bacteria | 1469 |
| 172 | Ga0068863_100523626 | 3300005841 | Bacteria | 1169 |
| 173 | Ga0068858_100000310 | 3300005842 | Bacteria | 51909 |
| 174 | Ga0068860_100002446 | 3300005843 | Bacteria | 19513 |
| 175 | Ga0068860_100230210 | 3300005843 | Bacteria | 1801 |
| 176 | Ga0068862_100000699 | 3300005844 | Bacteria | 34289 |
| 177 | Ga0081539_10000001 | 3300005985 | Bacteria | 808331 |
| 178 | Ga0075432_10003783 | 3300006058 | Bacteria | 5156 |
| 179 | Ga0075432_10011066 | 3300006058 | Bacteria | 3064 |
| 180 | Ga0075362_10000040 | 3300006177 | Bacteria | 46092 |
| 181 | Ga0075362_10082446 | 3300006177 | Bacteria | 1484 |
| 182 | Ga0075366_10021460 | 3300006195 | Bacteria | 3753 |
| 183 | Ga0097621_100004748 | 3300006237 | Bacteria | 9502 |
| 184 | Ga0097621_100186645 | 3300006237 | Bacteria | 1794 |
| 185 | Ga0075370_10036614 | 3300006353 | Bacteria | 2757 |
| 186 | Ga0075370_10042480 | 3300006353 | Bacteria | 2568 |
| 187 | Ga0068871_100013227 | 3300006358 | Bacteria | 6120 |
| 188 | Ga0068871_100330004 | 3300006358 | Bacteria | 1345 |
| 189 | Ga0097620_100055973 | 3300006931 | Bacteria | 3969 |
| 190 | Ga0097620_100108791 | 3300006931 | Bacteria | 2833 |
| 191 | Ga0105251_10001809 | 3300009011 | Bacteria | 17722 |
| 192 | Ga0105240_10000121 | 3300009093 | Bacteria | 163057 |
| 193 | Ga0105240_10082383 | 3300009093 | Bacteria | 3951 |
| 194 | Ga0105240_10097190 | 3300009093 | Bacteria | 3589 |
| 195 | Ga0105240_10211402 | 3300009093 | Bacteria | 2267 |
| 196 | Ga0105240_10509329 | 3300009093 | Bacteria | 1337 |
| 197 | Ga0105240_10708390 | 3300009093 | Bacteria | 1098 |
| 198 | Ga0105245_10001044 | 3300009098 | Bacteria | 25061 |
| 199 | Ga0105247_10001062 | 3300009101 | Bacteria | 20537 |
| 200 | Ga0105243_10000030 | 3300009148 | Bacteria | 190342 |
| 201 | Ga0105243_10054917 | 3300009148 | Bacteria | 3164 |
| 202 | Ga0105241_10000799 | 3300009174 | Bacteria | 23921 |
| 203 | Ga0105241_10000903 | 3300009174 | Bacteria | 22440 |
| 204 | Ga0105241_10017577 | 3300009174 | Bacteria | 5257 |
| 205 | Ga0105241_10177281 | 3300009174 | Bacteria | 1765 |
| 206 | Ga0105241_10217077 | 3300009174 | Bacteria | 1605 |
| 207 | Ga0105248_10015048 | 3300009177 | Bacteria | 8519 |
| 208 | Ga0105248_10055553 | 3300009177 | Bacteria | 4442 |
| 209 | Ga0105248_10233496 | 3300009177 | Bacteria | 2071 |
| 210 | Ga0105237_10055147 | 3300009545 | Bacteria | 3981 |
| 211 | Ga0105237_10361523 | 3300009545 | Bacteria | 1456 |
| 212 | Ga0105238_10007472 | 3300009551 | Bacteria | 10949 |
| 213 | Ga0105238_10021395 | 3300009551 | Bacteria | 6589 |
| 214 | Ga0105238_10076399 | 3300009551 | Bacteria | 3340 |
| 215 | Ga0105249_10000196 | 3300009553 | Bacteria | 69134 |
| 216 | Ga0105249_10033714 | 3300009553 | Bacteria | 4636 |
| 217 | Ga0105239_10005768 | 3300010375 | Bacteria | 14444 |
| 218 | Ga0105239_10061342 | 3300010375 | Bacteria | 4127 |
| 219 | Ga0105239_10166688 | 3300010375 | Bacteria | 2463 |
| 220 | Ga0105239_10267262 | 3300010375 | Bacteria | 1923 |
| 221 | Ga0105239_10404293 | 3300010375 | Bacteria | 1545 |
| 222 | Ga0105246_10263859 | 3300011119 | Bacteria | 1373 |
| 223 | Ga0157373_10018661 | 3300013100 | Bacteria | 5049 |
| 224 | Ga0157373_10019281 | 3300013100 | Bacteria | 4967 |
| 225 | Ga0157373_10057484 | 3300013100 | Bacteria | 2759 |
| 226 | Ga0157373_10127119 | 3300013100 | Bacteria | 1793 |
| 227 | Ga0157373_10280132 | 3300013100 | Bacteria | 1181 |
| 228 | Ga0157371_10000111 | 3300013102 | Bacteria | 123977 |
| 229 | Ga0157371_10000757 | 3300013102 | Bacteria | 37321 |
| 230 | Ga0157371_10009942 | 3300013102 | Bacteria | 7446 |
| 231 | Ga0157370_10042645 | 3300013104 | Bacteria | 4371 |
| 232 | Ga0157369_10071138 | 3300013105 | Bacteria | 3735 |
| 233 | Ga0157369_10081176 | 3300013105 | Bacteria | 3471 |
| 234 | Ga0157369_10129916 | 3300013105 | Bacteria | 2670 |
| 235 | Ga0157374_10167170 | 3300013296 | Bacteria | 2144 |
| 236 | Ga0163162_10131849 | 3300013306 | Bacteria | 2608 |
| 237 | Ga0163162_10295572 | 3300013306 | Bacteria | 1751 |
| 238 | Ga0157372_10115387 | 3300013307 | Bacteria | 3079 |
| 239 | Ga0157372_10165991 | 3300013307 | Bacteria | 2553 |
| 240 | Ga0157372_10204213 | 3300013307 | Bacteria | 2289 |
| 241 | Ga0157372_10217348 | 3300013307 | Bacteria | 2215 |
| 242 | Ga0157372_10405894 | 3300013307 | Bacteria | 1588 |
| 243 | Ga0157375_10037462 | 3300013308 | Bacteria | 4647 |
| 244 | Ga0157375_10252678 | 3300013308 | Bacteria | 1924 |
| 245 | Ga0163163_10016474 | 3300014325 | Bacteria | 6872 |
| 246 | Ga0157380_10126611 | 3300014326 | Bacteria | 2172 |
| 247 | Ga0157380_10147364 | 3300014326 | Bacteria | 2030 |
| 248 | Ga0157377_10006308 | 3300014745 | Bacteria | 5644 |
| 249 | Ga0157379_10129206 | 3300014968 | Bacteria | 2273 |
| 250 | Ga0157376_10235690 | 3300014969 | Bacteria | 1702 |
| 251 | Ga0163161_10002180 | 3300017792 | Bacteria | 14123 |
| 252 | Ga0163161_10016322 | 3300017792 | Bacteria | 5184 |
| 253 | Ga0163161_10151988 | 3300017792 | Bacteria | 1760 |
| 254 | Ga0163161_10209132 | 3300017792 | Bacteria | 1507 |
| 255 | Ga0213872_10041975 | 3300021361 | Bacteria | 2087 |
| 256 | Ga0213872_10084398 | 3300021361 | Bacteria | 1424 |
| 257 | Ga0209147_100763 | 3300025229 | Bacteria | 15759 |
| 258 | Ga0209455_1010049 | 3300025272 | Bacteria | 2434 |
| 259 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 260 | Ga0209050_1001048 | 3300025298 | Bacteria | 34107 |
| 261 | Ga0209050_1016290 | 3300025298 | Bacteria | 3053 |
| 262 | Ga0207656_10004092 | 3300025321 | Bacteria | 5060 |
| 263 | Ga0207656_10012645 | 3300025321 | Bacteria | 3213 |
| 264 | Ga0207656_10018676 | 3300025321 | Bacteria | 2732 |
| 265 | Ga0207656_10029633 | 3300025321 | Bacteria | 2256 |
| 266 | Ga0207656_10037068 | 3300025321 | Bacteria | 2050 |
| 267 | Ga0207656_10038474 | 3300025321 | Bacteria | 2018 |
| 268 | Ga0207682_10006701 | 3300025893 | Bacteria | 4625 |
| 269 | Ga0207710_10006828 | 3300025900 | Bacteria | 4860 |
| 270 | Ga0207680_10019437 | 3300025903 | Bacteria | 3633 |
| 271 | Ga0207680_10082882 | 3300025903 | Bacteria | 2020 |
| 272 | Ga0207647_10002614 | 3300025904 | Bacteria | 13617 |
| 273 | Ga0207647_10013943 | 3300025904 | Bacteria | 5560 |
| 274 | Ga0207647_10027409 | 3300025904 | Bacteria | 3713 |
| 275 | Ga0207647_10067164 | 3300025904 | Bacteria | 2174 |
| 276 | Ga0207647_10082511 | 3300025904 | Bacteria | 1925 |
| 277 | Ga0207647_10103528 | 3300025904 | Bacteria | 1688 |
| 278 | Ga0207645_10029241 | 3300025907 | Bacteria | 3553 |
| 279 | Ga0207643_10132844 | 3300025908 | Bacteria | 1482 |
| 280 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 281 | Ga0207705_10000157 | 3300025909 | Bacteria | 73563 |
| 282 | Ga0207705_10000228 | 3300025909 | Bacteria | 55776 |
| 283 | Ga0207705_10000784 | 3300025909 | Bacteria | 26096 |
| 284 | Ga0207654_10001685 | 3300025911 | Bacteria | 11537 |
| 285 | Ga0207654_10002302 | 3300025911 | Bacteria | 9796 |
| 286 | Ga0207654_10024069 | 3300025911 | Bacteria | 3270 |
| 287 | Ga0207654_10040965 | 3300025911 | Bacteria | 2613 |
| 288 | Ga0207654_10048834 | 3300025911 | Bacteria | 2424 |
| 289 | Ga0207707_10006188 | 3300025912 | Bacteria | 10457 |
| 290 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 291 | Ga0207695_10007333 | 3300025913 | Bacteria | 14081 |
| 292 | Ga0207695_10010978 | 3300025913 | Bacteria | 11009 |
| 293 | Ga0207695_10027051 | 3300025913 | Bacteria | 6390 |
| 294 | Ga0207695_10087375 | 3300025913 | Bacteria | 3141 |
| 295 | Ga0207695_10108153 | 3300025913 | Bacteria | 2765 |
| 296 | Ga0207695_10255720 | 3300025913 | Bacteria | 1650 |
| 297 | Ga0207671_10003767 | 3300025914 | Bacteria | 14911 |
| 298 | Ga0207671_10004267 | 3300025914 | Bacteria | 13756 |
| 299 | Ga0207671_10006621 | 3300025914 | Bacteria | 10278 |
| 300 | Ga0207671_10120423 | 3300025914 | Bacteria | 2006 |
| 301 | Ga0207660_10004609 | 3300025917 | Bacteria | 8984 |
| 302 | Ga0207662_10182485 | 3300025918 | Bacteria | 1351 |
| 303 | Ga0207657_10000465 | 3300025919 | Bacteria | 42880 |
| 304 | Ga0207657_10001164 | 3300025919 | Bacteria | 27924 |
| 305 | Ga0207657_10001229 | 3300025919 | Bacteria | 27350 |
| 306 | Ga0207657_10009609 | 3300025919 | Bacteria | 9707 |
| 307 | Ga0207657_10010580 | 3300025919 | Bacteria | 9199 |
| 308 | Ga0207657_10014853 | 3300025919 | Bacteria | 7579 |
| 309 | Ga0207649_10001601 | 3300025920 | Bacteria | 13157 |
| 310 | Ga0207649_10003068 | 3300025920 | Bacteria | 9170 |
| 311 | Ga0207649_10010980 | 3300025920 | Bacteria | 4982 |
| 312 | Ga0207649_10098820 | 3300025920 | Bacteria | 1927 |
| 313 | Ga0207652_10018418 | 3300025921 | Bacteria | 5727 |
| 314 | Ga0207681_10062976 | 3300025923 | Bacteria | 2556 |
| 315 | Ga0207694_10009999 | 3300025924 | Bacteria | 7152 |
| 316 | Ga0207694_10031707 | 3300025924 | Bacteria | 4040 |
| 317 | Ga0207694_10049311 | 3300025924 | Bacteria | 3259 |
| 318 | Ga0207694_10090041 | 3300025924 | Bacteria | 2420 |
| 319 | Ga0207694_10112313 | 3300025924 | Bacteria | 2168 |
| 320 | Ga0207650_10016772 | 3300025925 | Bacteria | 5122 |
| 321 | Ga0207650_10096157 | 3300025925 | Bacteria | 2272 |
| 322 | Ga0207659_10007271 | 3300025926 | Bacteria | 6802 |
| 323 | Ga0207659_10065719 | 3300025926 | Bacteria | 2629 |
| 324 | Ga0207687_10002747 | 3300025927 | Bacteria | 11933 |
| 325 | Ga0207644_10021555 | 3300025931 | Bacteria | 4391 |
| 326 | Ga0207690_10000368 | 3300025932 | Bacteria | 29888 |
| 327 | Ga0207690_10001385 | 3300025932 | Bacteria | 15233 |
| 328 | Ga0207690_10003924 | 3300025932 | Bacteria | 8792 |
| 329 | Ga0207690_10299924 | 3300025932 | Bacteria | 1257 |
| 330 | Ga0207706_10001587 | 3300025933 | Bacteria | 22571 |
| 331 | Ga0207706_10022833 | 3300025933 | Bacteria | 5613 |
| 332 | Ga0207706_10024381 | 3300025933 | Bacteria | 5423 |
| 333 | Ga0207706_10041335 | 3300025933 | Bacteria | 4087 |
| 334 | Ga0207706_10041697 | 3300025933 | Bacteria | 4068 |
| 335 | Ga0207706_10042913 | 3300025933 | Bacteria | 4008 |
| 336 | Ga0207706_10180760 | 3300025933 | Bacteria | 1852 |
| 337 | Ga0207709_10000137 | 3300025935 | Bacteria | 106203 |
| 338 | Ga0207670_10015539 | 3300025936 | Bacteria | 4551 |
| 339 | Ga0207669_10000093 | 3300025937 | Bacteria | 45459 |
| 340 | Ga0207669_10003436 | 3300025937 | Bacteria | 6845 |
| 341 | Ga0207691_10005079 | 3300025940 | Bacteria | 12704 |
| 342 | Ga0207691_10026614 | 3300025940 | Bacteria | 5427 |
| 343 | Ga0207691_10096866 | 3300025940 | Unclassified | 2637 |
| 344 | Ga0207711_10008752 | 3300025941 | Bacteria | 8464 |
| 345 | Ga0207711_10024045 | 3300025941 | Bacteria | 5100 |
| 346 | Ga0207689_10036853 | 3300025942 | Bacteria | 4059 |
| 347 | Ga0207679_10000640 | 3300025945 | Bacteria | 23345 |
| 348 | Ga0207679_10054153 | 3300025945 | Bacteria | 2952 |
| 349 | Ga0207679_10100615 | 3300025945 | Bacteria | 2259 |
| 350 | Ga0207679_10124169 | 3300025945 | Bacteria | 2060 |
| 351 | Ga0207679_10160530 | 3300025945 | Bacteria | 1840 |
| 352 | Ga0207679_10334451 | 3300025945 | Bacteria | 1315 |
| 353 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 354 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 355 | Ga0207667_10002681 | 3300025949 | Bacteria | 22015 |
| 356 | Ga0207667_10016478 | 3300025949 | Bacteria | 8350 |
| 357 | Ga0207667_10051010 | 3300025949 | Bacteria | 4363 |
| 358 | Ga0207667_10056466 | 3300025949 | Bacteria | 4125 |
| 359 | Ga0207667_10088965 | 3300025949 | Bacteria | 3193 |
| 360 | Ga0207667_10120298 | 3300025949 | Bacteria | 2706 |
| 361 | Ga0207651_10002413 | 3300025960 | Bacteria | 8928 |
| 362 | Ga0207651_10002469 | 3300025960 | Bacteria | 8823 |
| 363 | Ga0207651_10065019 | 3300025960 | Unclassified | 2556 |
| 364 | Ga0207712_10000015 | 3300025961 | Bacteria | 346689 |
| 365 | Ga0207668_10005778 | 3300025972 | Bacteria | 7291 |
| 366 | Ga0207640_10005079 | 3300025981 | Bacteria | 7160 |
| 367 | Ga0207640_10028932 | 3300025981 | Bacteria | 3395 |
| 368 | Ga0207640_10071113 | 3300025981 | Bacteria | 2342 |
| 369 | Ga0207640_10222105 | 3300025981 | Bacteria | 1447 |
| 370 | Ga0207658_10056441 | 3300025986 | Bacteria | 2914 |
| 371 | Ga0207703_10000757 | 3300026035 | Bacteria | 31884 |
| 372 | Ga0207639_10000160 | 3300026041 | Bacteria | 51548 |
| 373 | Ga0207639_10000185 | 3300026041 | Bacteria | 48694 |
| 374 | Ga0207639_10001020 | 3300026041 | Bacteria | 19060 |
| 375 | Ga0207639_10013092 | 3300026041 | Bacteria | 5792 |
| 376 | Ga0207639_10050242 | 3300026041 | Bacteria | 3166 |
| 377 | Ga0207639_10065385 | 3300026041 | Bacteria | 2823 |
| 378 | Ga0207639_10125066 | 3300026041 | Bacteria | 2119 |
| 379 | Ga0207639_10261251 | 3300026041 | Bacteria | 1514 |
| 380 | Ga0207678_10000083 | 3300026067 | Bacteria | 77023 |
| 381 | Ga0207678_10000491 | 3300026067 | Bacteria | 35916 |
| 382 | Ga0207678_10000545 | 3300026067 | Bacteria | 34437 |
| 383 | Ga0207678_10000801 | 3300026067 | Bacteria | 28842 |
| 384 | Ga0207678_10008944 | 3300026067 | Bacteria | 8818 |
| 385 | Ga0207678_10053121 | 3300026067 | Bacteria | 3493 |
| 386 | Ga0207678_10089483 | 3300026067 | Bacteria | 2631 |
| 387 | Ga0207678_10121804 | 3300026067 | Bacteria | 2226 |
| 388 | Ga0207702_10004461 | 3300026078 | Bacteria | 12438 |
| 389 | Ga0207702_10004499 | 3300026078 | Bacteria | 12374 |
| 390 | Ga0207702_10009174 | 3300026078 | Bacteria | 8319 |
| 391 | Ga0207702_10009706 | 3300026078 | Bacteria | 8083 |
| 392 | Ga0207702_10016210 | 3300026078 | Bacteria | 6169 |
| 393 | Ga0207702_10118736 | 3300026078 | Bacteria | 2363 |
| 394 | Ga0207702_10323644 | 3300026078 | Bacteria | 1469 |
| 395 | Ga0207702_10395284 | 3300026078 | Bacteria | 1332 |
| 396 | Ga0207641_10001505 | 3300026088 | Bacteria | 22818 |
| 397 | Ga0207641_10052577 | 3300026088 | Bacteria | 3450 |
| 398 | Ga0207648_10044737 | 3300026089 | Bacteria | 3884 |
| 399 | Ga0207676_10054692 | 3300026095 | Bacteria | 3129 |
| 400 | Ga0207676_10145144 | 3300026095 | Bacteria | 2037 |
| 401 | Ga0207676_10317648 | 3300026095 | Bacteria | 1428 |
| 402 | Ga0207674_10017103 | 3300026116 | Bacteria | 7916 |
| 403 | Ga0207674_10031539 | 3300026116 | Bacteria | 5566 |
| 404 | Ga0207674_10033636 | 3300026116 | Bacteria | 5366 |
| 405 | Ga0207674_10085338 | 3300026116 | Bacteria | 3153 |
| 406 | Ga0207674_10138473 | 3300026116 | Bacteria | 2395 |
| 407 | Ga0207674_10141171 | 3300026116 | Bacteria | 2368 |
| 408 | Ga0207674_10446228 | 3300026116 | Bacteria | 1250 |
| 409 | Ga0207675_100000012 | 3300026118 | Bacteria | 140594 |
| 410 | Ga0207675_100255201 | 3300026118 | Bacteria | 1698 |
| 411 | Ga0207683_10000115 | 3300026121 | Bacteria | 65630 |
| 412 | Ga0207683_10053762 | 3300026121 | Bacteria | 3531 |
| 413 | Ga0207683_10141231 | 3300026121 | Bacteria | 2170 |
| 414 | Ga0207698_10000019 | 3300026142 | Bacteria | 145910 |
| 415 | Ga0207698_10003456 | 3300026142 | Bacteria | 9511 |
| 416 | Ga0207698_10007180 | 3300026142 | Bacteria | 6976 |
| 417 | Ga0207698_10011849 | 3300026142 | Bacteria | 5676 |
| 418 | Ga0207698_10018236 | 3300026142 | Bacteria | 4778 |
| 419 | Ga0207698_10041531 | 3300026142 | Bacteria | 3428 |
| 420 | Ga0207698_10077164 | 3300026142 | Bacteria | 2670 |
| 421 | Ga0207698_10153584 | 3300026142 | Bacteria | 2002 |
| 422 | Ga0207428_10013576 | 3300027907 | Bacteria | 7109 |
| 423 | Ga0207428_10096876 | 3300027907 | Bacteria | 2284 |
| 424 | Ga0268266_10119155 | 3300028379 | Bacteria | 2347 |
| 425 | Ga0268266_10122130 | 3300028379 | Bacteria | 2319 |
| 426 | Ga0268265_10000658 | 3300028380 | Bacteria | 34307 |
| 427 | Ga0268264_10002774 | 3300028381 | Bacteria | 15281 |
| 428 | Ga0268264_10028752 | 3300028381 | Bacteria | 4550 |
| 429 | Ga0268264_10219456 | 3300028381 | Bacteria | 1750 |
| 430 | Ga0265334_10019913 | 3300028573 | Bacteria | 2753 |
| 431 | Ga0307515_10051473 | 3300028794 | Bacteria | 6139 |
| 432 | Ga0307515_10140118 | 3300028794 | Bacteria | 2600 |
| 433 | Ga0265338_10008334 | 3300028800 | Bacteria | 12608 |
| 434 | Ga0265338_10026416 | 3300028800 | Bacteria | 5857 |
| 435 | Ga0265338_10059595 | 3300028800 | Bacteria | 3362 |
| 436 | Ga0265340_10019040 | 3300031247 | Bacteria | 3536 |
| 437 | Ga0265340_10028348 | 3300031247 | Bacteria | 2817 |
| 438 | Ga0265327_10002198 | 3300031251 | Bacteria | 21377 |
| 439 | Ga0307513_10000034 | 3300031456 | Bacteria | 185012 |
| 440 | Ga0307513_10057878 | 3300031456 | Bacteria | 4125 |
| 441 | Ga0307513_10090272 | 3300031456 | Bacteria | 3126 |
| 442 | Ga0307509_10232840 | 3300031507 | Bacteria | 1643 |
| 443 | Ga0307408_100055766 | 3300031548 | Bacteria | 2862 |
| 444 | Ga0307408_100079323 | 3300031548 | Bacteria | 2449 |
| 445 | Ga0307508_10025651 | 3300031616 | Bacteria | 5341 |
| 446 | Ga0265314_10036108 | 3300031711 | Bacteria | 3595 |
| 447 | Ga0307405_10062371 | 3300031731 | Bacteria | 2360 |
| 448 | Ga0307405_10062434 | 3300031731 | Bacteria | 2359 |
| 449 | Ga0307413_10051151 | 3300031824 | Bacteria | 2488 |
| 450 | Ga0307413_10113942 | 3300031824 | Bacteria | 1816 |
| 451 | Ga0307406_10051052 | 3300031901 | Bacteria | 2624 |
| 452 | Ga0307406_10064151 | 3300031901 | Bacteria | 2382 |
| 453 | Ga0307407_10206864 | 3300031903 | Bacteria | 1319 |
| 454 | Ga0307412_10035794 | 3300031911 | Bacteria | 3174 |
| 455 | Ga0307412_10077360 | 3300031911 | Bacteria | 2288 |
| 456 | Ga0307412_10099599 | 3300031911 | Bacteria | 2052 |
| 457 | Ga0307412_10101111 | 3300031911 | Bacteria | 2039 |
| 458 | Ga0307412_10144528 | 3300031911 | Bacteria | 1746 |
| 459 | Ga0307409_100053268 | 3300031995 | Bacteria | 3108 |
| 460 | Ga0307409_100209284 | 3300031995 | Bacteria | 1751 |
| 461 | Ga0307409_100375577 | 3300031995 | Bacteria | 1349 |
| 462 | Ga0307416_100025913 | 3300032002 | Bacteria | 4310 |
| 463 | Ga0307414_10003631 | 3300032004 | Bacteria | 8266 |
| 464 | Ga0307414_10012568 | 3300032004 | Bacteria | 5012 |
| 465 | Ga0307414_10154722 | 3300032004 | Bacteria | 1813 |
| 466 | Ga0307414_10263110 | 3300032004 | Bacteria | 1440 |
| 467 | Ga0307411_10204174 | 3300032005 | Bacteria | 1520 |
| 468 | Ga0307510_10002596 | 3300033180 | Bacteria | 20627 |
| 469 | Ga0373931_0024623 | 3300035691 | Bacteria | 3052 |
| 470 | Ga0373935_0027934 | 3300035692 | Bacteria | 3487 |
| 471 | Ga0373927_0001162 | 3300035695 | Bacteria | 19918 |
| 472 | Ga0316582_0000197 | 3300036647 | Bacteria | 19119 |
| 473 | Ga0316584_0092524 | 3300036712 | Unclassified | 2264 |
| 474 | Ga0316584_0213817 | 3300036712 | Bacteria | 1418 |
| 475 | Ga0373925_0000991 | 3300037068 | Bacteria | 25768 |
| 476 | Ga0400483_048519 | 3300039062 | Bacteria | 5904 |
| 477 | Ga0400483_050097 | 3300039062 | Bacteria | 4038 |
| 478 | Ga0400483_161893 | 3300039062 | Bacteria | 2469 |
| 479 | Ga0436361_0812819 | 3300039447 | Bacteria | 11508 |
| 480 | Ga0439443_004810 | 3300042003 | Bacteria | 1780 |
| 481 | Ga0439435_0018676 | 3300042436 | Bacteria | 1767 |
| 482 | Ga0466972_0020132 | 3300044658 | Bacteria | 3335 |
| 483 | Ga0466966_0032567 | 3300044684 | Bacteria | 3377 |
| 484 | Ga0466961_0091244 | 3300044693 | Bacteria | 1923 |
| 485 | Ga0466960_0086101 | 3300044901 | Bacteria | 1593 |
| 486 | Ga0466959_0039932 | 3300045049 | Bacteria | 3468 |
| 487 | Ga0451576_0001437 | 3300045051 | Bacteria | 40602 |
| 488 | Ga0451576_0051839 | 3300045051 | Bacteria | 4301 |
| 489 | Ga0466958_0000355 | 3300045836 | Bacteria | 18454 |
| 490 | Ga0466958_0036857 | 3300045836 | Bacteria | 2929 |
| 491 | Ga0495627_000305 | 3300046453 | Bacteria | 48602 |
| 492 | Ga0495627_000520 | 3300046453 | Bacteria | 31871 |
| 493 | Ga0495627_000804 | 3300046453 | Bacteria | 22900 |
| 494 | Ga0495627_033046 | 3300046453 | Bacteria | 1624 |
| 495 | Ga0495603_0166890 | 3300046455 | Bacteria | 1276 |
| 496 | Ga0495638_0000024 | 3300046460 | Bacteria | 362116 |
| 497 | Ga0495638_0000074 | 3300046460 | Bacteria | 163843 |
| 498 | Ga0495650_0000325 | 3300046471 | Bacteria | 85327 |
| 499 | Ga0495650_0001824 | 3300046471 | Bacteria | 19114 |
| 500 | Ga0495650_0073563 | 3300046471 | Bacteria | 1335 |
| 501 | Ga0495584_0053281 | 3300046491 | Bacteria | 2036 |
| 502 | Ga0495584_0194802 | 3300046491 | Bacteria | 1030 |
| 503 | Ga0495585_0000339 | 3300046492 | Bacteria | 45404 |
| 504 | Ga0495585_0001102 | 3300046492 | Bacteria | 22234 |
| 505 | Ga0495585_0044720 | 3300046492 | Bacteria | 2473 |
| 506 | Ga0495585_0104795 | 3300046492 | Bacteria | 1509 |
| 507 | Ga0495585_0127167 | 3300046492 | Bacteria | 1344 |
| 508 | Ga0495594_0051755 | 3300046499 | Bacteria | 2260 |
| 509 | Ga0495596_0000136 | 3300046500 | Bacteria | 50455 |
| 510 | Ga0495596_0000187 | 3300046500 | Bacteria | 43214 |
| 511 | Ga0495596_0001732 | 3300046500 | Bacteria | 12249 |
| 512 | Ga0495596_0002742 | 3300046500 | Bacteria | 9247 |
| 513 | Ga0495583_0000275 | 3300046506 | Bacteria | 83178 |
| 514 | Ga0495583_0000527 | 3300046506 | Bacteria | 54086 |
| 515 | Ga0495583_0022408 | 3300046506 | Bacteria | 3223 |
| 516 | Ga0495606_0027879 | 3300046507 | Bacteria | 3995 |
| 517 | Ga0495610_0000034 | 3300046512 | Bacteria | 201408 |
| 518 | Ga0495610_0002224 | 3300046512 | Bacteria | 16409 |
| 519 | Ga0495610_0003976 | 3300046512 | Bacteria | 11174 |
| 520 | Ga0495610_0005525 | 3300046512 | Bacteria | 8956 |
| 521 | Ga0495610_0026473 | 3300046512 | Bacteria | 3096 |
| 522 | Ga0495610_0042899 | 3300046512 | Bacteria | 2258 |
| 523 | Ga0495610_0052989 | 3300046512 | Bacteria | 1967 |
| 524 | Ga0495620_0001019 | 3300046515 | Bacteria | 17232 |
| 525 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 526 | Ga0495632_0000053 | 3300046519 | Bacteria | 131977 |
| 527 | Ga0495632_0000498 | 3300046519 | Bacteria | 36972 |
| 528 | Ga0495632_0000813 | 3300046519 | Bacteria | 27616 |
| 529 | Ga0495632_0006591 | 3300046519 | Bacteria | 7432 |
| 530 | Ga0495632_0070173 | 3300046519 | Bacteria | 1685 |
| 531 | Ga0495637_0000717 | 3300046520 | Bacteria | 22702 |
| 532 | Ga0495637_0000826 | 3300046520 | Bacteria | 20447 |
| 533 | Ga0495637_0000850 | 3300046520 | Bacteria | 20082 |
| 534 | Ga0495643_0000006 | 3300046522 | Bacteria | 419524 |
| 535 | Ga0495643_0000020 | 3300046522 | Bacteria | 294973 |
| 536 | Ga0495643_0000061 | 3300046522 | Bacteria | 185933 |
| 537 | Ga0495643_0000859 | 3300046522 | Bacteria | 32706 |
| 538 | Ga0495643_0001729 | 3300046522 | Bacteria | 18882 |
| 539 | Ga0495643_0071188 | 3300046522 | Bacteria | 1826 |
| 540 | Ga0495643_0099853 | 3300046522 | Bacteria | 1488 |
| 541 | Ga0495648_0000005 | 3300046524 | Bacteria | 362116 |
| 542 | Ga0495648_0000050 | 3300046524 | Bacteria | 163843 |
| 543 | Ga0495648_0000051 | 3300046524 | Bacteria | 162502 |
| 544 | Ga0495648_0005515 | 3300046524 | Bacteria | 10498 |
| 545 | Ga0495648_0006642 | 3300046524 | Bacteria | 9369 |
| 546 | Ga0495648_0030955 | 3300046524 | Bacteria | 3531 |
| 547 | Ga0495648_0039517 | 3300046524 | Bacteria | 3002 |
| 548 | Ga0495663_0000002 | 3300046525 | Bacteria | 495384 |
| 549 | Ga0495663_0000012 | 3300046525 | Bacteria | 157546 |
| 550 | Ga0495654_0025597 | 3300046530 | Bacteria | 3039 |
| 551 | Ga0495654_0061125 | 3300046530 | Bacteria | 1810 |
| 552 | Ga0495622_0042546 | 3300046557 | Bacteria | 2112 |
| 553 | Ga0495633_0000208 | 3300046558 | Bacteria | 74469 |
| 554 | Ga0495633_0000312 | 3300046558 | Bacteria | 55371 |
| 555 | Ga0495633_0000413 | 3300046558 | Bacteria | 44456 |
| 556 | Ga0495633_0004138 | 3300046558 | Bacteria | 9329 |
| 557 | Ga0495633_0013178 | 3300046558 | Bacteria | 4367 |
| 558 | Ga0495633_0034785 | 3300046558 | Bacteria | 2422 |
| 559 | Ga0495625_0010009 | 3300046660 | Bacteria | 7885 |
| 560 | Ga0495625_0032733 | 3300046660 | Bacteria | 3852 |
| 561 | Ga0495625_0225685 | 3300046660 | Bacteria | 1225 |
| 562 | Ga0495671_0000008 | 3300046692 | Bacteria | 419524 |
| 563 | Ga0495671_0000016 | 3300046692 | Bacteria | 294821 |
| 564 | Ga0495671_0000036 | 3300046692 | Bacteria | 181192 |
| 565 | Ga0495671_0000096 | 3300046692 | Bacteria | 82384 |
| 566 | Ga0495671_0000187 | 3300046692 | Bacteria | 54674 |
| 567 | Ga0495671_0010581 | 3300046692 | Bacteria | 5101 |
| 568 | Ga0495671_0017625 | 3300046692 | Bacteria | 3799 |
| 569 | Ga0495673_0000157 | 3300047469 | Bacteria | 117733 |
| 570 | Ga0495673_0000365 | 3300047469 | Bacteria | 54674 |
| 571 | Ga0495681_0000037 | 3300047470 | Bacteria | 122686 |
| 572 | Ga0495681_0000208 | 3300047470 | Bacteria | 48683 |
| 573 | Ga0495681_0000437 | 3300047470 | Bacteria | 31989 |
| 574 | Ga0495681_0001363 | 3300047470 | Bacteria | 18446 |
| 575 | Ga0495681_0002391 | 3300047470 | Bacteria | 13438 |
| 576 | Ga0495686_0009263 | 3300047472 | Bacteria | 7111 |
| 577 | Ga0495686_0069693 | 3300047472 | Bacteria | 2167 |
| 578 | Ga0495686_0078788 | 3300047472 | Bacteria | 2016 |
| 579 | Ga0495686_0191365 | 3300047472 | Bacteria | 1179 |
| 580 | Ga0495615_0000002 | 3300048090 | Bacteria | 167871 |
| 581 | Ga0495626_0000852 | 3300048091 | Bacteria | 27166 |
| 582 | Ga0496102_0164084 | 3300048905 | Bacteria | 2090 |
| 583 | Ga0496109_0114978 | 3300048912 | Bacteria | 2503 |
| 584 | Ga0496109_0146367 | 3300048912 | Bacteria | 2211 |
| 585 | Ga0496110_0053470 | 3300048913 | Bacteria | 3550 |
| 586 | Ga0496111_0058545 | 3300048914 | Bacteria | 2789 |
| 587 | Ga0496113_0036418 | 3300048916 | Bacteria | 3605 |
| 588 | Ga0496114_0006351 | 3300048917 | Bacteria | 9299 |
| 589 | Ga0496116_0000093 | 3300048919 | Bacteria | 205660 |
| 590 | Ga0496116_0019366 | 3300048919 | Bacteria | 5212 |
| 591 | Ga0496117_0057598 | 3300048920 | Bacteria | 2697 |
| 592 | Ga0496117_0062063 | 3300048920 | Bacteria | 2564 |
| 593 | Ga0496117_0125437 | 3300048920 | Bacteria | 1568 |
| 594 | Ga0496118_0004744 | 3300048921 | Bacteria | 15911 |
| 595 | Ga0496118_0005210 | 3300048921 | Bacteria | 14872 |
| 596 | Ga0496118_0033605 | 3300048921 | Bacteria | 4205 |
| 597 | Ga0496118_0056320 | 3300048921 | Bacteria | 2957 |
| 598 | Ga0496118_0183043 | 3300048921 | Bacteria | 1263 |
| 599 | Ga0496121_0004428 | 3300048924 | Bacteria | 18910 |
| 600 | Ga0496121_0014480 | 3300048924 | Bacteria | 8363 |
| 601 | Ga0496121_0025046 | 3300048924 | Bacteria | 5680 |
| 602 | Ga0496122_0000702 | 3300048925 | Bacteria | 66240 |
| 603 | Ga0496122_0010843 | 3300048925 | Bacteria | 9330 |
| 604 | Ga0496122_0017535 | 3300048925 | Bacteria | 6688 |
| 605 | Ga0496122_0097126 | 3300048925 | Bacteria | 1983 |
| 606 | Ga0496123_0000914 | 3300048926 | Bacteria | 46373 |
| 607 | Ga0496123_0061160 | 3300048926 | Bacteria | 2422 |
| 608 | Ga0496124_0000374 | 3300048927 | Bacteria | 81451 |
| 609 | Ga0496124_0008549 | 3300048927 | Bacteria | 10687 |
| 610 | Ga0496124_0025049 | 3300048927 | Bacteria | 5410 |
| 611 | Ga0496124_0034344 | 3300048927 | Bacteria | 4452 |
| 612 | Ga0496124_0095884 | 3300048927 | Bacteria | 2410 |
| 613 | Ga0496125_0000373 | 3300048928 | Bacteria | 84239 |
| 614 | Ga0496125_0007575 | 3300048928 | Bacteria | 11530 |
| 615 | Ga0496125_0030387 | 3300048928 | Bacteria | 4834 |
| 616 | Ga0496126_0000512 | 3300048929 | Bacteria | 75587 |
| 617 | Ga0496126_0022194 | 3300048929 | Bacteria | 6181 |
| 618 | Ga0496126_0053896 | 3300048929 | Bacteria | 3646 |
| 619 | Ga0496126_0072905 | 3300048929 | Bacteria | 3053 |
| 620 | Ga0496126_0301825 | 3300048929 | Bacteria | 1321 |
| 621 | Ga0496126_0368496 | 3300048929 | Bacteria | 1172 |
| 622 | Ga0501033_0000059 | 3300049570 | Bacteria | 105311 |
| 623 | Ga0501035_0000213 | 3300049822 | Bacteria | 69670 |
| 624 | nmdc:mga03683_24869_c1 | 3300050489 | Bacteria | 2346 |
| 625 | nmdc:mga03683_2_c1 | 3300050489 | Bacteria | 289140 |
| 626 | nmdc:mga03683_48550_c1 | 3300050489 | Bacteria | 1764 |
| 627 | nmdc:mga03n38_1707_c1 | 3300050490 | Bacteria | 6471 |
| 628 | nmdc:mga0k408_2_c1 | 3300050493 | Bacteria | 395671 |
| 629 | nmdc:mga0k408_84305_c1 | 3300050493 | Bacteria | 1864 |
| 630 | nmdc:mga0k408_85160_c1 | 3300050493 | Bacteria | 1855 |
| 631 | nmdc:mga0sz30_3405_c2 | 3300050516 | Bacteria | 3961 |
| 632 | Ga0500635_0001737 | 3300053080 | Bacteria | 5300 |
| 633 | Ga0500643_000162 | 3300053087 | Bacteria | 66736 |
| 634 | Ga0500643_020651 | 3300053087 | Bacteria | 2148 |
| 635 | Ga0500562_000306 | 3300053108 | Bacteria | 11974 |
| 636 | Ga0500562_004347 | 3300053108 | Bacteria | 3586 |
| 637 | Ga0500594_0004429 | 3300053118 | Bacteria | 3095 |
| 638 | Ga0500594_0007498 | 3300053118 | Bacteria | 2469 |
| 639 | Ga0500594_0056774 | 3300053118 | Bacteria | 1117 |
| 640 | Ga0500595_021185 | 3300053119 | Bacteria | 2324 |
| 641 | Ga0500597_009023 | 3300053120 | Bacteria | 3486 |
| 642 | Ga0500607_000045 | 3300053121 | Bacteria | 84084 |
| 643 | Ga0500618_000993 | 3300053125 | Bacteria | 14349 |
| 644 | Ga0500618_001122 | 3300053125 | Bacteria | 13055 |
| 645 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 646 | Ga0500559_0002057 | 3300053136 | Bacteria | 10771 |
| 647 | Ga0500559_0012209 | 3300053136 | Bacteria | 3655 |
| 648 | Ga0500559_0022654 | 3300053136 | Bacteria | 2664 |
| 649 | Ga0500559_0027306 | 3300053136 | Bacteria | 2436 |
| 650 | Ga0500564_001755 | 3300053138 | Bacteria | 7674 |
| 651 | Ga0500624_000098 | 3300053157 | Bacteria | 42544 |
| 652 | Ga0500636_0064800 | 3300053177 | Bacteria | 2128 |
| 653 | Ga0500637_0000055 | 3300053178 | Bacteria | 42526 |
| 654 | Ga0500637_0029458 | 3300053178 | Bacteria | 3045 |
| 655 | Ga0500567_001363 | 3300053723 | Bacteria | 9772 |
| 656 | Ga0500625_000012 | 3300053729 | Bacteria | 127269 |
| 657 | Ga0500645_017281 | 3300053730 | Bacteria | 2263 |
| 658 | 2585263466 | 2582581305 | Bacteria | 4895574 |
| 659 | 2585264107 | 2582581305 | Bacteria | 4895574 |
| 660 | 2600226176 | 2599185359 | Bacteria | 4772316 |
| 661 | 2643814998 | 2643221558 | Bacteria | 5460675 |
| 662 | 2738710778 | 2738541275 | Bacteria | 4830863 |
| 663 | 2738712967 | 2738541275 | Bacteria | 4830863 |
| 664 | 2738849203 | 2738541301 | Bacteria | 4834102 |
| 665 | 2738851391 | 2738541301 | Bacteria | 4834102 |
| 666 | 2738864932 | 2738541304 | Bacteria | 4833665 |
| 667 | 2738867121 | 2738541304 | Bacteria | 4833665 |
| 668 | 2739297450 | 2738543022 | Bacteria | 4835059 |
| 669 | 2739299638 | 2738543022 | Bacteria | 4835059 |
| 670 | 2739359128 | 2738543033 | Bacteria | 4833336 |
| 671 | 2739361317 | 2738543033 | Bacteria | 4833336 |
| 672 | 2739650244 | 2739367664 | Bacteria | 4114334 |
| 673 | 2740028717 | 2739367865 | Bacteria | 4114482 |
| 674 | 2753763571 | 2751185897 | Bacteria | 5322941 |
| 675 | 2819555468 | 2818991438 | Bacteria | 5793701 |
| 676 | 2896187030 | 2896184354 | Bacteria | 3258548 |
| 677 | 2919139512 | 2919138771 | Bacteria | 5281312 |
| 678 | 2919139549 | 2919138771 | Bacteria | 5281312 |
| 679 | 2919709961 | 2919709256 | Bacteria | 4318106 |
| 680 | 2928100880 | 2928100450 | Bacteria | 4837635 |
| 681 | 2928103578 | 2928100450 | Bacteria | 4837635 |
| 682 | 2928962287 | 2928959182 | Bacteria | 4725774 |
| 683 | 2928963277 | 2928959182 | Bacteria | 4725774 |
| 684 | 3000867523 | 3000865235 | Bacteria | 3106258 |
| 685 | 8002747221 | 8002745576 | Bacteria | 4840272 |
| 686 | 8055432559 | 8055431914 | Bacteria | 4551896 |
| 687 | 8057102197 | 8057101203 | Bacteria | 5034064 |
| 688 | Ga0495633_0000470 | |||
| 689 | JGI24736J21556_1000219 | |||
| 690 | JGI24741J21665_1000021 | |||
| 691 | JGI24741J21665_1000068 | |||
| 692 | JGI24741J21665_1000106 | |||
| 693 | JGI24741J21665_1000204 | |||
| 694 | JGI24741J21665_1001619 | |||
| 695 | JGI24740J21852_10000043 | |||
| 696 | JGI24740J21852_10001202 | |||
| 697 | JGI24740J21852_10001360 | |||
| 698 | JGI24740J21852_10004146 | |||
| 699 | JGI24740J21852_10007599 | |||
| 700 | JGI24739J22299_10001257 | |||
| 701 | JGI24739J22299_10003195 | |||
| 702 | JGI24739J22299_10007955 | |||
| 703 | JGI24739J22299_10017169 | |||
| 704 | JGI24737J22298_10000054 | |||
| 705 | JGI24737J22298_10000947 | |||
| 706 | JGI24737J22298_10001005 | |||
| 707 | JGI24737J22298_10001250 | |||
| 708 | JGI24737J22298_10003837 | |||
| 709 | JGI24737J22298_10012428 | |||
| 710 | JGI24737J22298_10022508 | |||
| 711 | JGI24735J21928_10001235 | |||
| 712 | JGI24735J21928_10003256 | |||
| 713 | JGI24735J21928_10010665 | |||
| 714 | JGI24738J21930_10000887 | |||
| 715 | JGI24738J21930_10004705 | |||
| 716 | JGI24744J21845_10004568 | |||
| 717 | JGI25153J46596_10000005 | |||
| 718 | rootH1_10058872 | |||
| 719 | rootL2_10060416 | |||
| 720 | rootL2_10095669 | |||
| 721 | rootL2_10165326 | |||
| 722 | rootL2_10201879 | |||
| 723 | rootH1_10113965 | |||
| 724 | Ga0055530_10028273 | |||
| 725 | Ga0065704_10098629 | |||
| 726 | Ga0070658_10000167 | |||
| 727 | Ga0070658_10000180 | |||
| 728 | Ga0070658_10000937 | |||
| 729 | Ga0070658_10080612 | |||
| 730 | Ga0070658_10153838 | |||
| 731 | Ga0070658_10167781 | |||
| 732 | Ga0070658_10287692 | |||
| 733 | Ga0070676_10023574 | |||
| 734 | Ga0070676_10210184 | |||
| 735 | Ga0070683_100105391 | |||
| 736 | Ga0070683_100133055 | |||
| 737 | Ga0070670_100008343 | |||
| 738 | Ga0070670_100036548 | |||
| 739 | Ga0070670_100117660 | |||
| 740 | Ga0070677_10033610 | |||
| 741 | Ga0068869_100025861 | |||
| 742 | Ga0070666_10036790 | |||
| 743 | Ga0070666_10072946 | |||
| 744 | Ga0070666_10077232 | |||
| 745 | Ga0070666_10086650 | |||
| 746 | Ga0070680_100000486 | |||
| 747 | Ga0070660_100005124 | |||
| 748 | Ga0070660_100014169 | |||
| 749 | Ga0070660_100121065 | |||
| 750 | Ga0070689_100030340 | |||
| 751 | Ga0070691_10017513 | |||
| 752 | Ga0070687_100079499 | |||
| 753 | Ga0070661_100002081 | |||
| 754 | Ga0070661_100015978 | |||
| 755 | Ga0070661_100016878 | |||
| 756 | Ga0070661_100056982 | |||
| 757 | Ga0070661_100081024 | |||
| 758 | Ga0070661_100111753 | |||
| 759 | Ga0070661_100117773 | |||
| 760 | Ga0070661_100136144 | |||
| 761 | Ga0070668_100016788 | |||
| 762 | Ga0070669_100034151 | |||
| 763 | Ga0070675_100017384 | |||
| 764 | Ga0070675_100064017 | |||
| 765 | Ga0070675_100072390 | |||
| 766 | Ga0070671_100011172 | |||
| 767 | Ga0070671_100011225 | |||
| 768 | Ga0070671_100091423 | |||
| 769 | Ga0070671_100121933 | |||
| 770 | Ga0070674_100000078 | |||
| 771 | Ga0070674_100003725 | |||
| 772 | Ga0070673_100007256 | |||
| 773 | Ga0070673_100026968 | |||
| 774 | Ga0070673_100082551 | |||
| 775 | Ga0070673_100087594 | |||
| 776 | Ga0070688_100056433 | |||
| 777 | Ga0070688_100062645 | |||
| 778 | Ga0070659_100000573 | |||
| 779 | Ga0070659_100008652 | |||
| 780 | Ga0070659_100057839 | |||
| 781 | Ga0070659_100309891 | |||
| 782 | Ga0070667_100012614 | |||
| 783 | Ga0070667_100210924 | |||
| 784 | Ga0070663_100000203 | |||
| 785 | Ga0070663_100005836 | |||
| 786 | Ga0070663_100017206 | |||
| 787 | Ga0070663_100028464 | |||
| 788 | Ga0070663_100032188 | |||
| 789 | Ga0070663_100038387 | |||
| 790 | Ga0070663_100038633 | |||
| 791 | Ga0070678_100000005 | |||
| 792 | Ga0070678_100012235 | |||
| 793 | Ga0070678_100032869 | |||
| 794 | Ga0070678_100107199 | |||
| 795 | Ga0070662_100031732 | |||
| 796 | Ga0070662_100032403 | |||
| 797 | Ga0070662_100036683 | |||
| 798 | Ga0070662_100040872 | |||
| 799 | Ga0070662_100176791 | |||
| 800 | Ga0070681_10000836 | |||
| 801 | Ga0070685_10018913 | |||
| 802 | Ga0070679_100002376 | |||
| 803 | Ga0068853_100134268 | |||
| 804 | Ga0068853_100139822 | |||
| 805 | Ga0068853_100377060 | |||
| 806 | Ga0070672_100000872 | |||
| 807 | Ga0070672_100049640 | |||
| 808 | Ga0070672_100086646 | |||
| 809 | Ga0070672_100284434 | |||
| 810 | Ga0070686_100099367 | |||
| 811 | Ga0070665_100036260 | |||
| 812 | Ga0068855_100019318 | |||
| 813 | Ga0068855_100035976 | |||
| 814 | Ga0068855_100083107 | |||
| 815 | Ga0068855_100116698 | |||
| 816 | Ga0068855_100123559 | |||
| 817 | Ga0068855_100133497 | |||
| 818 | Ga0070664_100005524 | |||
| 819 | Ga0070664_100007441 | |||
| 820 | Ga0070664_100012745 | |||
| 821 | Ga0070664_100020156 | |||
| 822 | Ga0070664_100033301 | |||
| 823 | Ga0070664_100109707 | |||
| 824 | Ga0070664_100195369 | |||
| 825 | Ga0068857_100030321 | |||
| 826 | Ga0068857_100030580 | |||
| 827 | Ga0068857_100152583 | |||
| 828 | Ga0068857_100156240 | |||
| 829 | Ga0068857_100237952 | |||
| 830 | Ga0068854_100026091 | |||
| 831 | Ga0068854_100032228 | |||
| 832 | Ga0068854_100082980 | |||
| 833 | Ga0068854_100130047 | |||
| 834 | Ga0068854_100211949 | |||
| 835 | Ga0068856_100032979 | |||
| 836 | Ga0068856_100072774 | |||
| 837 | Ga0068856_100078026 | |||
| 838 | Ga0068856_100148208 | |||
| 839 | Ga0068856_100165658 | |||
| 840 | Ga0068856_100241538 | |||
| 841 | Ga0068852_100006804 | |||
| 842 | Ga0068852_100136243 | |||
| 843 | Ga0068852_100138971 | |||
| 844 | Ga0068852_100286635 | |||
| 845 | Ga0068859_100055972 | |||
| 846 | Ga0068859_100108799 | |||
| 847 | Ga0068864_100063466 | |||
| 848 | Ga0068864_100245242 | |||
| 849 | Ga0068864_100401156 | |||
| 850 | Ga0068861_100000085 | |||
| 851 | Ga0068861_100298297 | |||
| 852 | Ga0068861_100369219 | |||
| 853 | Ga0068851_10004933 | |||
| 854 | Ga0068851_10007046 | |||
| 855 | Ga0068851_10044065 | |||
| 856 | Ga0068870_10131776 | |||
| 857 | Ga0068863_100038607 | |||
| 858 | Ga0068863_100336005 | |||
| 859 | Ga0068863_100523626 | |||
| 860 | Ga0068858_100000310 | |||
| 861 | Ga0068860_100002446 | |||
| 862 | Ga0068860_100230210 | |||
| 863 | Ga0068862_100000699 | |||
| 864 | Ga0081539_10000001 | |||
| 865 | Ga0075432_10003783 | |||
| 866 | Ga0075432_10011066 | |||
| 867 | Ga0075362_10000040 | |||
| 868 | Ga0075362_10082446 | |||
| 869 | Ga0075366_10021460 | |||
| 870 | Ga0097621_100004748 | |||
| 871 | Ga0097621_100186645 | |||
| 872 | Ga0075370_10036614 | |||
| 873 | Ga0075370_10042480 | |||
| 874 | Ga0068871_100013227 | |||
| 875 | Ga0068871_100330004 | |||
| 876 | Ga0097620_100055973 | |||
| 877 | Ga0097620_100108791 | |||
| 878 | Ga0105251_10001809 | |||
| 879 | Ga0105240_10000121 | |||
| 880 | Ga0105240_10082383 | |||
| 881 | Ga0105240_10097190 | |||
| 882 | Ga0105240_10211402 | |||
| 883 | Ga0105240_10509329 | |||
| 884 | Ga0105240_10708390 | |||
| 885 | Ga0105245_10001044 | |||
| 886 | Ga0105247_10001062 | |||
| 887 | Ga0105243_10000030 | |||
| 888 | Ga0105243_10054917 | |||
| 889 | Ga0105241_10000799 | |||
| 890 | Ga0105241_10000903 | |||
| 891 | Ga0105241_10017577 | |||
| 892 | Ga0105241_10177281 | |||
| 893 | Ga0105241_10217077 | |||
| 894 | Ga0105248_10015048 | |||
| 895 | Ga0105248_10055553 | |||
| 896 | Ga0105248_10233496 | |||
| 897 | Ga0105237_10055147 | |||
| 898 | Ga0105237_10361523 | |||
| 899 | Ga0105238_10007472 | |||
| 900 | Ga0105238_10021395 | |||
| 901 | Ga0105238_10076399 | |||
| 902 | Ga0105249_10000196 | |||
| 903 | Ga0105249_10033714 | |||
| 904 | Ga0105239_10005768 | |||
| 905 | Ga0105239_10061342 | |||
| 906 | Ga0105239_10166688 | |||
| 907 | Ga0105239_10267262 | |||
| 908 | Ga0105239_10404293 | |||
| 909 | Ga0105246_10263859 | |||
| 910 | Ga0157373_10018661 | |||
| 911 | Ga0157373_10019281 | |||
| 912 | Ga0157373_10057484 | |||
| 913 | Ga0157373_10127119 | |||
| 914 | Ga0157373_10280132 | |||
| 915 | Ga0157371_10000111 | |||
| 916 | Ga0157371_10000757 | |||
| 917 | Ga0157371_10009942 | |||
| 918 | Ga0157370_10042645 | |||
| 919 | Ga0157369_10071138 | |||
| 920 | Ga0157369_10081176 | |||
| 921 | Ga0157369_10129916 | |||
| 922 | Ga0157374_10167170 | |||
| 923 | Ga0163162_10131849 | |||
| 924 | Ga0163162_10295572 | |||
| 925 | Ga0157372_10115387 | |||
| 926 | Ga0157372_10165991 | |||
| 927 | Ga0157372_10204213 | |||
| 928 | Ga0157372_10217348 | |||
| 929 | Ga0157372_10405894 | |||
| 930 | Ga0157375_10037462 | |||
| 931 | Ga0157375_10252678 | |||
| 932 | Ga0163163_10016474 | |||
| 933 | Ga0157380_10126611 | |||
| 934 | Ga0157380_10147364 | |||
| 935 | Ga0157377_10006308 | |||
| 936 | Ga0157379_10129206 | |||
| 937 | Ga0157376_10235690 | |||
| 938 | Ga0163161_10002180 | |||
| 939 | Ga0163161_10016322 | |||
| 940 | Ga0163161_10151988 | |||
| 941 | Ga0163161_10209132 | |||
| 942 | Ga0213872_10041975 | |||
| 943 | Ga0213872_10084398 | |||
| 944 | Ga0209147_100763 | |||
| 945 | Ga0209455_1010049 | |||
| 946 | Ga0209758_1000001 | |||
| 947 | Ga0209050_1001048 | |||
| 948 | Ga0209050_1016290 | |||
| 949 | Ga0207656_10004092 | |||
| 950 | Ga0207656_10012645 | |||
| 951 | Ga0207656_10018676 | |||
| 952 | Ga0207656_10029633 | |||
| 953 | Ga0207656_10037068 | |||
| 954 | Ga0207656_10038474 | |||
| 955 | Ga0207682_10006701 | |||
| 956 | Ga0207710_10006828 | |||
| 957 | Ga0207680_10019437 | |||
| 958 | Ga0207680_10082882 | |||
| 959 | Ga0207647_10002614 | |||
| 960 | Ga0207647_10013943 | |||
| 961 | Ga0207647_10027409 | |||
| 962 | Ga0207647_10067164 | |||
| 963 | Ga0207647_10082511 | |||
| 964 | Ga0207647_10103528 | |||
| 965 | Ga0207645_10029241 | |||
| 966 | Ga0207643_10132844 | |||
| 967 | Ga0207705_10000004 | |||
| 968 | Ga0207705_10000157 | |||
| 969 | Ga0207705_10000228 | |||
| 970 | Ga0207705_10000784 | |||
| 971 | Ga0207654_10001685 | |||
| 972 | Ga0207654_10002302 | |||
| 973 | Ga0207654_10024069 | |||
| 974 | Ga0207654_10040965 | |||
| 975 | Ga0207654_10048834 | |||
| 976 | Ga0207707_10006188 | |||
| 977 | Ga0207695_10000006 | |||
| 978 | Ga0207695_10007333 | |||
| 979 | Ga0207695_10010978 | |||
| 980 | Ga0207695_10027051 | |||
| 981 | Ga0207695_10087375 | |||
| 982 | Ga0207695_10108153 | |||
| 983 | Ga0207695_10255720 | |||
| 984 | Ga0207671_10003767 | |||
| 985 | Ga0207671_10004267 | |||
| 986 | Ga0207671_10006621 | |||
| 987 | Ga0207671_10120423 | |||
| 988 | Ga0207660_10004609 | |||
| 989 | Ga0207662_10182485 | |||
| 990 | Ga0207657_10000465 | |||
| 991 | Ga0207657_10001164 | |||
| 992 | Ga0207657_10001229 | |||
| 993 | Ga0207657_10009609 | |||
| 994 | Ga0207657_10010580 | |||
| 995 | Ga0207657_10014853 | |||
| 996 | Ga0207649_10001601 | |||
| 997 | Ga0207649_10003068 | |||
| 998 | Ga0207649_10010980 | |||
| 999 | Ga0207649_10098820 | |||
| 1000 | Ga0207652_10018418 | |||
| 1001 | Ga0207681_10062976 | |||
| 1002 | Ga0207694_10009999 | |||
| 1003 | Ga0207694_10031707 | |||
| 1004 | Ga0207694_10049311 | |||
| 1005 | Ga0207694_10090041 | |||
| 1006 | Ga0207694_10112313 | |||
| 1007 | Ga0207650_10016772 | |||
| 1008 | Ga0207650_10096157 | |||
| 1009 | Ga0207659_10007271 | |||
| 1010 | Ga0207659_10065719 | |||
| 1011 | Ga0207687_10002747 | |||
| 1012 | Ga0207644_10021555 | |||
| 1013 | Ga0207690_10000368 | |||
| 1014 | Ga0207690_10001385 | |||
| 1015 | Ga0207690_10003924 | |||
| 1016 | Ga0207690_10299924 | |||
| 1017 | Ga0207706_10001587 | |||
| 1018 | Ga0207706_10022833 | |||
| 1019 | Ga0207706_10024381 | |||
| 1020 | Ga0207706_10041335 | |||
| 1021 | Ga0207706_10041697 | |||
| 1022 | Ga0207706_10042913 | |||
| 1023 | Ga0207706_10180760 | |||
| 1024 | Ga0207709_10000137 | |||
| 1025 | Ga0207670_10015539 | |||
| 1026 | Ga0207669_10000093 | |||
| 1027 | Ga0207669_10003436 | |||
| 1028 | Ga0207691_10005079 | |||
| 1029 | Ga0207691_10026614 | |||
| 1030 | Ga0207691_10096866 | |||
| 1031 | Ga0207711_10008752 | |||
| 1032 | Ga0207711_10024045 | |||
| 1033 | Ga0207689_10036853 | |||
| 1034 | Ga0207679_10000640 | |||
| 1035 | Ga0207679_10054153 | |||
| 1036 | Ga0207679_10100615 | |||
| 1037 | Ga0207679_10124169 | |||
| 1038 | Ga0207679_10160530 | |||
| 1039 | Ga0207679_10334451 | |||
| 1040 | Ga0207667_10000004 | |||
| 1041 | Ga0207667_10000006 | |||
| 1042 | Ga0207667_10002681 | |||
| 1043 | Ga0207667_10016478 | |||
| 1044 | Ga0207667_10051010 | |||
| 1045 | Ga0207667_10056466 | |||
| 1046 | Ga0207667_10088965 | |||
| 1047 | Ga0207667_10120298 | |||
| 1048 | Ga0207651_10002413 | |||
| 1049 | Ga0207651_10002469 | |||
| 1050 | Ga0207651_10065019 | |||
| 1051 | Ga0207712_10000015 | |||
| 1052 | Ga0207668_10005778 | |||
| 1053 | Ga0207640_10005079 | |||
| 1054 | Ga0207640_10028932 | |||
| 1055 | Ga0207640_10071113 | |||
| 1056 | Ga0207640_10222105 | |||
| 1057 | Ga0207658_10056441 | |||
| 1058 | Ga0207703_10000757 | |||
| 1059 | Ga0207639_10000160 | |||
| 1060 | Ga0207639_10000185 | |||
| 1061 | Ga0207639_10001020 | |||
| 1062 | Ga0207639_10013092 | |||
| 1063 | Ga0207639_10050242 | |||
| 1064 | Ga0207639_10065385 | |||
| 1065 | Ga0207639_10125066 | |||
| 1066 | Ga0207639_10261251 | |||
| 1067 | Ga0207678_10000083 | |||
| 1068 | Ga0207678_10000491 | |||
| 1069 | Ga0207678_10000545 | |||
| 1070 | Ga0207678_10000801 | |||
| 1071 | Ga0207678_10008944 | |||
| 1072 | Ga0207678_10053121 | |||
| 1073 | Ga0207678_10089483 | |||
| 1074 | Ga0207678_10121804 | |||
| 1075 | Ga0207702_10004461 | |||
| 1076 | Ga0207702_10004499 | |||
| 1077 | Ga0207702_10009174 | |||
| 1078 | Ga0207702_10009706 | |||
| 1079 | Ga0207702_10016210 | |||
| 1080 | Ga0207702_10118736 | |||
| 1081 | Ga0207702_10323644 | |||
| 1082 | Ga0207702_10395284 | |||
| 1083 | Ga0207641_10001505 | |||
| 1084 | Ga0207641_10052577 | |||
| 1085 | Ga0207648_10044737 | |||
| 1086 | Ga0207676_10054692 | |||
| 1087 | Ga0207676_10145144 | |||
| 1088 | Ga0207676_10317648 | |||
| 1089 | Ga0207674_10017103 | |||
| 1090 | Ga0207674_10031539 | |||
| 1091 | Ga0207674_10033636 | |||
| 1092 | Ga0207674_10085338 | |||
| 1093 | Ga0207674_10138473 | |||
| 1094 | Ga0207674_10141171 | |||
| 1095 | Ga0207674_10446228 | |||
| 1096 | Ga0207675_100000012 | |||
| 1097 | Ga0207675_100255201 | |||
| 1098 | Ga0207683_10000115 | |||
| 1099 | Ga0207683_10053762 | |||
| 1100 | Ga0207683_10141231 | |||
| 1101 | Ga0207698_10000019 | |||
| 1102 | Ga0207698_10003456 | |||
| 1103 | Ga0207698_10007180 | |||
| 1104 | Ga0207698_10011849 | |||
| 1105 | Ga0207698_10018236 | |||
| 1106 | Ga0207698_10041531 | |||
| 1107 | Ga0207698_10077164 | |||
| 1108 | Ga0207698_10153584 | |||
| 1109 | Ga0207428_10013576 | |||
| 1110 | Ga0207428_10096876 | |||
| 1111 | Ga0268266_10119155 | |||
| 1112 | Ga0268266_10122130 | |||
| 1113 | Ga0268265_10000658 | |||
| 1114 | Ga0268264_10002774 | |||
| 1115 | Ga0268264_10028752 | |||
| 1116 | Ga0268264_10219456 | |||
| 1117 | Ga0265334_10019913 | |||
| 1118 | Ga0307515_10051473 | |||
| 1119 | Ga0307515_10140118 | |||
| 1120 | Ga0265338_10008334 | |||
| 1121 | Ga0265338_10026416 | |||
| 1122 | Ga0265338_10059595 | |||
| 1123 | Ga0265340_10019040 | |||
| 1124 | Ga0265340_10028348 | |||
| 1125 | Ga0265327_10002198 | |||
| 1126 | Ga0307513_10000034 | |||
| 1127 | Ga0307513_10057878 | |||
| 1128 | Ga0307513_10090272 | |||
| 1129 | Ga0307509_10232840 | |||
| 1130 | Ga0307408_100055766 | |||
| 1131 | Ga0307408_100079323 | |||
| 1132 | Ga0307508_10025651 | |||
| 1133 | Ga0265314_10036108 | |||
| 1134 | Ga0307405_10062371 | |||
| 1135 | Ga0307405_10062434 | |||
| 1136 | Ga0307413_10051151 | |||
| 1137 | Ga0307413_10113942 | |||
| 1138 | Ga0307406_10051052 | |||
| 1139 | Ga0307406_10064151 | |||
| 1140 | Ga0307407_10206864 | |||
| 1141 | Ga0307412_10035794 | |||
| 1142 | Ga0307412_10077360 | |||
| 1143 | Ga0307412_10099599 | |||
| 1144 | Ga0307412_10101111 | |||
| 1145 | Ga0307412_10144528 | |||
| 1146 | Ga0307409_100053268 | |||
| 1147 | Ga0307409_100209284 | |||
| 1148 | Ga0307409_100375577 | |||
| 1149 | Ga0307416_100025913 | |||
| 1150 | Ga0307414_10003631 | |||
| 1151 | Ga0307414_10012568 | |||
| 1152 | Ga0307414_10154722 | |||
| 1153 | Ga0307414_10263110 | |||
| 1154 | Ga0307411_10204174 | |||
| 1155 | Ga0307510_10002596 | |||
| 1156 | Ga0373931_0024623 | |||
| 1157 | Ga0373935_0027934 | |||
| 1158 | Ga0373927_0001162 | |||
| 1159 | Ga0316582_0000197 | |||
| 1160 | Ga0316584_0092524 | |||
| 1161 | Ga0316584_0213817 | |||
| 1162 | Ga0373925_0000991 | |||
| 1163 | Ga0400483_048519 | |||
| 1164 | Ga0400483_050097 | |||
| 1165 | Ga0400483_161893 | |||
| 1166 | Ga0436361_0812819 | |||
| 1167 | Ga0439443_004810 | |||
| 1168 | Ga0439435_0018676 | |||
| 1169 | Ga0466972_0020132 | |||
| 1170 | Ga0466966_0032567 | |||
| 1171 | Ga0466961_0091244 | |||
| 1172 | Ga0466960_0086101 | |||
| 1173 | Ga0466959_0039932 | |||
| 1174 | Ga0451576_0001437 | |||
| 1175 | Ga0451576_0051839 | |||
| 1176 | Ga0466958_0000355 | |||
| 1177 | Ga0466958_0036857 | |||
| 1178 | Ga0495627_000305 | |||
| 1179 | Ga0495627_000520 | |||
| 1180 | Ga0495627_000804 | |||
| 1181 | Ga0495627_033046 | |||
| 1182 | Ga0495603_0166890 | |||
| 1183 | Ga0495638_0000024 | |||
| 1184 | Ga0495638_0000074 | |||
| 1185 | Ga0495650_0000325 | |||
| 1186 | Ga0495650_0001824 | |||
| 1187 | Ga0495650_0073563 | |||
| 1188 | Ga0495584_0053281 | |||
| 1189 | Ga0495584_0194802 | |||
| 1190 | Ga0495585_0000339 | |||
| 1191 | Ga0495585_0001102 | |||
| 1192 | Ga0495585_0044720 | |||
| 1193 | Ga0495585_0104795 | |||
| 1194 | Ga0495585_0127167 | |||
| 1195 | Ga0495594_0051755 | |||
| 1196 | Ga0495596_0000136 | |||
| 1197 | Ga0495596_0000187 | |||
| 1198 | Ga0495596_0001732 | |||
| 1199 | Ga0495596_0002742 | |||
| 1200 | Ga0495583_0000275 | |||
| 1201 | Ga0495583_0000527 | |||
| 1202 | Ga0495583_0022408 | |||
| 1203 | Ga0495606_0027879 | |||
| 1204 | Ga0495610_0000034 | |||
| 1205 | Ga0495610_0002224 | |||
| 1206 | Ga0495610_0003976 | |||
| 1207 | Ga0495610_0005525 | |||
| 1208 | Ga0495610_0026473 | |||
| 1209 | Ga0495610_0042899 | |||
| 1210 | Ga0495610_0052989 | |||
| 1211 | Ga0495620_0001019 | |||
| 1212 | Ga0495632_0000001 | |||
| 1213 | Ga0495632_0000053 | |||
| 1214 | Ga0495632_0000498 | |||
| 1215 | Ga0495632_0000813 | |||
| 1216 | Ga0495632_0006591 | |||
| 1217 | Ga0495632_0070173 | |||
| 1218 | Ga0495637_0000717 | |||
| 1219 | Ga0495637_0000826 | |||
| 1220 | Ga0495637_0000850 | |||
| 1221 | Ga0495643_0000006 | |||
| 1222 | Ga0495643_0000020 | |||
| 1223 | Ga0495643_0000061 | |||
| 1224 | Ga0495643_0000859 | |||
| 1225 | Ga0495643_0001729 | |||
| 1226 | Ga0495643_0071188 | |||
| 1227 | Ga0495643_0099853 | |||
| 1228 | Ga0495648_0000005 | |||
| 1229 | Ga0495648_0000050 | |||
| 1230 | Ga0495648_0000051 | |||
| 1231 | Ga0495648_0005515 | |||
| 1232 | Ga0495648_0006642 | |||
| 1233 | Ga0495648_0030955 | |||
| 1234 | Ga0495648_0039517 | |||
| 1235 | Ga0495663_0000002 | |||
| 1236 | Ga0495663_0000012 | |||
| 1237 | Ga0495654_0025597 | |||
| 1238 | Ga0495654_0061125 | |||
| 1239 | Ga0495622_0042546 | |||
| 1240 | Ga0495633_0000208 | |||
| 1241 | Ga0495633_0000312 | |||
| 1242 | Ga0495633_0000413 | |||
| 1243 | Ga0495633_0004138 | |||
| 1244 | Ga0495633_0013178 | |||
| 1245 | Ga0495633_0034785 | |||
| 1246 | Ga0495625_0010009 | |||
| 1247 | Ga0495625_0032733 | |||
| 1248 | Ga0495625_0225685 | |||
| 1249 | Ga0495671_0000008 | |||
| 1250 | Ga0495671_0000016 | |||
| 1251 | Ga0495671_0000036 | |||
| 1252 | Ga0495671_0000096 | |||
| 1253 | Ga0495671_0000187 | |||
| 1254 | Ga0495671_0010581 | |||
| 1255 | Ga0495671_0017625 | |||
| 1256 | Ga0495673_0000157 | |||
| 1257 | Ga0495673_0000365 | |||
| 1258 | Ga0495681_0000037 | |||
| 1259 | Ga0495681_0000208 | |||
| 1260 | Ga0495681_0000437 | |||
| 1261 | Ga0495681_0001363 | |||
| 1262 | Ga0495681_0002391 | |||
| 1263 | Ga0495686_0009263 | |||
| 1264 | Ga0495686_0069693 | |||
| 1265 | Ga0495686_0078788 | |||
| 1266 | Ga0495686_0191365 | |||
| 1267 | Ga0495615_0000002 | |||
| 1268 | Ga0495626_0000852 | |||
| 1269 | Ga0496102_0164084 | |||
| 1270 | Ga0496109_0114978 | |||
| 1271 | Ga0496109_0146367 | |||
| 1272 | Ga0496110_0053470 | |||
| 1273 | Ga0496111_0058545 | |||
| 1274 | Ga0496113_0036418 | |||
| 1275 | Ga0496114_0006351 | |||
| 1276 | Ga0496116_0000093 | |||
| 1277 | Ga0496116_0019366 | |||
| 1278 | Ga0496117_0057598 | |||
| 1279 | Ga0496117_0062063 | |||
| 1280 | Ga0496117_0125437 | |||
| 1281 | Ga0496118_0004744 | |||
| 1282 | Ga0496118_0005210 | |||
| 1283 | Ga0496118_0033605 | |||
| 1284 | Ga0496118_0056320 | |||
| 1285 | Ga0496118_0183043 | |||
| 1286 | Ga0496121_0004428 | |||
| 1287 | Ga0496121_0014480 | |||
| 1288 | Ga0496121_0025046 | |||
| 1289 | Ga0496122_0000702 | |||
| 1290 | Ga0496122_0010843 | |||
| 1291 | Ga0496122_0017535 | |||
| 1292 | Ga0496122_0097126 | |||
| 1293 | Ga0496123_0000914 | |||
| 1294 | Ga0496123_0061160 | |||
| 1295 | Ga0496124_0000374 | |||
| 1296 | Ga0496124_0008549 | |||
| 1297 | Ga0496124_0025049 | |||
| 1298 | Ga0496124_0034344 | |||
| 1299 | Ga0496124_0095884 | |||
| 1300 | Ga0496125_0000373 | |||
| 1301 | Ga0496125_0007575 | |||
| 1302 | Ga0496125_0030387 | |||
| 1303 | Ga0496126_0000512 | |||
| 1304 | Ga0496126_0022194 | |||
| 1305 | Ga0496126_0053896 | |||
| 1306 | Ga0496126_0072905 | |||
| 1307 | Ga0496126_0301825 | |||
| 1308 | Ga0496126_0368496 | |||
| 1309 | Ga0501033_0000059 | |||
| 1310 | Ga0501035_0000213 | |||
| 1311 | nmdc:mga03683_24869_c1 | |||
| 1312 | nmdc:mga03683_2_c1 | |||
| 1313 | nmdc:mga03683_48550_c1 | |||
| 1314 | nmdc:mga03n38_1707_c1 | |||
| 1315 | nmdc:mga0k408_2_c1 | |||
| 1316 | nmdc:mga0k408_84305_c1 | |||
| 1317 | nmdc:mga0k408_85160_c1 | |||
| 1318 | nmdc:mga0sz30_3405_c2 | |||
| 1319 | Ga0500635_0001737 | |||
| 1320 | Ga0500643_000162 | |||
| 1321 | Ga0500643_020651 | |||
| 1322 | Ga0500562_000306 | |||
| 1323 | Ga0500562_004347 | |||
| 1324 | Ga0500594_0004429 | |||
| 1325 | Ga0500594_0007498 | |||
| 1326 | Ga0500594_0056774 | |||
| 1327 | Ga0500595_021185 | |||
| 1328 | Ga0500597_009023 | |||
| 1329 | Ga0500607_000045 | |||
| 1330 | Ga0500618_000993 | |||
| 1331 | Ga0500618_001122 | |||
| 1332 | Ga0500642_0000003 | |||
| 1333 | Ga0500559_0002057 | |||
| 1334 | Ga0500559_0012209 | |||
| 1335 | Ga0500559_0022654 | |||
| 1336 | Ga0500559_0027306 | |||
| 1337 | Ga0500564_001755 | |||
| 1338 | Ga0500624_000098 | |||
| 1339 | Ga0500636_0064800 | |||
| 1340 | Ga0500637_0000055 | |||
| 1341 | Ga0500637_0029458 | |||
| 1342 | Ga0500567_001363 | |||
| 1343 | Ga0500625_000012 | |||
| 1344 | Ga0500645_017281 | |||
| 1345 | 2585263466 | |||
| 1346 | 2585264107 | |||
| 1347 | 2600226176 | |||
| 1348 | 2643814998 | |||
| 1349 | 2738710778 | |||
| 1350 | 2738712967 | |||
| 1351 | 2738849203 | |||
| 1352 | 2738851391 | |||
| 1353 | 2738864932 | |||
| 1354 | 2738867121 | |||
| 1355 | 2739297450 | |||
| 1356 | 2739299638 | |||
| 1357 | 2739359128 | |||
| 1358 | 2739361317 | |||
| 1359 | 2739650244 | |||
| 1360 | 2740028717 | |||
| 1361 | 2753763571 | |||
| 1362 | 2819555468 | |||
| 1363 | 2896187030 | |||
| 1364 | 2919139512 | |||
| 1365 | 2919139549 | |||
| 1366 | 2919709961 | |||
| 1367 | 2928100880 | |||
| 1368 | 2928103578 | |||
| 1369 | 2928962287 | |||
| 1370 | 2928963277 | |||
| 1371 | 3000867523 | |||
| 1372 | 8002747221 | |||
| 1373 | 8055432559 | |||
| 1374 | 8057102197 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lzk-assembly1.cif.gz_B | the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 | 0.9726 | 1 | 322 |
| 3lzk-assembly1.cif.gz_B | the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 | 0.9579 | 1 | 322 |
| 6sbj-assembly1.cif.gz_B | x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed | 0.8603 | 76 | 321 |
| 1saw-assembly1.cif.gz_A | x-ray structure of homo sapiens protein flj36880 | 0.8579 | 76 | 322 |
| 6sbi-assembly2.cif.gz_C | x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate | 0.8557 | 76 | 321 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lzkB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9478 | 2 | 322 | 3.90.850.10 |
| 3lzkB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9307 | 2 | 322 | 3.90.850.10 |
| af_Q9VDE2_1_220_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8715 | 76 | 322 | 3.90.850.10 |
| 1wzoC02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8654 | 78 | 320 | 3.90.850.10 |
| af_P34673_5_211_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8629 | 76 | 315 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I4N1P0-F1-model_v4 | Hydrolase | 0.9886 | 1 | 323 |
GO:0016787
|
| AF-A0A520I8J2-F1-model_v4 | Fumarylacetoacetate hydrolase | 0.9878 | 1 | 325 |
GO:0003824
|
| AF-A0A1E4MBN2-F1-model_v4 | Fumarylacetoacetate hydrolase | 0.9871 | 22 | 321 |
GO:0016787
|
| AF-A0A7Z8LJX5-F1-model_v4 | deleted | 0.9866 | 1 | 321 |
|
| AF-A0A519KLD5-F1-model_v4 | Fumarylacetoacetate hydrolase | 0.9856 | 172 | 322 |
GO:0016787
|