F475491

General Info

Members Datasets Scaffolds Average Seq Length
690 205 690 308

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0256403|Ga0501082_0256403_424_1401
Length 325
Sequence MPAVSLSTDRPSRTRRPLVAESVLDLVGSTPLVRLRRLPAPASATVLAKLESHNPGGSVKDRIALAMVEDAERRGRLRSGMTLVEPTSGNTGVGLAMVAAVKGYRLILTMPEDMSLERRRLLARFGAELQLTPAIEGMTGAVYAAEELCRAHADYVMLQQFQNPANPEVHRRTTALEILEATAGRLDAFVAGVGTGGTITGTGEVLRETLGRAVKIVAVEPARSPVLSGGRFAVHGIQGLGASFVPGIFNRDAVDEVVTVRDEDAMATALRLCREEGLLVGISAGANVWAALAVAAGLGEGRVVVTVLPDTGERYLSVDLEAPGR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 99.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10140814 3300005293 Bacteria 1857
2 Ga0070676_10004889 3300005328 Bacteria 7100
3 Ga0070676_10019457 3300005328 Bacteria 3778
4 Ga0070690_100207673 3300005330 Bacteria 1366
5 Ga0070670_100002651 3300005331 Bacteria 14795
6 Ga0068869_100000454 3300005334 Bacteria 22524
7 Ga0068869_100002372 3300005334 Bacteria 11330
8 Ga0068869_100125073 3300005334 Bacteria 1971
9 Ga0070680_100025007 3300005336 Bacteria 4773
10 Ga0070680_100053833 3300005336 Bacteria 3285
11 Ga0070680_100065726 3300005336 Bacteria 2973
12 Ga0070682_100000164 3300005337 Bacteria 50996
13 Ga0070660_100001192 3300005339 Bacteria 17625
14 Ga0070689_100022172 3300005340 Bacteria 4739
15 Ga0070691_10049471 3300005341 Bacteria 2003
16 Ga0070691_10108061 3300005341 Bacteria 1389
17 Ga0070661_100007596 3300005344 Bacteria 7477
18 Ga0070692_10000185 3300005345 Bacteria 16429
19 Ga0070692_10004690 3300005345 Bacteria 5729
20 Ga0070692_10019280 3300005345 Bacteria 3290
21 Ga0070669_100069938 3300005353 Bacteria 2593
22 Ga0070669_100155814 3300005353 Bacteria 1771
23 Ga0070673_100006759 3300005364 Bacteria 7485
24 Ga0070688_100085022 3300005365 Bacteria 2056
25 Ga0070659_100000169 3300005366 Bacteria 50438
26 Ga0070703_10001360 3300005406 Bacteria 7417
27 Ga0070703_10067019 3300005406 Bacteria 1189
28 Ga0070709_10420300 3300005434 Bacteria 1002
29 Ga0070713_100269868 3300005436 Bacteria 1558
30 Ga0070701_10000434 3300005438 Bacteria 14271
31 Ga0070701_10021820 3300005438 Bacteria 3063
32 Ga0070701_10061258 3300005438 Bacteria 1984
33 Ga0070705_100000303 3300005440 Bacteria 29220
34 Ga0070705_100420662 3300005440 Bacteria 995
35 Ga0070694_100000153 3300005444 Bacteria 35445
36 Ga0070694_100000394 3300005444 Bacteria 23658
37 Ga0070694_100029446 3300005444 Bacteria 3583
38 Ga0070694_100031508 3300005444 Bacteria 3477
39 Ga0070708_100002805 3300005445 Bacteria 13530
40 Ga0070708_100012658 3300005445 Bacteria 6889
41 Ga0070708_100027139 3300005445 Bacteria 4910
42 Ga0070708_100098682 3300005445 Bacteria 2671
43 Ga0070708_100234326 3300005445 Bacteria 1723
44 Ga0070663_100001895 3300005455 Bacteria 11672
45 Ga0070662_100090033 3300005457 Bacteria 2302
46 Ga0070681_10000730 3300005458 Bacteria 27149
47 Ga0068867_100070635 3300005459 Bacteria 2611
48 Ga0070706_100002480 3300005467 Bacteria 18577
49 Ga0070706_100006899 3300005467 Bacteria 10719
50 Ga0070706_100039579 3300005467 Bacteria 4352
51 Ga0070706_100067102 3300005467 Bacteria 3318
52 Ga0070706_100101981 3300005467 Bacteria 2667
53 Ga0070706_100397654 3300005467 Bacteria 1283
54 Ga0070707_100003230 3300005468 Bacteria 15441
55 Ga0070707_100004373 3300005468 Bacteria 13235
56 Ga0070707_100004480 3300005468 Bacteria 13085
57 Ga0070707_100006735 3300005468 Bacteria 10648
58 Ga0070707_100133507 3300005468 Bacteria 2414
59 Ga0070707_100149079 3300005468 Bacteria 2277
60 Ga0070707_100220071 3300005468 Bacteria 1849
61 Ga0070698_100002229 3300005471 Bacteria 21462
62 Ga0070698_100009682 3300005471 Bacteria 10306
63 Ga0070698_100015432 3300005471 Bacteria 8071
64 Ga0070698_100045359 3300005471 Bacteria 4499
65 Ga0070698_100112955 3300005471 Bacteria 2681
66 Ga0070698_100246894 3300005471 Bacteria 1718
67 Ga0070699_100002125 3300005518 Bacteria 17972
68 Ga0070699_100010069 3300005518 Bacteria 8186
69 Ga0070699_100016368 3300005518 Bacteria 6368
70 Ga0070699_100028568 3300005518 Bacteria 4809
71 Ga0070699_100034353 3300005518 Bacteria 4383
72 Ga0070699_100057958 3300005518 Bacteria 3354
73 Ga0070699_100425884 3300005518 Bacteria 1202
74 Ga0070679_100000780 3300005530 Bacteria 27672
75 Ga0070679_100151411 3300005530 Bacteria 2296
76 Ga0070697_100007241 3300005536 Bacteria 8629
77 Ga0070697_100020405 3300005536 Bacteria 5241
78 Ga0070697_100043288 3300005536 Bacteria 3645
79 Ga0070697_100054038 3300005536 Bacteria 3264
80 Ga0070697_100144847 3300005536 Bacteria 1999
81 Ga0068853_100001544 3300005539 Bacteria 16734
82 Ga0070686_100120636 3300005544 Bacteria 1800
83 Ga0070686_100243678 3300005544 Bacteria 1310
84 Ga0070695_100002060 3300005545 Bacteria 11494
85 Ga0070695_100003497 3300005545 Bacteria 9168
86 Ga0070695_100004742 3300005545 Bacteria 8002
87 Ga0070695_100005853 3300005545 Bacteria 7253
88 Ga0070695_100009011 3300005545 Bacteria 5932
89 Ga0070696_100001302 3300005546 Bacteria 16274
90 Ga0070696_100032605 3300005546 Bacteria 3574
91 Ga0070696_100065384 3300005546 Bacteria 2549
92 Ga0070696_100072427 3300005546 Bacteria 2427
93 Ga0070696_100178770 3300005546 Bacteria 1573
94 Ga0070693_100000018 3300005547 Bacteria 62344
95 Ga0070693_100036024 3300005547 Bacteria 2748
96 Ga0070704_100008622 3300005549 Bacteria 6125
97 Ga0070704_100049443 3300005549 Bacteria 2950
98 Ga0070704_100135223 3300005549 Bacteria 1917
99 Ga0068855_100000233 3300005563 Bacteria 70757
100 Ga0070664_100010975 3300005564 Bacteria 7346
101 Ga0068857_100009717 3300005577 Bacteria 8357
102 Ga0068854_100001715 3300005578 Bacteria 13360
103 Ga0068856_100000806 3300005614 Bacteria 33848
104 Ga0070702_100255630 3300005615 Bacteria 1190
105 Ga0068859_100006365 3300005617 Bacteria 11976
106 Ga0068859_100009180 3300005617 Bacteria 9986
107 Ga0068859_100259722 3300005617 Bacteria 1828
108 Ga0068864_100004417 3300005618 Bacteria 11548
109 Ga0068861_100200085 3300005719 Bacteria 1676
110 Ga0068870_10000059 3300005840 Bacteria 34564
111 Ga0068858_100040912 3300005842 Bacteria 4299
112 Ga0068860_100003577 3300005843 Bacteria 15976
113 Ga0068860_100129312 3300005843 Bacteria 2422
114 Ga0068862_100004350 3300005844 Bacteria 11989
115 Ga0068862_100004793 3300005844 Bacteria 11385
116 Ga0068862_100012292 3300005844 Bacteria 7079
117 Ga0068862_100022823 3300005844 Bacteria 5237
118 Ga0068862_100046444 3300005844 Bacteria 3705
119 Ga0081455_10001251 3300005937 Bacteria 31750
120 Ga0081455_10219809 3300005937 Bacteria 1409
121 Ga0081538_10003971 3300005981 Bacteria 13780
122 Ga0081539_10000092 3300005985 Bacteria 208968
123 Ga0070716_100031277 3300006173 Bacteria 2893
124 Ga0070712_100001609 3300006175 Bacteria 13807
125 Ga0070712_100274552 3300006175 Bacteria 1356
126 Ga0075428_100000421 3300006844 Bacteria 42169
127 Ga0075428_100008551 3300006844 Bacteria 11355
128 Ga0075428_100016534 3300006844 Bacteria 8146
129 Ga0075428_100029927 3300006844 Bacteria 6023
130 Ga0075428_100043256 3300006844 Bacteria 4951
131 Ga0075428_100142719 3300006844 Bacteria 2603
132 Ga0075428_100143058 3300006844 Bacteria 2600
133 Ga0075428_100146364 3300006844 Bacteria 2567
134 Ga0075428_100568227 3300006844 Bacteria 1212
135 Ga0075430_100000341 3300006846 Bacteria 33734
136 Ga0075430_100002061 3300006846 Bacteria 16580
137 Ga0075430_100005238 3300006846 Bacteria 10938
138 Ga0075430_100007544 3300006846 Bacteria 9185
139 Ga0075430_100096687 3300006846 Bacteria 2468
140 Ga0075430_100308728 3300006846 Bacteria 1308
141 Ga0075431_100000452 3300006847 Bacteria 33772
142 Ga0075431_100000470 3300006847 Bacteria 33363
143 Ga0075431_100001171 3300006847 Bacteria 23632
144 Ga0075431_100002219 3300006847 Bacteria 18607
145 Ga0075431_100002638 3300006847 Bacteria 17346
146 Ga0075431_100002902 3300006847 Bacteria 16586
147 Ga0075431_100004853 3300006847 Bacteria 13244
148 Ga0075431_100009244 3300006847 Bacteria 9893
149 Ga0075431_100103039 3300006847 Bacteria 2945
150 Ga0075431_100103692 3300006847 Bacteria 2935
151 Ga0075431_100164022 3300006847 Bacteria 2284
152 Ga0075431_100166959 3300006847 Bacteria 2262
153 Ga0075431_100175556 3300006847 Bacteria 2201
154 Ga0075431_100294664 3300006847 Bacteria 1640
155 Ga0075431_100464602 3300006847 Bacteria 1260
156 Ga0075431_100538410 3300006847 Bacteria 1156
157 Ga0075433_10001399 3300006852 Bacteria 17780
158 Ga0075433_10003027 3300006852 Bacteria 12915
159 Ga0075433_10003861 3300006852 Bacteria 11601
160 Ga0075433_10009505 3300006852 Bacteria 7770
161 Ga0075433_10028302 3300006852 Bacteria 4763
162 Ga0075433_10029437 3300006852 Bacteria 4679
163 Ga0075433_10069220 3300006852 Bacteria 3099
164 Ga0075433_10108867 3300006852 Bacteria 2458
165 Ga0075433_10120453 3300006852 Bacteria 2330
166 Ga0075433_10127796 3300006852 Bacteria 2257
167 Ga0075433_10392078 3300006852 Bacteria 1225
168 Ga0075433_10417822 3300006852 Bacteria 1183
169 Ga0075434_100000107 3300006871 Bacteria 47551
170 Ga0075434_100001918 3300006871 Bacteria 18027
171 Ga0075434_100002260 3300006871 Bacteria 16853
172 Ga0075434_100003368 3300006871 Bacteria 14308
173 Ga0075434_100036682 3300006871 Bacteria 4850
174 Ga0075434_100065643 3300006871 Bacteria 3615
175 Ga0075434_100114972 3300006871 Bacteria 2703
176 Ga0075434_100123165 3300006871 Bacteria 2609
177 Ga0075434_100244675 3300006871 Bacteria 1813
178 Ga0075434_100439041 3300006871 Bacteria 1326
179 Ga0075429_100000305 3300006880 Bacteria 34736
180 Ga0075429_100003918 3300006880 Bacteria 12716
181 Ga0075429_100010160 3300006880 Bacteria 8149
182 Ga0075429_100010628 3300006880 Bacteria 7964
183 Ga0075429_100013922 3300006880 Bacteria 6972
184 Ga0075429_100045044 3300006880 Bacteria 3838
185 Ga0075429_100062017 3300006880 Bacteria 3257
186 Ga0075429_100066718 3300006880 Bacteria 3133
187 Ga0075429_100144592 3300006880 Bacteria 2081
188 Ga0075429_100164495 3300006880 Bacteria 1944
189 Ga0075429_100266545 3300006880 Bacteria 1500
190 Ga0075436_100001117 3300006914 Bacteria 18139
191 Ga0075436_100032734 3300006914 Bacteria 3583
192 Ga0075436_100073431 3300006914 Bacteria 2368
193 Ga0075436_100124360 3300006914 Bacteria 1806
194 Ga0075436_100299249 3300006914 Bacteria 1153
195 Ga0097620_100006365 3300006931 Bacteria 11976
196 Ga0097620_100009180 3300006931 Bacteria 9986
197 Ga0097620_100134776 3300006931 Bacteria 2542
198 Ga0097620_100259721 3300006931 Bacteria 1828
199 Ga0075435_100000798 3300007076 Bacteria 19609
200 Ga0075435_100001899 3300007076 Bacteria 13598
201 Ga0075435_100004640 3300007076 Bacteria 9468
202 Ga0075435_100007188 3300007076 Bacteria 7918
203 Ga0075435_100010546 3300007076 Bacteria 6760
204 Ga0075435_100029753 3300007076 Bacteria 4288
205 Ga0075435_100163965 3300007076 Bacteria 1873
206 Ga0075435_100286482 3300007076 Bacteria 1407
207 Ga0075435_100366274 3300007076 Bacteria 1237
208 Ga0099794_10055000 3300007265 Bacteria 1922
209 Ga0111539_10000557 3300009094 Bacteria 47767
210 Ga0111539_10008896 3300009094 Bacteria 12713
211 Ga0111539_10011342 3300009094 Bacteria 11194
212 Ga0111539_10099499 3300009094 Bacteria 3415
213 Ga0111539_10109518 3300009094 Bacteria 3242
214 Ga0111539_10152793 3300009094 Bacteria 2702
215 Ga0105245_10346129 3300009098 Bacteria 1471
216 Ga0105247_10097035 3300009101 Bacteria 1879
217 Ga0114129_10000497 3300009147 Bacteria 47712
218 Ga0114129_10000704 3300009147 Bacteria 42132
219 Ga0114129_10000726 3300009147 Bacteria 41775
220 Ga0114129_10001085 3300009147 Bacteria 35711
221 Ga0114129_10002365 3300009147 Bacteria 26178
222 Ga0114129_10002578 3300009147 Bacteria 25189
223 Ga0114129_10004399 3300009147 Bacteria 19870
224 Ga0114129_10006119 3300009147 Bacteria 17065
225 Ga0114129_10006298 3300009147 Bacteria 16825
226 Ga0114129_10014740 3300009147 Bacteria 11136
227 Ga0114129_10021486 3300009147 Bacteria 9160
228 Ga0114129_10034166 3300009147 Bacteria 7181
229 Ga0114129_10044350 3300009147 Bacteria 6256
230 Ga0114129_10064549 3300009147 Bacteria 5110
231 Ga0114129_10072614 3300009147 Bacteria 4796
232 Ga0114129_10086069 3300009147 Bacteria 4360
233 Ga0114129_10164893 3300009147 Bacteria 3025
234 Ga0114129_10169162 3300009147 Bacteria 2981
235 Ga0114129_10234984 3300009147 Bacteria 2467
236 Ga0114129_10265070 3300009147 Bacteria 2300
237 Ga0114129_10271162 3300009147 Bacteria 2270
238 Ga0114129_10432212 3300009147 Bacteria 1730
239 Ga0105243_10005054 3300009148 Bacteria 10351
240 Ga0105243_10061888 3300009148 Bacteria 2995
241 Ga0105241_10002337 3300009174 Bacteria 14247
242 Ga0105241_10048576 3300009174 Bacteria 3229
243 Ga0105248_10292608 3300009177 Bacteria 1834
244 Ga0105248_10777860 3300009177 Bacteria 1080
245 Ga0105249_10018869 3300009553 Bacteria 6145
246 Ga0105249_10106027 3300009553 Unclassified 2651
247 Ga0105239_10513261 3300010375 Bacteria 1363
248 Ga0157373_10018199 3300013100 Bacteria 5117
249 Ga0157369_10028864 3300013105 Bacteria 6136
250 Ga0157378_10076143 3300013297 Bacteria 3023
251 Ga0157378_10112151 3300013297 Bacteria 2501
252 Ga0157378_10454229 3300013297 Bacteria 1272
253 Ga0163162_10028990 3300013306 Bacteria 5477
254 Ga0163162_10144116 3300013306 Bacteria 2497
255 Ga0157372_10000846 3300013307 Bacteria 33218
256 Ga0157372_10092431 3300013307 Bacteria 3442
257 Ga0157375_10041557 3300013308 Bacteria 4441
258 Ga0157375_10336270 3300013308 Bacteria 1675
259 Ga0182007_10015372 3300015262 Bacteria 2857
260 Ga0207653_10001521 3300025885 Bacteria 7507
261 Ga0207653_10007870 3300025885 Bacteria 3322
262 Ga0207647_10029432 3300025904 Bacteria 3555
263 Ga0207647_10167732 3300025904 Bacteria 1279
264 Ga0207699_10317904 3300025906 Bacteria 1091
265 Ga0207645_10000340 3300025907 Bacteria 39096
266 Ga0207645_10019898 3300025907 Bacteria 4394
267 Ga0207643_10000105 3300025908 Bacteria 57132
268 Ga0207684_10000242 3300025910 Bacteria 81735
269 Ga0207684_10009125 3300025910 Bacteria 8784
270 Ga0207684_10025708 3300025910 Bacteria 5016
271 Ga0207684_10045384 3300025910 Bacteria 3728
272 Ga0207684_10102886 3300025910 Bacteria 2442
273 Ga0207684_10110774 3300025910 Bacteria 2350
274 Ga0207684_10464493 3300025910 Bacteria 1086
275 Ga0207654_10007386 3300025911 Bacteria 5533
276 Ga0207654_10107796 3300025911 Bacteria 1727
277 Ga0207707_10000034 3300025912 Bacteria 152677
278 Ga0207693_10009502 3300025915 Bacteria 7920
279 Ga0207693_10189345 3300025915 Bacteria 1619
280 Ga0207660_10165539 3300025917 Bacteria 1709
281 Ga0207657_10000066 3300025919 Bacteria 98663
282 Ga0207649_10027797 3300025920 Bacteria 3324
283 Ga0207652_10000740 3300025921 Bacteria 31505
284 Ga0207652_10129849 3300025921 Bacteria 2247
285 Ga0207646_10000574 3300025922 Bacteria 48122
286 Ga0207646_10004220 3300025922 Bacteria 15726
287 Ga0207646_10026137 3300025922 Bacteria 5332
288 Ga0207646_10033355 3300025922 Bacteria 4658
289 Ga0207646_10043129 3300025922 Bacteria 4052
290 Ga0207646_10062589 3300025922 Bacteria 3322
291 Ga0207646_10077131 3300025922 Bacteria 2979
292 Ga0207646_10162357 3300025922 Bacteria 2016
293 Ga0207646_10261551 3300025922 Bacteria 1564
294 Ga0207681_10005715 3300025923 Bacteria 7631
295 Ga0207681_10198957 3300025923 Bacteria 1537
296 Ga0207650_10031007 3300025925 Bacteria 3857
297 Ga0207700_10219506 3300025928 Bacteria 1611
298 Ga0207690_10001729 3300025932 Bacteria 13423
299 Ga0207706_10043062 3300025933 Bacteria 4001
300 Ga0207706_10245545 3300025933 Bacteria 1564
301 Ga0207706_10273292 3300025933 Bacteria 1474
302 Ga0207706_10310932 3300025933 Bacteria 1372
303 Ga0207709_10048952 3300025935 Bacteria 2577
304 Ga0207691_10011340 3300025940 Bacteria 8552
305 Ga0207689_10000365 3300025942 Bacteria 42716
306 Ga0207689_10004878 3300025942 Bacteria 12094
307 Ga0207689_10193462 3300025942 Bacteria 1678
308 Ga0207679_10000248 3300025945 Bacteria 41174
309 Ga0207667_10000790 3300025949 Bacteria 41185
310 Ga0207651_10030135 3300025960 Bacteria 3450
311 Ga0207712_10159424 3300025961 Unclassified 1752
312 Ga0207712_10247477 3300025961 Bacteria 1439
313 Ga0207640_10003504 3300025981 Bacteria 8458
314 Ga0207703_10111134 3300026035 Bacteria 2339
315 Ga0207639_10017235 3300026041 Bacteria 5120
316 Ga0207678_10002576 3300026067 Bacteria 16517
317 Ga0207708_10011344 3300026075 Bacteria 6637
318 Ga0207648_10000856 3300026089 Bacteria 34281
319 Ga0207648_10110675 3300026089 Bacteria 2411
320 Ga0207648_10132025 3300026089 Bacteria 2198
321 Ga0207648_10469557 3300026089 Bacteria 1148
322 Ga0207676_10024755 3300026095 Bacteria 4445
323 Ga0207674_10000050 3300026116 Bacteria 116782
324 Ga0207675_100074739 3300026118 Bacteria 3171
325 Ga0207675_100466114 3300026118 Bacteria 1254
326 Ga0209981_1005557 3300027378 Bacteria 1674
327 Ga0209984_1005626 3300027424 Bacteria 1512
328 Ga0210000_1003329 3300027462 Bacteria 2316
329 Ga0209995_1005718 3300027471 Bacteria 1998
330 Ga0209968_1008697 3300027526 Bacteria 1549
331 Ga0209983_1002812 3300027665 Bacteria 3761
332 Ga0209588_1010800 3300027671 Bacteria 2751
333 Ga0209971_1000128 3300027682 Bacteria 22582
334 Ga0209966_1000071 3300027695 Bacteria 45482
335 Ga0209966_1022285 3300027695 Bacteria 1237
336 Ga0209998_10000113 3300027717 Bacteria 32266
337 Ga0209974_10022208 3300027876 Bacteria 2102
338 Ga0207428_10000033 3300027907 Bacteria 232081
339 Ga0207428_10000054 3300027907 Bacteria 175237
340 Ga0207428_10022910 3300027907 Bacteria 5262
341 Ga0207428_10174593 3300027907 Bacteria 1626
342 Ga0268265_10003185 3300028380 Bacteria 11925
343 Ga0268265_10008213 3300028380 Bacteria 7053
344 Ga0268265_10015396 3300028380 Bacteria 5234
345 Ga0268265_10082887 3300028380 Bacteria 2537
346 Ga0268264_10004690 3300028381 Bacteria 11621
347 Ga0268264_10030442 3300028381 Bacteria 4423
348 Ga0268264_10078705 3300028381 Bacteria 2811
349 Ga0268264_10095295 3300028381 Bacteria 2575
350 Ga0268264_10143668 3300028381 Bacteria 2131
351 Ga0307408_100019764 3300031548 Bacteria 4537
352 Ga0307408_100289440 3300031548 Bacteria 1367
353 Ga0307405_10161862 3300031731 Bacteria 1586
354 Ga0307409_100018640 3300031995 Bacteria 4674
355 Ga0307409_100035154 3300031995 Bacteria 3668
356 Ga0307416_100097447 3300032002 Bacteria 2547
357 Ga0307416_100102901 3300032002 Bacteria 2492
358 Ga0307411_10528467 3300032005 Bacteria 1003
359 Ga0307415_100303893 3300032126 Bacteria 1323
360 Ga0373948_0002216 3300034817 Bacteria 2839
361 Ga0373959_0012217 3300034820 Bacteria 1529
362 Ga0373940_0082375 3300035088 Bacteria 953
363 Ga0373949_0019418 3300035090 Bacteria 1548
364 Ga0373951_0001847 3300035091 Bacteria 5473
365 Ga0373939_0016956 3300035114 Bacteria 1928
366 Ga0373939_0025450 3300035114 Bacteria 1659
367 Ga0373960_0005205 3300035121 Bacteria 3004
368 Ga0373960_0033821 3300035121 Bacteria 1443
369 Ga0373931_0015664 3300035691 Bacteria 3721
370 Ga0373931_0069245 3300035691 Bacteria 1922
371 Ga0373931_0106101 3300035691 Bacteria 1587
372 Ga0395899_0033281 3300037312 Bacteria 3871
373 Ga0395900_0003509 3300037418 Bacteria 16929
374 Ga0395898_0013339 3300037466 Bacteria 8463
375 Ga0395901_0011843 3300038443 Bacteria 8842
376 Ga0439448_0000205 3300042005 Bacteria 12290
377 Ga0439459_0012281 3300042438 Bacteria 1522
378 Ga0439464_0015396 3300042439 Bacteria 2064
379 Ga0439460_0000453 3300042461 Bacteria 8827
380 Ga0439460_0047034 3300042461 Bacteria 1283
381 Ga0451577_0011665 3300042876 Bacteria 8298
382 Ga0451577_0013723 3300042876 Bacteria 7571
383 Ga0451577_0023769 3300042876 Bacteria 5584
384 Ga0451577_0064518 3300042876 Bacteria 3266
385 Ga0451577_0163289 3300042876 Bacteria 2006
386 Ga0451577_0284928 3300042876 Bacteria 1497
387 Ga0453684_0135624 3300044712 Bacteria 2947
388 Ga0451576_0017829 3300045051 Bacteria 7798
389 Ga0451576_0030449 3300045051 Bacteria 5768
390 Ga0451576_0040536 3300045051 Bacteria 4927
391 Ga0451576_0042261 3300045051 Bacteria 4813
392 Ga0451576_0085237 3300045051 Bacteria 3287
393 Ga0451576_0087339 3300045051 Bacteria 3243
394 Ga0451576_0111360 3300045051 Bacteria 2849
395 Ga0451576_0141805 3300045051 Bacteria 2505
396 Ga0495580_0005537 3300046472 Bacteria 10420
397 Ga0495580_0351528 3300046472 Bacteria 998
398 Ga0495584_0115460 3300046491 Bacteria 1359
399 Ga0495642_0104950 3300046528 Bacteria 1205
400 Ga0495598_0026656 3300046537 Bacteria 1586
401 Ga0495669_0020026 3300046684 Bacteria 2891
402 Ga0495669_0089338 3300046684 Bacteria 1421
403 Ga0495636_0048646 3300047318 Bacteria 1772
404 Ga0496103_0200311 3300048906 Bacteria 1284
405 Ga0496106_0186716 3300048909 Bacteria 1647
406 Ga0496106_0210911 3300048909 Bacteria 1547
407 Ga0496108_0268576 3300048911 Bacteria 1485
408 Ga0496112_0141679 3300048915 Bacteria 2373
409 Ga0501033_0063804 3300049570 Bacteria 2711
410 Ga0501033_0254184 3300049570 Bacteria 1245
411 Ga0501033_0261497 3300049570 Bacteria 1225
412 Ga0501036_0040793 3300049572 Bacteria 3927
413 Ga0501036_0049407 3300049572 Bacteria 3562
414 Ga0501036_0070650 3300049572 Bacteria 2952
415 Ga0501036_0088180 3300049572 Bacteria 2622
416 Ga0501036_0187665 3300049572 Bacteria 1740
417 Ga0501036_0400432 3300049572 Bacteria 1145
418 Ga0501038_0007239 3300049574 Bacteria 10249
419 Ga0501038_0040088 3300049574 Bacteria 4093
420 Ga0501038_0125500 3300049574 Bacteria 2113
421 Ga0501038_0152989 3300049574 Bacteria 1880
422 Ga0501038_0219693 3300049574 Bacteria 1517
423 Ga0501038_0255750 3300049574 Bacteria 1386
424 Ga0501039_0003008 3300049575 Bacteria 12600
425 Ga0501039_0020459 3300049575 Bacteria 5072
426 Ga0501039_0040095 3300049575 Bacteria 3616
427 Ga0501039_0109802 3300049575 Bacteria 2156
428 Ga0501040_0000372 3300049576 Bacteria 26457
429 Ga0501040_0002803 3300049576 Bacteria 11240
430 Ga0501040_0012033 3300049576 Bacteria 5661
431 Ga0501040_0021721 3300049576 Bacteria 4291
432 Ga0501040_0045132 3300049576 Bacteria 3005
433 Ga0501040_0088301 3300049576 Bacteria 2153
434 Ga0501040_0111366 3300049576 Bacteria 1914
435 Ga0501040_0173969 3300049576 Bacteria 1525
436 Ga0501040_0230401 3300049576 Bacteria 1319
437 Ga0501040_0353630 3300049576 Bacteria 1053
438 Ga0501041_0000313 3300049577 Bacteria 23678
439 Ga0501041_0003933 3300049577 Bacteria 8569
440 Ga0501041_0004305 3300049577 Bacteria 8236
441 Ga0501041_0090684 3300049577 Bacteria 1887
442 Ga0501041_0167657 3300049577 Bacteria 1374
443 Ga0501042_0001568 3300049578 Bacteria 13533
444 Ga0501042_0006045 3300049578 Bacteria 7839
445 Ga0501042_0127595 3300049578 Bacteria 1832
446 Ga0501042_0172982 3300049578 Bacteria 1558
447 Ga0501042_0174868 3300049578 Bacteria 1549
448 Ga0501042_0269252 3300049578 Bacteria 1230
449 Ga0501043_0036352 3300049579 Bacteria 3874
450 Ga0501046_0000084 3300049580 Bacteria 100971
451 Ga0501046_0004108 3300049580 Bacteria 13262
452 Ga0501046_0036544 3300049580 Bacteria 3952
453 Ga0501046_0038740 3300049580 Bacteria 3823
454 Ga0501046_0174207 3300049580 Bacteria 1613
455 Ga0501046_0249105 3300049580 Bacteria 1308
456 Ga0501046_0331720 3300049580 Bacteria 1107
457 Ga0501048_0003731 3300049582 Bacteria 11615
458 Ga0501048_0007331 3300049582 Bacteria 8363
459 Ga0501048_0008354 3300049582 Bacteria 7826
460 Ga0501068_0050008 3300049584 Bacteria 2526
461 Ga0501068_0071379 3300049584 Bacteria 2120
462 Ga0501068_0143782 3300049584 Bacteria 1496
463 Ga0501068_0166247 3300049584 Bacteria 1391
464 Ga0501069_0055638 3300049585 Bacteria 2204
465 Ga0501071_0004236 3300049587 Bacteria 9084
466 Ga0501071_0022346 3300049587 Bacteria 4410
467 Ga0501071_0181561 3300049587 Bacteria 1577
468 Ga0501071_0187157 3300049587 Bacteria 1552
469 Ga0501071_0396971 3300049587 Bacteria 1053
470 Ga0501072_0002328 3300049588 Bacteria 14251
471 Ga0501072_0006474 3300049588 Bacteria 8918
472 Ga0501072_0011064 3300049588 Bacteria 6885
473 Ga0501072_0011625 3300049588 Bacteria 6726
474 Ga0501072_0021799 3300049588 Bacteria 4968
475 Ga0501072_0038391 3300049588 Bacteria 3758
476 Ga0501072_0043833 3300049588 Bacteria 3517
477 Ga0501072_0076813 3300049588 Bacteria 2643
478 Ga0501072_0273737 3300049588 Bacteria 1343
479 Ga0501072_0279597 3300049588 Bacteria 1328
480 Ga0501072_0491669 3300049588 Bacteria 970
481 Ga0501074_0002552 3300049590 Bacteria 12706
482 Ga0501074_0002904 3300049590 Bacteria 12025
483 Ga0501074_0159699 3300049590 Bacteria 1610
484 Ga0501074_0191218 3300049590 Bacteria 1459
485 Ga0501074_0300827 3300049590 Bacteria 1139
486 Ga0501075_0000734 3300049591 Bacteria 20322
487 Ga0501075_0000742 3300049591 Bacteria 20270
488 Ga0501075_0002306 3300049591 Bacteria 12664
489 Ga0501075_0024482 3300049591 Bacteria 4428
490 Ga0501075_0024488 3300049591 Bacteria 4427
491 Ga0501075_0025151 3300049591 Bacteria 4374
492 Ga0501075_0026883 3300049591 Bacteria 4238
493 Ga0501075_0030009 3300049591 Bacteria 4024
494 Ga0501075_0037620 3300049591 Bacteria 3616
495 Ga0501075_0051359 3300049591 Bacteria 3100
496 Ga0501075_0063924 3300049591 Bacteria 2775
497 Ga0501075_0210943 3300049591 Bacteria 1481
498 Ga0501075_0257741 3300049591 Bacteria 1329
499 Ga0501075_0280989 3300049591 Bacteria 1268
500 Ga0501075_0323316 3300049591 Bacteria 1175
501 Ga0501076_0001282 3300049592 Bacteria 16737
502 Ga0501076_0001694 3300049592 Bacteria 14878
503 Ga0501076_0002350 3300049592 Bacteria 12941
504 Ga0501076_0016721 3300049592 Bacteria 5565
505 Ga0501076_0017009 3300049592 Bacteria 5522
506 Ga0501076_0021097 3300049592 Bacteria 4992
507 Ga0501076_0042702 3300049592 Bacteria 3570
508 Ga0501076_0103543 3300049592 Bacteria 2296
509 Ga0501076_0103709 3300049592 Bacteria 2294
510 Ga0501076_0299531 3300049592 Bacteria 1318
511 Ga0501077_0001222 3300049593 Bacteria 15514
512 Ga0501077_0001630 3300049593 Bacteria 13483
513 Ga0501077_0022560 3300049593 Bacteria 3987
514 Ga0501077_0035033 3300049593 Bacteria 3196
515 Ga0501077_0036677 3300049593 Bacteria 3124
516 Ga0501077_0045127 3300049593 Bacteria 2799
517 Ga0501077_0192003 3300049593 Bacteria 1297
518 Ga0501079_0000347 3300049741 Bacteria 29466
519 Ga0501079_0000847 3300049741 Bacteria 20853
520 Ga0501079_0001826 3300049741 Bacteria 15236
521 Ga0501079_0003926 3300049741 Bacteria 10986
522 Ga0501079_0005662 3300049741 Bacteria 9327
523 Ga0501079_0024179 3300049741 Bacteria 4662
524 Ga0501079_0031768 3300049741 Bacteria 4057
525 Ga0501079_0040790 3300049741 Bacteria 3582
526 Ga0501079_0044595 3300049741 Bacteria 3422
527 Ga0501079_0076646 3300049741 Bacteria 2586
528 Ga0501079_0133394 3300049741 Bacteria 1933
529 Ga0501079_0183508 3300049741 Bacteria 1633
530 Ga0501079_0200500 3300049741 Bacteria 1559
531 Ga0501079_0207297 3300049741 Bacteria 1531
532 Ga0501080_0000373 3300049742 Bacteria 34505
533 Ga0501080_0060310 3300049742 Bacteria 3531
534 Ga0501080_0106207 3300049742 Bacteria 2602
535 Ga0501080_0117195 3300049742 Bacteria 2468
536 Ga0501080_0155503 3300049742 Bacteria 2113
537 Ga0501080_0257528 3300049742 Bacteria 1590
538 Ga0501081_0002261 3300049743 Bacteria 12115
539 Ga0501081_0002829 3300049743 Bacteria 11009
540 Ga0501081_0003242 3300049743 Bacteria 10354
541 Ga0501081_0005570 3300049743 Bacteria 8132
542 Ga0501081_0013375 3300049743 Bacteria 5398
543 Ga0501081_0030144 3300049743 Bacteria 3670
544 Ga0501081_0038636 3300049743 Bacteria 3262
545 Ga0501081_0048334 3300049743 Bacteria 2928
546 Ga0501081_0056095 3300049743 Bacteria 2722
547 Ga0501081_0089925 3300049743 Bacteria 2158
548 Ga0501081_0102409 3300049743 Bacteria 2025
549 Ga0501081_0317062 3300049743 Bacteria 1145
550 Ga0501081_0337409 3300049743 Bacteria 1109
551 Ga0501083_0003803 3300049744 Bacteria 10601
552 Ga0501083_0080269 3300049744 Bacteria 2163
553 Ga0501083_0135426 3300049744 Bacteria 1614
554 Ga0501045_0000024 3300049824 Bacteria 63402
555 Ga0501045_0001154 3300049824 Bacteria 17499
556 Ga0501045_0202453 3300049824 Bacteria 1479
557 Ga0501045_0218662 3300049824 Bacteria 1419
558 Ga0501045_0239977 3300049824 Bacteria 1349
559 Ga0501045_0303483 3300049824 Bacteria 1188
560 nmdc:mga05p37_114160_c1 3300050507 Bacteria 2873
561 nmdc:mga05p37_19006_c1 3300050507 Bacteria 8310
562 nmdc:mga05p37_227346_c1 3300050507 Bacteria 2249
563 nmdc:mga05p37_239485_c1 3300050507 Bacteria 2183
564 nmdc:mga05p37_240176_c1 3300050507 Bacteria 2179
565 nmdc:mga05p37_280974_c1 3300050507 Bacteria 1985
566 nmdc:mga05p37_33272_c1 3300050507 Bacteria 6314
567 nmdc:mga05p37_3760_c1 3300050507 Bacteria 17767
568 nmdc:mga05p37_423819_c1 3300050507 Bacteria 1548
569 nmdc:mga05p37_46194_c1 3300050507 Bacteria 5355
570 nmdc:mga05p37_4740_c1 3300050507 Bacteria 15888
571 nmdc:mga05p37_50612_c1 3300050507 Bacteria 5109
572 nmdc:mga05p37_51237_c1 3300050507 Bacteria 5077
573 nmdc:mga05p37_54516_c1 3300050507 Bacteria 4919
574 nmdc:mga05p37_55867_c1 3300050507 Bacteria 4860
575 nmdc:mga05p37_571_c1 3300050507 Bacteria 40489
576 nmdc:mga05p37_7326_c1 3300050507 Bacteria 13022
577 nmdc:mga05p37_733_c1 3300050507 Bacteria 36361
578 nmdc:mga05p37_7533_c1 3300050507 Bacteria 12833
579 nmdc:mga05p37_9265_c1 3300050507 Bacteria 11639
580 nmdc:mga09592_10815_c1 3300050508 Bacteria 7422
581 nmdc:mga09592_13717_c1 3300050508 Bacteria 6622
582 nmdc:mga09592_13762_c1 3300050508 Bacteria 6610
583 nmdc:mga09592_218002_c1 3300050508 Bacteria 1653
584 nmdc:mga09592_227935_c1 3300050508 Bacteria 1614
585 nmdc:mga09592_32609_c1 3300050508 Bacteria 4343
586 nmdc:mga09592_33695_c1 3300050508 Bacteria 4277
587 nmdc:mga09592_36768_c1 3300050508 Bacteria 4103
588 nmdc:mga09592_44015_c1 3300050508 Bacteria 3756
589 nmdc:mga09592_47056_c1 3300050508 Bacteria 3634
590 nmdc:mga09592_5510_c1 3300050508 Bacteria 10298
591 nmdc:mga09592_56_c1 3300050508 Bacteria 62143
592 nmdc:mga09592_6707_c1 3300050508 Bacteria 9377
593 nmdc:mga0qj67_18157_c1 3300050509 Bacteria 5360
594 nmdc:mga0qj67_28264_c1 3300050509 Bacteria 4352
595 nmdc:mga0qj67_300724_c1 3300050509 Bacteria 1300
596 nmdc:mga0qj67_3409_c1 3300050509 Bacteria 11467
597 nmdc:mga0qj67_4522_c1 3300050509 Bacteria 10072
598 nmdc:mga0qj67_639520_c1 3300050509 Bacteria 849
599 nmdc:mga0qj67_711_c1 3300050509 Bacteria 22648
600 nmdc:mga0qj67_761_c1 3300050509 Bacteria 21944
601 nmdc:mga0qj67_85066_c1 3300050509 Bacteria 2536
602 nmdc:mga06r32_1136_c1 3300050510 Bacteria 23891
603 nmdc:mga06r32_12631_c1 3300050510 Bacteria 7630
604 nmdc:mga06r32_132_c1 3300050510 Bacteria 54848
605 nmdc:mga06r32_214774_c1 3300050510 Bacteria 1911
606 nmdc:mga06r32_295283_c1 3300050510 Bacteria 1607
607 nmdc:mga06r32_344052_c1 3300050510 Bacteria 1476
608 nmdc:mga06r32_37690_c1 3300050510 Bacteria 4574
609 nmdc:mga06r32_380548_c1 3300050510 Bacteria 1394
610 nmdc:mga06r32_428_c1 3300050510 Bacteria 35405
611 nmdc:mga06r32_48513_c1 3300050510 Bacteria 4059
612 nmdc:mga06r32_53897_c1 3300050510 Bacteria 3855
613 nmdc:mga06r32_701929_c1 3300050510 Bacteria 977
614 nmdc:mga06r32_8388_c1 3300050510 Bacteria 9306
615 nmdc:mga08y16_101940_c1 3300050511 Bacteria 2988
616 nmdc:mga08y16_13982_c1 3300050511 Bacteria 8449
617 nmdc:mga08y16_15975_c1 3300050511 Bacteria 7890
618 nmdc:mga08y16_165516_c1 3300050511 Bacteria 2297
619 nmdc:mga08y16_272246_c1 3300050511 Bacteria 1748
620 nmdc:mga08y16_3397_c1 3300050511 Bacteria 16517
621 nmdc:mga08y16_589741_c1 3300050511 Bacteria 1121
622 nmdc:mga0n895_10415_c1 3300050512 Bacteria 8210
623 nmdc:mga0n895_162730_c1 3300050512 Bacteria 2263
624 nmdc:mga0n895_176712_c1 3300050512 Bacteria 2166
625 nmdc:mga0n895_191_c1 3300050512 Bacteria 38035
626 nmdc:mga0n895_232972_c1 3300050512 Bacteria 1869
627 nmdc:mga0n895_26_c1 3300050512 Bacteria 89958
628 nmdc:mga0n895_2702_c1 3300050512 Bacteria 14000
629 nmdc:mga0n895_356462_c1 3300050512 Bacteria 1481
630 nmdc:mga0n895_37967_c1 3300050512 Bacteria 4664
631 nmdc:mga0n895_74710_c1 3300050512 Bacteria 3368
632 nmdc:mga0n895_79039_c1 3300050512 Bacteria 3275
633 nmdc:mga0n895_91060_c1 3300050512 Bacteria 3052
634 nmdc:mga0rr50_17563_c1 3300050513 Bacteria 4780
635 nmdc:mga0rr50_1853_c1 3300050513 Bacteria 11718
636 nmdc:mga0rr50_23170_c1 3300050513 Bacteria 4276
637 nmdc:mga0rr50_25401_c1 3300050513 Bacteria 4118
638 nmdc:mga0rr50_5485_c1 3300050513 Bacteria 7575
639 nmdc:mga0rr50_79664_c1 3300050513 Bacteria 2523
640 nmdc:mga0rr50_95422_c1 3300050513 Bacteria 2325
641 nmdc:mga08x19_106914_c1 3300050514 Bacteria 1862
642 nmdc:mga08x19_111959_c1 3300050514 Bacteria 1821
643 nmdc:mga08x19_132107_c1 3300050514 Bacteria 1680
644 nmdc:mga08x19_223715_c1 3300050514 Bacteria 1294
645 nmdc:mga08x19_224099_c1 3300050514 Bacteria 1293
646 nmdc:mga08x19_3113_c1 3300050514 Bacteria 9971
647 nmdc:mga08x19_399_c1 3300050514 Bacteria 30610
648 nmdc:mga08x19_87694_c1 3300050514 Bacteria 2050
649 nmdc:mga0a205_123092_c1 3300050515 Bacteria 2493
650 nmdc:mga0a205_225470_c1 3300050515 Bacteria 1759
651 nmdc:mga0a205_25642_c1 3300050515 Bacteria 5618
652 nmdc:mga0a205_25936_c1 3300050515 Bacteria 4768
653 nmdc:mga0a205_3171_c1 3300050515 Bacteria 14605
654 nmdc:mga0a205_329_c1 3300050515 Bacteria 35516
655 nmdc:mga0a205_32_c1 3300050515 Bacteria 79060
656 nmdc:mga0a205_332962_c1 3300050515 Bacteria 1388
657 nmdc:mga0a205_47042_c1 3300050515 Bacteria 4161
658 nmdc:mga0a205_5347_c1 3300050515 Bacteria 11573
659 Ga0495601_0000902 3300053077 Bacteria 16197
660 Ga0495595_0051409 3300053084 Bacteria 1910
661 Ga0495619_0021234 3300053085 Bacteria 4143
662 Ga0501084_0000494 3300054114 Bacteria 30250
663 Ga0501084_0002049 3300054114 Bacteria 16089
664 Ga0501084_0002997 3300054114 Bacteria 13675
665 Ga0501084_0004153 3300054114 Bacteria 11804
666 Ga0501084_0007499 3300054114 Bacteria 8993
667 Ga0501084_0082136 3300054114 Bacteria 2704
668 Ga0501084_0125913 3300054114 Bacteria 2156
669 Ga0501084_0137166 3300054114 Bacteria 2059
670 Ga0501084_0148808 3300054114 Bacteria 1973
671 Ga0501084_0197689 3300054114 Bacteria 1696
672 Ga0501084_0239813 3300054114 Bacteria 1530
673 Ga0501084_0250168 3300054114 Bacteria 1496
674 Ga0501082_0000376 3300060353 Bacteria 39540
675 Ga0501082_0009499 3300060353 Bacteria 8371
676 Ga0501082_0018857 3300060353 Bacteria 5943
677 Ga0501082_0028785 3300060353 Bacteria 4785
678 Ga0501082_0029329 3300060353 Bacteria 4739
679 Ga0501082_0256403 3300060353 Bacteria 1522
680 Ga0501082_0284181 3300060353 Bacteria 1440
681 Ga0530510_0000045 3300061734 Bacteria 56772
682 Ga0530510_0000460 3300061734 Bacteria 26308
683 Ga0530510_0002276 3300061734 Bacteria 13172
684 Ga0530510_0002539 3300061734 Bacteria 12540
685 Ga0530510_0015160 3300061734 Bacteria 5442
686 Ga0530510_0017498 3300061734 Bacteria 5081
687 Ga0530510_0037506 3300061734 Bacteria 3496
688 Ga0530510_0069846 3300061734 Bacteria 2549
689 Ga0530510_0092696 3300061734 Bacteria 2205
690 Ga0530510_0134482 3300061734 Bacteria 1820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0491669 Ga0501072_0491669_19_837 272
2 3300050509 nmdc:mga0qj67_639520_c1 nmdc:mga0qj67_639520_c1_19_837 272
3 3300049576 Ga0501040_0230401 Ga0501040_0230401_479_1300 273
4 3300050510 nmdc:mga06r32_701929_c1 nmdc:mga06r32_701929_c1_14_835 273
5 3300050512 nmdc:mga0n895_356462_c1 nmdc:mga0n895_356462_c1_621_1442 273
6 3300050515 nmdc:mga0a205_225470_c1 nmdc:mga0a205_225470_c1_27_851 274
7 3300027378 Ga0209981_1005557 Ga0209981_10055572 279
8 3300031548 Ga0307408_100289440 Ga0307408_1002894401 282
9 3300031731 Ga0307405_10161862 Ga0307405_101618623 282
10 3300032002 Ga0307416_100097447 Ga0307416_1000974472 282
11 3300005546 Ga0070696_100072427 Ga0070696_1000724274 283
12 3300006844 Ga0075428_100029927 Ga0075428_1000299274 284
13 3300006847 Ga0075431_100002219 Ga0075431_10000221911 284
14 3300006880 Ga0075429_100013922 Ga0075429_1000139226 284
15 3300009147 Ga0114129_10002578 Ga0114129_100025785 284
16 3300050507 nmdc:mga05p37_733_c1 nmdc:mga05p37_733_c1_32222_33130 284
17 3300050508 nmdc:mga09592_6707_c1 nmdc:mga09592_6707_c1_7105_8013 284
18 3300050509 nmdc:mga0qj67_300724_c1 nmdc:mga0qj67_300724_c1_14_922 284
19 3300050510 nmdc:mga06r32_8388_c1 nmdc:mga06r32_8388_c1_8056_8964 284
20 3300005719 Ga0068861_100200085 Ga0068861_1002000852 285
21 3300006844 Ga0075428_100043256 Ga0075428_1000432563 285
22 3300006852 Ga0075433_10127796 Ga0075433_101277963 285
23 3300006871 Ga0075434_100439041 Ga0075434_1004390412 285
24 3300007076 Ga0075435_100366274 Ga0075435_1003662742 285
25 3300009094 Ga0111539_10109518 Ga0111539_101095184 285
26 3300026118 Ga0207675_100466114 Ga0207675_1004661141 285
27 3300027907 Ga0207428_10174593 Ga0207428_101745932 285
28 3300046537 Ga0495598_0026656 Ga0495598_0026656_388_1302 285
29 3300050511 nmdc:mga08y16_272246_c1 nmdc:mga08y16_272246_c1_639_1553 285
30 3300049587 Ga0501071_0187157 Ga0501071_0187157_575_1486 286
31 3300006914 Ga0075436_100032734 Ga0075436_1000327345 287
32 3300049577 Ga0501041_0167657 Ga0501041_0167657_437_1300 287
33 3300049588 Ga0501072_0043833 Ga0501072_0043833_1779_2693 287
34 3300049743 Ga0501081_0337409 Ga0501081_0337409_135_1049 287
35 3300050514 nmdc:mga08x19_106914_c1 nmdc:mga08x19_106914_c1_347_1261 287
36 3300034820 Ga0373959_0012217 Ga0373959_0012217_14_880 288
37 3300049580 Ga0501046_0331720 Ga0501046_0331720_229_1095 288
38 3300049588 Ga0501072_0273737 Ga0501072_0273737_421_1287 288
39 3300050507 nmdc:mga05p37_51237_c1 nmdc:mga05p37_51237_c1_4003_4869 288
40 3300005445 Ga0070708_100027139 Ga0070708_1000271392 292
41 3300005546 Ga0070696_100032605 Ga0070696_1000326053 292
42 3300005549 Ga0070704_100135223 Ga0070704_1001352232 292
43 3300006931 Ga0097620_100134776 Ga0097620_1001347762 292
44 3300007265 Ga0099794_10055000 Ga0099794_100550002 292
45 3300009094 Ga0111539_10099499 Ga0111539_100994993 292
46 3300013297 Ga0157378_10076143 Ga0157378_100761434 292
47 3300026089 Ga0207648_10110675 Ga0207648_101106751 292
48 3300050507 nmdc:mga05p37_227346_c1 nmdc:mga05p37_227346_c1_56_964 292
49 3300050511 nmdc:mga08y16_165516_c1 nmdc:mga08y16_165516_c1_922_1836 292
50 3300049580 Ga0501046_0174207 Ga0501046_0174207_221_1156 293
51 3300049743 Ga0501081_0089925 Ga0501081_0089925_562_1476 293
52 3300006852 Ga0075433_10003861 Ga0075433_100038617 294
53 3300006871 Ga0075434_100036682 Ga0075434_1000366823 294
54 3300006914 Ga0075436_100001117 Ga0075436_1000011177 294
55 3300007076 Ga0075435_100029753 Ga0075435_1000297535 294
56 3300009147 Ga0114129_10006119 Ga0114129_1000611912 294
57 3300050507 nmdc:mga05p37_571_c1 nmdc:mga05p37_571_c1_12367_13290 294
58 3300050512 nmdc:mga0n895_26_c1 nmdc:mga0n895_26_c1_58110_59033 294
59 3300050513 nmdc:mga0rr50_1853_c1 nmdc:mga0rr50_1853_c1_6099_7022 294
60 3300050514 nmdc:mga08x19_399_c1 nmdc:mga08x19_399_c1_7910_8833 294
61 3300050515 nmdc:mga0a205_329_c1 nmdc:mga0a205_329_c1_31403_32326 294
62 3300005353 Ga0070669_100155814 Ga0070669_1001558141 295
63 3300006844 Ga0075428_100016534 Ga0075428_1000165343 295
64 3300006847 Ga0075431_100164022 Ga0075431_1001640222 295
65 3300006847 Ga0075431_100538410 Ga0075431_1005384102 295
66 3300006852 Ga0075433_10417822 Ga0075433_104178222 295
67 3300006880 Ga0075429_100010160 Ga0075429_1000101605 295
68 3300009094 Ga0111539_10011342 Ga0111539_100113427 295
69 3300009147 Ga0114129_10044350 Ga0114129_100443503 295
70 3300025923 Ga0207681_10198957 Ga0207681_101989573 295
71 3300027907 Ga0207428_10022910 Ga0207428_100229106 295
72 3300042876 Ga0451577_0011665 Ga0451577_0011665_3084_3974 295
73 3300050507 nmdc:mga05p37_19006_c1 nmdc:mga05p37_19006_c1_4241_5164 295
74 3300050508 nmdc:mga09592_13762_c1 nmdc:mga09592_13762_c1_620_1543 295
75 3300050510 nmdc:mga06r32_380548_c1 nmdc:mga06r32_380548_c1_252_1175 295
76 3300050511 nmdc:mga08y16_15975_c1 nmdc:mga08y16_15975_c1_3266_4189 295
77 3300050515 nmdc:mga0a205_25642_c1 nmdc:mga0a205_25642_c1_3190_4113 295
78 3300027671 Ga0209588_1010800 Ga0209588_10108002 296
79 3300049591 Ga0501075_0051359 Ga0501075_0051359_66_956 296
80 3300010375 Ga0105239_10513261 Ga0105239_105132611 297
81 3300013100 Ga0157373_10018199 Ga0157373_100181993 297
82 3300013105 Ga0157369_10028864 Ga0157369_100288646 297
83 3300013297 Ga0157378_10112151 Ga0157378_101121513 297
84 3300015262 Ga0182007_10015372 Ga0182007_100153724 297
85 3300046472 Ga0495580_0351528 Ga0495580_0351528_79_972 297
86 3300049587 Ga0501071_0396971 Ga0501071_0396971_141_1034 297
87 3300049592 Ga0501076_0016721 Ga0501076_0016721_4412_5305 297
88 3300049741 Ga0501079_0200500 Ga0501079_0200500_617_1510 297
89 3300049743 Ga0501081_0102409 Ga0501081_0102409_674_1567 297
90 3300050511 nmdc:mga08y16_589741_c1 nmdc:mga08y16_589741_c1_12_905 297
91 3300061734 Ga0530510_0134482 Ga0530510_0134482_44_937 297
92 3300005981 Ga0081538_10003971 Ga0081538_100039715 301
93 3300009101 Ga0105247_10097035 Ga0105247_100970351 301
94 3300009177 Ga0105248_10777860 Ga0105248_107778602 301
95 3300009553 Ga0105249_10106027 Ga0105249_101060273 301
96 3300013306 Ga0163162_10144116 Ga0163162_101441162 301
97 3300013308 Ga0157375_10336270 Ga0157375_103362703 301
98 3300034817 Ga0373948_0002216 Ga0373948_0002216_1724_2629 301
99 3300042876 Ga0451577_0163289 Ga0451577_0163289_147_1052 301
100 3300045051 Ga0451576_0042261 Ga0451576_0042261_3788_4693 301
101 3300049570 Ga0501033_0254184 Ga0501033_0254184_36_953 301
102 3300049580 Ga0501046_0249105 Ga0501046_0249105_112_1029 301
103 3300005445 Ga0070708_100002805 Ga0070708_1000028056 302
104 3300005467 Ga0070706_100006899 Ga0070706_1000068999 302
105 3300005468 Ga0070707_100003230 Ga0070707_1000032306 302
106 3300005471 Ga0070698_100002229 Ga0070698_10000222913 302
107 3300005518 Ga0070699_100002125 Ga0070699_1000021256 302
108 3300005536 Ga0070697_100007241 Ga0070697_1000072414 302
109 3300005536 Ga0070697_100054038 Ga0070697_1000540382 302
110 3300005546 Ga0070696_100178770 Ga0070696_1001787702 302
111 3300005985 Ga0081539_10000092 Ga0081539_10000092121 302
112 3300006844 Ga0075428_100000421 Ga0075428_10000042111 302
113 3300006844 Ga0075428_100142719 Ga0075428_1001427194 302
114 3300006846 Ga0075430_100096687 Ga0075430_1000966873 302
115 3300006846 Ga0075430_100308728 Ga0075430_1003087282 302
116 3300006847 Ga0075431_100002638 Ga0075431_10000263819 302
117 3300006847 Ga0075431_100004853 Ga0075431_10000485311 302
118 3300006847 Ga0075431_100103692 Ga0075431_1001036923 302
119 3300006847 Ga0075431_100175556 Ga0075431_1001755563 302
120 3300006847 Ga0075431_100294664 Ga0075431_1002946643 302
121 3300006852 Ga0075433_10069220 Ga0075433_100692204 302
122 3300006852 Ga0075433_10392078 Ga0075433_103920782 302
123 3300006871 Ga0075434_100123165 Ga0075434_1001231653 302
124 3300006880 Ga0075429_100010628 Ga0075429_1000106286 302
125 3300006880 Ga0075429_100045044 Ga0075429_1000450442 302
126 3300006880 Ga0075429_100066718 Ga0075429_1000667183 302
127 3300009147 Ga0114129_10000726 Ga0114129_1000072632 302
128 3300009147 Ga0114129_10001085 Ga0114129_100010851 302
129 3300009147 Ga0114129_10064549 Ga0114129_100645494 302
130 3300009147 Ga0114129_10072614 Ga0114129_100726145 302
131 3300009147 Ga0114129_10169162 Ga0114129_101691623 302
132 3300025910 Ga0207684_10000242 Ga0207684_1000024224 302
133 3300025922 Ga0207646_10000574 Ga0207646_1000057439 302
134 3300027695 Ga0209966_1022285 Ga0209966_10222852 302
135 3300031548 Ga0307408_100019764 Ga0307408_1000197644 302
136 3300031995 Ga0307409_100018640 Ga0307409_1000186406 302
137 3300031995 Ga0307409_100035154 Ga0307409_1000351543 302
138 3300032005 Ga0307411_10528467 Ga0307411_105284671 302
139 3300032126 Ga0307415_100303893 Ga0307415_1003038931 302
140 3300049572 Ga0501036_0400432 Ga0501036_0400432_73_981 302
141 3300049575 Ga0501039_0109802 Ga0501039_0109802_266_1174 302
142 3300049578 Ga0501042_0269252 Ga0501042_0269252_92_1000 302
143 3300049580 Ga0501046_0036544 Ga0501046_0036544_994_1902 302
144 3300049584 Ga0501068_0050008 Ga0501068_0050008_196_1104 302
145 3300049585 Ga0501069_0055638 Ga0501069_0055638_937_1845 302
146 3300049587 Ga0501071_0181561 Ga0501071_0181561_575_1483 302
147 3300049588 Ga0501072_0038391 Ga0501072_0038391_73_981 302
148 3300049590 Ga0501074_0191218 Ga0501074_0191218_48_956 302
149 3300049590 Ga0501074_0300827 Ga0501074_0300827_210_1118 302
150 3300049591 Ga0501075_0000742 Ga0501075_0000742_11483_12391 302
151 3300049591 Ga0501075_0063924 Ga0501075_0063924_1214_2122 302
152 3300049591 Ga0501075_0257741 Ga0501075_0257741_330_1238 302
153 3300049591 Ga0501075_0323316 Ga0501075_0323316_24_932 302
154 3300049592 Ga0501076_0001694 Ga0501076_0001694_10708_11616 302
155 3300049592 Ga0501076_0002350 Ga0501076_0002350_476_1384 302
156 3300049593 Ga0501077_0001222 Ga0501077_0001222_5571_6479 302
157 3300049593 Ga0501077_0045127 Ga0501077_0045127_79_987 302
158 3300049741 Ga0501079_0000847 Ga0501079_0000847_10766_11674 302
159 3300049741 Ga0501079_0005662 Ga0501079_0005662_5994_6902 302
160 3300049743 Ga0501081_0002829 Ga0501081_0002829_1685_2593 302
161 3300049743 Ga0501081_0038636 Ga0501081_0038636_1505_2413 302
162 3300049743 Ga0501081_0056095 Ga0501081_0056095_183_1091 302
163 3300049743 Ga0501081_0317062 Ga0501081_0317062_213_1121 302
164 3300049824 Ga0501045_0303483 Ga0501045_0303483_38_946 302
165 3300050507 nmdc:mga05p37_114160_c1 nmdc:mga05p37_114160_c1_821_1729 302
166 3300050507 nmdc:mga05p37_280974_c1 nmdc:mga05p37_280974_c1_1057_1965 302
167 3300050507 nmdc:mga05p37_33272_c1 nmdc:mga05p37_33272_c1_583_1491 302
168 3300050507 nmdc:mga05p37_46194_c1 nmdc:mga05p37_46194_c1_2213_3121 302
169 3300050507 nmdc:mga05p37_55867_c1 nmdc:mga05p37_55867_c1_1448_2356 302
170 3300050507 nmdc:mga05p37_7326_c1 nmdc:mga05p37_7326_c1_4274_5182 302
171 3300050508 nmdc:mga09592_36768_c1 nmdc:mga09592_36768_c1_2743_3651 302
172 3300050508 nmdc:mga09592_44015_c1 nmdc:mga09592_44015_c1_2473_3381 302
173 3300050508 nmdc:mga09592_47056_c1 nmdc:mga09592_47056_c1_1117_2025 302
174 3300050508 nmdc:mga09592_5510_c1 nmdc:mga09592_5510_c1_8140_9048 302
175 3300050509 nmdc:mga0qj67_28264_c1 nmdc:mga0qj67_28264_c1_277_1185 302
176 3300050509 nmdc:mga0qj67_85066_c1 nmdc:mga0qj67_85066_c1_635_1543 302
177 3300050510 nmdc:mga06r32_132_c1 nmdc:mga06r32_132_c1_11583_12491 302
178 3300050510 nmdc:mga06r32_344052_c1 nmdc:mga06r32_344052_c1_510_1418 302
179 3300050510 nmdc:mga06r32_53897_c1 nmdc:mga06r32_53897_c1_1631_2539 302
180 3300050512 nmdc:mga0n895_10415_c1 nmdc:mga0n895_10415_c1_3855_4763 302
181 3300050512 nmdc:mga0n895_162730_c1 nmdc:mga0n895_162730_c1_287_1195 302
182 3300050515 nmdc:mga0a205_47042_c1 nmdc:mga0a205_47042_c1_597_1505 302
183 3300054114 Ga0501084_0007499 Ga0501084_0007499_5556_6464 302
184 3300054114 Ga0501084_0197689 Ga0501084_0197689_203_1111 302
185 3300061734 Ga0530510_0069846 Ga0530510_0069846_181_1089 302
186 3300005530 Ga0070679_100151411 Ga0070679_1001514113 303
187 3300006846 Ga0075430_100000341 Ga0075430_1000003419 303
188 3300006847 Ga0075431_100000470 Ga0075431_10000047024 303
189 3300025921 Ga0207652_10129849 Ga0207652_101298492 303
190 3300025961 Ga0207712_10247477 Ga0207712_102474772 303
191 3300035088 Ga0373940_0082375 Ga0373940_0082375_10_921 303
192 3300035114 Ga0373939_0016956 Ga0373939_0016956_390_1301 303
193 3300035691 Ga0373931_0015664 Ga0373931_0015664_76_987 303
194 3300042876 Ga0451577_0064518 Ga0451577_0064518_197_1108 303
195 3300048906 Ga0496103_0200311 Ga0496103_0200311_147_1058 303
196 3300049588 Ga0501072_0011064 Ga0501072_0011064_5416_6327 303
197 3300050509 nmdc:mga0qj67_761_c1 nmdc:mga0qj67_761_c1_14022_14933 303
198 3300050510 nmdc:mga06r32_37690_c1 nmdc:mga06r32_37690_c1_1944_2855 303
199 3300006846 Ga0075430_100002061 Ga0075430_1000020617 304
200 3300006847 Ga0075431_100002902 Ga0075431_1000029027 304
201 3300006880 Ga0075429_100000305 Ga0075429_10000030517 304
202 3300006914 Ga0075436_100124360 Ga0075436_1001243602 304
203 3300009147 Ga0114129_10014740 Ga0114129_100147407 304
204 3300009147 Ga0114129_10021486 Ga0114129_100214862 304
205 3300009148 Ga0105243_10061888 Ga0105243_100618883 304
206 3300009174 Ga0105241_10048576 Ga0105241_100485764 304
207 3300013306 Ga0163162_10028990 Ga0163162_100289904 304
208 3300025923 Ga0207681_10005715 Ga0207681_100057156 304
209 3300025933 Ga0207706_10043062 Ga0207706_100430624 304
210 3300025935 Ga0207709_10048952 Ga0207709_100489523 304
211 3300025940 Ga0207691_10011340 Ga0207691_100113406 304
212 3300028381 Ga0268264_10030442 Ga0268264_100304423 304
213 3300037312 Ga0395899_0033281 Ga0395899_0033281_2527_3441 304
214 3300037418 Ga0395900_0003509 Ga0395900_0003509_6299_7213 304
215 3300037466 Ga0395898_0013339 Ga0395898_0013339_625_1539 304
216 3300038443 Ga0395901_0011843 Ga0395901_0011843_505_1419 304
217 3300046528 Ga0495642_0104950 Ga0495642_0104950_227_1141 304
218 3300046684 Ga0495669_0020026 Ga0495669_0020026_267_1181 304
219 3300048909 Ga0496106_0186716 Ga0496106_0186716_696_1610 304
220 3300048909 Ga0496106_0210911 Ga0496106_0210911_471_1385 304
221 3300050507 nmdc:mga05p37_54516_c1 nmdc:mga05p37_54516_c1_414_1328 304
222 3300050508 nmdc:mga09592_56_c1 nmdc:mga09592_56_c1_52254_53168 304
223 3300050509 nmdc:mga0qj67_711_c1 nmdc:mga0qj67_711_c1_5498_6412 304
224 3300050510 nmdc:mga06r32_1136_c1 nmdc:mga06r32_1136_c1_6736_7650 304
225 3300050512 nmdc:mga0n895_232972_c1 nmdc:mga0n895_232972_c1_936_1850 304
226 3300005518 Ga0070699_100010069 Ga0070699_1000100695 305
227 3300005536 Ga0070697_100020405 Ga0070697_1000204055 305
228 3300005844 Ga0068862_100046444 Ga0068862_1000464443 306
229 3300006847 Ga0075431_100464602 Ga0075431_1004646021 306
230 3300006852 Ga0075433_10001399 Ga0075433_100013996 306
231 3300006852 Ga0075433_10029437 Ga0075433_100294374 306
232 3300006852 Ga0075433_10120453 Ga0075433_101204533 306
233 3300006871 Ga0075434_100000107 Ga0075434_10000010717 306
234 3300006871 Ga0075434_100001918 Ga0075434_10000191813 306
235 3300006880 Ga0075429_100266545 Ga0075429_1002665453 306
236 3300007076 Ga0075435_100004640 Ga0075435_1000046407 306
237 3300007076 Ga0075435_100010546 Ga0075435_1000105465 306
238 3300009147 Ga0114129_10000704 Ga0114129_1000070411 306
239 3300009147 Ga0114129_10002365 Ga0114129_1000236511 306
240 3300013297 Ga0157378_10454229 Ga0157378_104542292 306
241 3300028380 Ga0268265_10082887 Ga0268265_100828873 306
242 3300028381 Ga0268264_10143668 Ga0268264_101436683 306
243 3300035090 Ga0373949_0019418 Ga0373949_0019418_384_1304 306
244 3300035691 Ga0373931_0106101 Ga0373931_0106101_240_1160 306
245 3300042876 Ga0451577_0284928 Ga0451577_0284928_422_1342 306
246 3300046472 Ga0495580_0005537 Ga0495580_0005537_7927_8847 306
247 3300046684 Ga0495669_0089338 Ga0495669_0089338_223_1143 306
248 3300050507 nmdc:mga05p37_4740_c1 nmdc:mga05p37_4740_c1_2076_2996 306
249 3300050510 nmdc:mga06r32_295283_c1 nmdc:mga06r32_295283_c1_145_1065 306
250 3300050512 nmdc:mga0n895_2702_c1 nmdc:mga0n895_2702_c1_10546_11466 306
251 3300050512 nmdc:mga0n895_37967_c1 nmdc:mga0n895_37967_c1_458_1378 306
252 3300050512 nmdc:mga0n895_91060_c1 nmdc:mga0n895_91060_c1_1129_2049 306
253 3300050513 nmdc:mga0rr50_25401_c1 nmdc:mga0rr50_25401_c1_2233_3153 306
254 3300050513 nmdc:mga0rr50_5485_c1 nmdc:mga0rr50_5485_c1_1281_2201 306
255 3300050513 nmdc:mga0rr50_95422_c1 nmdc:mga0rr50_95422_c1_680_1600 306
256 3300050514 nmdc:mga08x19_111959_c1 nmdc:mga08x19_111959_c1_870_1790 306
257 3300050515 nmdc:mga0a205_25936_c1 nmdc:mga0a205_25936_c1_998_1918 306
258 3300050515 nmdc:mga0a205_32_c1 nmdc:mga0a205_32_c1_14667_15587 306
259 3300005445 Ga0070708_100234326 Ga0070708_1002343263 307
260 3300005467 Ga0070706_100067102 Ga0070706_1000671022 307
261 3300005536 Ga0070697_100144847 Ga0070697_1001448472 307
262 3300005544 Ga0070686_100243678 Ga0070686_1002436781 307
263 3300006844 Ga0075428_100568227 Ga0075428_1005682272 307
264 3300006846 Ga0075430_100005238 Ga0075430_1000052382 307
265 3300006847 Ga0075431_100103039 Ga0075431_1001030393 307
266 3300006847 Ga0075431_100166959 Ga0075431_1001669592 307
267 3300006852 Ga0075433_10108867 Ga0075433_101088672 307
268 3300006914 Ga0075436_100299249 Ga0075436_1002992491 307
269 3300007076 Ga0075435_100163965 Ga0075435_1001639653 307
270 3300009094 Ga0111539_10008896 Ga0111539_100088969 307
271 3300009094 Ga0111539_10152793 Ga0111539_101527933 307
272 3300009147 Ga0114129_10000497 Ga0114129_1000049744 307
273 3300009147 Ga0114129_10034166 Ga0114129_100341664 307
274 3300009147 Ga0114129_10164893 Ga0114129_101648932 307
275 3300009147 Ga0114129_10234984 Ga0114129_102349842 307
276 3300025910 Ga0207684_10045384 Ga0207684_100453843 307
277 3300025922 Ga0207646_10026137 Ga0207646_100261372 307
278 3300025933 Ga0207706_10310932 Ga0207706_103109322 307
279 3300027907 Ga0207428_10000033 Ga0207428_1000003334 307
280 3300035114 Ga0373939_0025450 Ga0373939_0025450_292_1215 307
281 3300035121 Ga0373960_0033821 Ga0373960_0033821_508_1431 307
282 3300035691 Ga0373931_0069245 Ga0373931_0069245_486_1409 307
283 3300045051 Ga0451576_0111360 Ga0451576_0111360_1891_2829 307
284 3300047318 Ga0495636_0048646 Ga0495636_0048646_565_1488 307
285 3300049570 Ga0501033_0261497 Ga0501033_0261497_225_1148 307
286 3300049572 Ga0501036_0040793 Ga0501036_0040793_2918_3856 307
287 3300049572 Ga0501036_0070650 Ga0501036_0070650_999_1937 307
288 3300049574 Ga0501038_0007239 Ga0501038_0007239_4203_5141 307
289 3300049574 Ga0501038_0040088 Ga0501038_0040088_2551_3489 307
290 3300049574 Ga0501038_0125500 Ga0501038_0125500_1109_2062 307
291 3300049574 Ga0501038_0219693 Ga0501038_0219693_160_1098 307
292 3300049574 Ga0501038_0255750 Ga0501038_0255750_273_1196 307
293 3300049575 Ga0501039_0003008 Ga0501039_0003008_11523_12461 307
294 3300049575 Ga0501039_0020459 Ga0501039_0020459_3859_4797 307
295 3300049575 Ga0501039_0040095 Ga0501039_0040095_279_1232 307
296 3300049576 Ga0501040_0000372 Ga0501040_0000372_1116_2054 307
297 3300049576 Ga0501040_0012033 Ga0501040_0012033_1831_2769 307
298 3300049576 Ga0501040_0021721 Ga0501040_0021721_2564_3517 307
299 3300049576 Ga0501040_0353630 Ga0501040_0353630_111_1037 307
300 3300049577 Ga0501041_0000313 Ga0501041_0000313_21316_22254 307
301 3300049577 Ga0501041_0004305 Ga0501041_0004305_5809_6747 307
302 3300049577 Ga0501041_0090684 Ga0501041_0090684_528_1481 307
303 3300049578 Ga0501042_0001568 Ga0501042_0001568_1356_2294 307
304 3300049578 Ga0501042_0172982 Ga0501042_0172982_264_1217 307
305 3300049579 Ga0501043_0036352 Ga0501043_0036352_2332_3270 307
306 3300049580 Ga0501046_0004108 Ga0501046_0004108_12228_13166 307
307 3300049580 Ga0501046_0038740 Ga0501046_0038740_2756_3709 307
308 3300049582 Ga0501048_0003731 Ga0501048_0003731_1242_2180 307
309 3300049582 Ga0501048_0007331 Ga0501048_0007331_2451_3389 307
310 3300049584 Ga0501068_0143782 Ga0501068_0143782_262_1200 307
311 3300049584 Ga0501068_0166247 Ga0501068_0166247_214_1167 307
312 3300049587 Ga0501071_0004236 Ga0501071_0004236_4051_4989 307
313 3300049587 Ga0501071_0022346 Ga0501071_0022346_766_1704 307
314 3300049588 Ga0501072_0002328 Ga0501072_0002328_1220_2158 307
315 3300049588 Ga0501072_0006474 Ga0501072_0006474_4521_5474 307
316 3300049588 Ga0501072_0021799 Ga0501072_0021799_40_978 307
317 3300049588 Ga0501072_0076813 Ga0501072_0076813_1545_2483 307
318 3300049590 Ga0501074_0002904 Ga0501074_0002904_9208_10146 307
319 3300049591 Ga0501075_0000734 Ga0501075_0000734_4220_5158 307
320 3300049591 Ga0501075_0210943 Ga0501075_0210943_179_1132 307
321 3300049592 Ga0501076_0001282 Ga0501076_0001282_10816_11754 307
322 3300049592 Ga0501076_0021097 Ga0501076_0021097_2932_3885 307
323 3300049593 Ga0501077_0001630 Ga0501077_0001630_515_1453 307
324 3300049593 Ga0501077_0022560 Ga0501077_0022560_1965_2918 307
325 3300049741 Ga0501079_0000347 Ga0501079_0000347_1028_1966 307
326 3300049741 Ga0501079_0003926 Ga0501079_0003926_8427_9365 307
327 3300049741 Ga0501079_0031768 Ga0501079_0031768_2218_3171 307
328 3300049741 Ga0501079_0076646 Ga0501079_0076646_913_1851 307
329 3300049742 Ga0501080_0000373 Ga0501080_0000373_29113_30051 307
330 3300049742 Ga0501080_0155503 Ga0501080_0155503_436_1374 307
331 3300049743 Ga0501081_0002261 Ga0501081_0002261_3821_4759 307
332 3300049743 Ga0501081_0003242 Ga0501081_0003242_8742_9680 307
333 3300049744 Ga0501083_0135426 Ga0501083_0135426_364_1302 307
334 3300049824 Ga0501045_0000024 Ga0501045_0000024_47963_48901 307
335 3300049824 Ga0501045_0202453 Ga0501045_0202453_404_1327 307
336 3300050507 nmdc:mga05p37_239485_c1 nmdc:mga05p37_239485_c1_89_1012 307
337 3300050507 nmdc:mga05p37_240176_c1 nmdc:mga05p37_240176_c1_418_1341 307
338 3300050507 nmdc:mga05p37_3760_c1 nmdc:mga05p37_3760_c1_15078_16016 307
339 3300050508 nmdc:mga09592_13717_c1 nmdc:mga09592_13717_c1_4463_5386 307
340 3300050511 nmdc:mga08y16_13982_c1 nmdc:mga08y16_13982_c1_3712_4635 307
341 3300050513 nmdc:mga0rr50_23170_c1 nmdc:mga0rr50_23170_c1_113_1036 307
342 3300050514 nmdc:mga08x19_223715_c1 nmdc:mga08x19_223715_c1_47_970 307
343 3300050515 nmdc:mga0a205_123092_c1 nmdc:mga0a205_123092_c1_741_1679 307
344 3300054114 Ga0501084_0002049 Ga0501084_0002049_11567_12505 307
345 3300054114 Ga0501084_0002997 Ga0501084_0002997_11799_12737 307
346 3300054114 Ga0501084_0148808 Ga0501084_0148808_444_1382 307
347 3300054114 Ga0501084_0239813 Ga0501084_0239813_429_1382 307
348 3300060353 Ga0501082_0009499 Ga0501082_0009499_3119_4057 307
349 3300060353 Ga0501082_0018857 Ga0501082_0018857_4343_5281 307
350 3300061734 Ga0530510_0000045 Ga0530510_0000045_48328_49266 307
351 3300061734 Ga0530510_0002276 Ga0530510_0002276_1365_2303 307
352 3300061734 Ga0530510_0015160 Ga0530510_0015160_258_1196 307
353 3300061734 Ga0530510_0017498 Ga0530510_0017498_2756_3709 307
354 3300049591 Ga0501075_0002306 Ga0501075_0002306_4527_5456 308
355 3300049741 Ga0501079_0183508 Ga0501079_0183508_637_1566 308
356 3300049742 Ga0501080_0060310 Ga0501080_0060310_2527_3456 308
357 3300049742 Ga0501080_0117195 Ga0501080_0117195_679_1608 308
358 3300061734 Ga0530510_0092696 Ga0530510_0092696_687_1616 308
359 3300006844 Ga0075428_100008551 Ga0075428_10000855110 309
360 3300006846 Ga0075430_100007544 Ga0075430_1000075444 309
361 3300006847 Ga0075431_100000452 Ga0075431_10000045230 309
362 3300006847 Ga0075431_100009244 Ga0075431_1000092449 309
363 3300006880 Ga0075429_100003918 Ga0075429_10000391811 309
364 3300006880 Ga0075429_100062017 Ga0075429_1000620172 309
365 3300006880 Ga0075429_100144592 Ga0075429_1001445922 309
366 3300009147 Ga0114129_10006298 Ga0114129_100062988 309
367 3300032002 Ga0307416_100102901 Ga0307416_1001029012 309
368 3300049572 Ga0501036_0049407 Ga0501036_0049407_2296_3228 309
369 3300049576 Ga0501040_0173969 Ga0501040_0173969_198_1130 309
370 3300049578 Ga0501042_0127595 Ga0501042_0127595_701_1633 309
371 3300049591 Ga0501075_0026883 Ga0501075_0026883_2576_3508 309
372 3300049592 Ga0501076_0103709 Ga0501076_0103709_1146_2078 309
373 3300049593 Ga0501077_0035033 Ga0501077_0035033_649_1581 309
374 3300049741 Ga0501079_0044595 Ga0501079_0044595_1833_2765 309
375 3300049824 Ga0501045_0239977 Ga0501045_0239977_395_1327 309
376 3300050507 nmdc:mga05p37_7533_c1 nmdc:mga05p37_7533_c1_4457_5398 309
377 3300050508 nmdc:mga09592_10815_c1 nmdc:mga09592_10815_c1_4430_5371 309
378 3300050508 nmdc:mga09592_227935_c1 nmdc:mga09592_227935_c1_153_1094 309
379 3300050508 nmdc:mga09592_32609_c1 nmdc:mga09592_32609_c1_1018_1947 309
380 3300050509 nmdc:mga0qj67_18157_c1 nmdc:mga0qj67_18157_c1_1424_2353 309
381 3300050509 nmdc:mga0qj67_3409_c1 nmdc:mga0qj67_3409_c1_2999_3940 309
382 3300050509 nmdc:mga0qj67_4522_c1 nmdc:mga0qj67_4522_c1_7177_8118 309
383 3300050510 nmdc:mga06r32_12631_c1 nmdc:mga06r32_12631_c1_4455_5396 309
384 3300050510 nmdc:mga06r32_48513_c1 nmdc:mga06r32_48513_c1_122_1051 309
385 3300053077 Ga0495601_0000902 Ga0495601_0000902_7634_8563 309
386 3300053084 Ga0495595_0051409 Ga0495595_0051409_375_1304 309
387 3300053085 Ga0495619_0021234 Ga0495619_0021234_1728_2657 309
388 3300054114 Ga0501084_0082136 Ga0501084_0082136_1732_2664 309
389 3300061734 Ga0530510_0000460 Ga0530510_0000460_8599_9531 309
390 3300006880 Ga0075429_100164495 Ga0075429_1001644953 312
391 3300009147 Ga0114129_10271162 Ga0114129_102711623 312
392 3300050508 nmdc:mga09592_218002_c1 nmdc:mga09592_218002_c1_162_1100 312
393 3300005330 Ga0070690_100207673 Ga0070690_1002076731 313
394 3300005345 Ga0070692_10019280 Ga0070692_100192802 313
395 3300005438 Ga0070701_10021820 Ga0070701_100218202 313
396 3300005467 Ga0070706_100397654 Ga0070706_1003976541 313
397 3300005468 Ga0070707_100004373 Ga0070707_1000043734 313
398 3300005468 Ga0070707_100006735 Ga0070707_1000067356 313
399 3300005518 Ga0070699_100425884 Ga0070699_1004258841 313
400 3300005544 Ga0070686_100120636 Ga0070686_1001206362 313
401 3300005615 Ga0070702_100255630 Ga0070702_1002556302 313
402 3300005617 Ga0068859_100009180 Ga0068859_1000091805 313
403 3300005843 Ga0068860_100129312 Ga0068860_1001293123 313
404 3300005844 Ga0068862_100004350 Ga0068862_1000043506 313
405 3300005844 Ga0068862_100012292 Ga0068862_1000122923 313
406 3300006844 Ga0075428_100143058 Ga0075428_1001430583 313
407 3300006844 Ga0075428_100146364 Ga0075428_1001463643 313
408 3300006847 Ga0075431_100001171 Ga0075431_1000011715 313
409 3300006852 Ga0075433_10028302 Ga0075433_100283025 313
410 3300006871 Ga0075434_100244675 Ga0075434_1002446752 313
411 3300006931 Ga0097620_100009180 Ga0097620_1000091805 313
412 3300009094 Ga0111539_10000557 Ga0111539_1000055713 313
413 3300025922 Ga0207646_10043129 Ga0207646_100431294 313
414 3300025922 Ga0207646_10062589 Ga0207646_100625893 313
415 3300025933 Ga0207706_10245545 Ga0207706_102455452 313
416 3300025961 Ga0207712_10159424 Ga0207712_101594243 313
417 3300026035 Ga0207703_10111134 Ga0207703_101111342 313
418 3300026089 Ga0207648_10469557 Ga0207648_104695571 313
419 3300026118 Ga0207675_100074739 Ga0207675_1000747394 313
420 3300027907 Ga0207428_10000054 Ga0207428_10000054111 313
421 3300028380 Ga0268265_10008213 Ga0268265_100082137 313
422 3300028380 Ga0268265_10015396 Ga0268265_100153961 313
423 3300028381 Ga0268264_10078705 Ga0268264_100787054 313
424 3300042876 Ga0451577_0013723 Ga0451577_0013723_6315_7259 313
425 3300044712 Ga0453684_0135624 Ga0453684_0135624_1632_2576 313
426 3300045051 Ga0451576_0017829 Ga0451576_0017829_4331_5275 313
427 3300049591 Ga0501075_0037620 Ga0501075_0037620_818_1792 313
428 3300049741 Ga0501079_0133394 Ga0501079_0133394_99_1073 313
429 3300049743 Ga0501081_0048334 Ga0501081_0048334_104_1078 313
430 3300050510 nmdc:mga06r32_428_c1 nmdc:mga06r32_428_c1_4392_5336 313
431 3300050511 nmdc:mga08y16_3397_c1 nmdc:mga08y16_3397_c1_4846_5790 313
432 3300050512 nmdc:mga0n895_176712_c1 nmdc:mga0n895_176712_c1_695_1639 313
433 3300054114 Ga0501084_0125913 Ga0501084_0125913_70_1044 313
434 3300005293 Ga0065715_10140814 Ga0065715_101408143 314
435 3300005328 Ga0070676_10004889 Ga0070676_100048895 314
436 3300005328 Ga0070676_10019457 Ga0070676_100194574 314
437 3300005331 Ga0070670_100002651 Ga0070670_1000026515 314
438 3300005334 Ga0068869_100000454 Ga0068869_10000045412 314
439 3300005334 Ga0068869_100002372 Ga0068869_1000023722 314
440 3300005334 Ga0068869_100125073 Ga0068869_1001250732 314
441 3300005336 Ga0070680_100025007 Ga0070680_1000250075 314
442 3300005336 Ga0070680_100053833 Ga0070680_1000538332 314
443 3300005336 Ga0070680_100065726 Ga0070680_1000657262 314
444 3300005337 Ga0070682_100000164 Ga0070682_10000016434 314
445 3300005339 Ga0070660_100001192 Ga0070660_10000119211 314
446 3300005340 Ga0070689_100022172 Ga0070689_1000221725 314
447 3300005341 Ga0070691_10049471 Ga0070691_100494712 314
448 3300005341 Ga0070691_10108061 Ga0070691_101080611 314
449 3300005344 Ga0070661_100007596 Ga0070661_1000075964 314
450 3300005345 Ga0070692_10000185 Ga0070692_1000018510 314
451 3300005345 Ga0070692_10004690 Ga0070692_100046906 314
452 3300005353 Ga0070669_100069938 Ga0070669_1000699382 314
453 3300005364 Ga0070673_100006759 Ga0070673_1000067594 314
454 3300005365 Ga0070688_100085022 Ga0070688_1000850223 314
455 3300005366 Ga0070659_100000169 Ga0070659_10000016913 314
456 3300005406 Ga0070703_10001360 Ga0070703_100013607 314
457 3300005406 Ga0070703_10067019 Ga0070703_100670191 314
458 3300005434 Ga0070709_10420300 Ga0070709_104203001 314
459 3300005436 Ga0070713_100269868 Ga0070713_1002698681 314
460 3300005438 Ga0070701_10000434 Ga0070701_100004345 314
461 3300005438 Ga0070701_10061258 Ga0070701_100612583 314
462 3300005440 Ga0070705_100000303 Ga0070705_1000003035 314
463 3300005440 Ga0070705_100420662 Ga0070705_1004206621 314
464 3300005444 Ga0070694_100000153 Ga0070694_10000015311 314
465 3300005444 Ga0070694_100000394 Ga0070694_10000039413 314
466 3300005444 Ga0070694_100029446 Ga0070694_1000294462 314
467 3300005444 Ga0070694_100031508 Ga0070694_1000315084 314
468 3300005445 Ga0070708_100012658 Ga0070708_1000126584 314
469 3300005445 Ga0070708_100098682 Ga0070708_1000986822 314
470 3300005455 Ga0070663_100001895 Ga0070663_1000018956 314
471 3300005457 Ga0070662_100090033 Ga0070662_1000900331 314
472 3300005458 Ga0070681_10000730 Ga0070681_100007305 314
473 3300005459 Ga0068867_100070635 Ga0068867_1000706353 314
474 3300005467 Ga0070706_100002480 Ga0070706_10000248015 314
475 3300005467 Ga0070706_100039579 Ga0070706_1000395793 314
476 3300005467 Ga0070706_100101981 Ga0070706_1001019814 314
477 3300005468 Ga0070707_100004480 Ga0070707_1000044805 314
478 3300005468 Ga0070707_100133507 Ga0070707_1001335072 314
479 3300005468 Ga0070707_100149079 Ga0070707_1001490791 314
480 3300005468 Ga0070707_100220071 Ga0070707_1002200712 314
481 3300005471 Ga0070698_100009682 Ga0070698_1000096824 314
482 3300005471 Ga0070698_100015432 Ga0070698_1000154327 314
483 3300005471 Ga0070698_100045359 Ga0070698_1000453594 314
484 3300005471 Ga0070698_100112955 Ga0070698_1001129552 314
485 3300005471 Ga0070698_100246894 Ga0070698_1002468943 314
486 3300005518 Ga0070699_100016368 Ga0070699_1000163684 314
487 3300005518 Ga0070699_100028568 Ga0070699_1000285684 314
488 3300005518 Ga0070699_100034353 Ga0070699_1000343531 314
489 3300005518 Ga0070699_100057958 Ga0070699_1000579584 314
490 3300005530 Ga0070679_100000780 Ga0070679_10000078010 314
491 3300005536 Ga0070697_100043288 Ga0070697_1000432885 314
492 3300005539 Ga0068853_100001544 Ga0068853_1000015448 314
493 3300005545 Ga0070695_100002060 Ga0070695_1000020602 314
494 3300005545 Ga0070695_100003497 Ga0070695_1000034973 314
495 3300005545 Ga0070695_100004742 Ga0070695_1000047423 314
496 3300005545 Ga0070695_100005853 Ga0070695_1000058536 314
497 3300005545 Ga0070695_100009011 Ga0070695_1000090115 314
498 3300005546 Ga0070696_100001302 Ga0070696_10000130216 314
499 3300005546 Ga0070696_100065384 Ga0070696_1000653843 314
500 3300005547 Ga0070693_100000018 Ga0070693_10000001838 314
501 3300005547 Ga0070693_100036024 Ga0070693_1000360243 314
502 3300005549 Ga0070704_100008622 Ga0070704_1000086224 314
503 3300005549 Ga0070704_100049443 Ga0070704_1000494434 314
504 3300005563 Ga0068855_100000233 Ga0068855_10000023325 314
505 3300005564 Ga0070664_100010975 Ga0070664_1000109755 314
506 3300005577 Ga0068857_100009717 Ga0068857_1000097174 314
507 3300005578 Ga0068854_100001715 Ga0068854_10000171510 314
508 3300005614 Ga0068856_100000806 Ga0068856_10000080629 314
509 3300005617 Ga0068859_100006365 Ga0068859_1000063655 314
510 3300005617 Ga0068859_100259722 Ga0068859_1002597222 314
511 3300005618 Ga0068864_100004417 Ga0068864_1000044175 314
512 3300005840 Ga0068870_10000059 Ga0068870_1000005916 314
513 3300005842 Ga0068858_100040912 Ga0068858_1000409125 314
514 3300005843 Ga0068860_100003577 Ga0068860_10000357710 314
515 3300005844 Ga0068862_100004793 Ga0068862_1000047934 314
516 3300005844 Ga0068862_100022823 Ga0068862_1000228235 314
517 3300005937 Ga0081455_10001251 Ga0081455_1000125124 314
518 3300005937 Ga0081455_10219809 Ga0081455_102198092 314
519 3300006173 Ga0070716_100031277 Ga0070716_1000312772 314
520 3300006175 Ga0070712_100001609 Ga0070712_1000016097 314
521 3300006175 Ga0070712_100274552 Ga0070712_1002745522 314
522 3300006852 Ga0075433_10003027 Ga0075433_100030273 314
523 3300006852 Ga0075433_10009505 Ga0075433_100095054 314
524 3300006871 Ga0075434_100002260 Ga0075434_1000022605 314
525 3300006871 Ga0075434_100003368 Ga0075434_1000033685 314
526 3300006871 Ga0075434_100065643 Ga0075434_1000656434 314
527 3300006871 Ga0075434_100114972 Ga0075434_1001149724 314
528 3300006914 Ga0075436_100073431 Ga0075436_1000734313 314
529 3300006931 Ga0097620_100006365 Ga0097620_1000063659 314
530 3300006931 Ga0097620_100259721 Ga0097620_1002597213 314
531 3300007076 Ga0075435_100000798 Ga0075435_1000007989 314
532 3300007076 Ga0075435_100001899 Ga0075435_1000018995 314
533 3300007076 Ga0075435_100007188 Ga0075435_1000071883 314
534 3300007076 Ga0075435_100286482 Ga0075435_1002864822 314
535 3300009098 Ga0105245_10346129 Ga0105245_103461293 314
536 3300009147 Ga0114129_10004399 Ga0114129_1000439919 314
537 3300009147 Ga0114129_10086069 Ga0114129_100860693 314
538 3300009147 Ga0114129_10265070 Ga0114129_102650704 314
539 3300009147 Ga0114129_10432212 Ga0114129_104322122 314
540 3300009148 Ga0105243_10005054 Ga0105243_100050548 314
541 3300009174 Ga0105241_10002337 Ga0105241_1000233712 314
542 3300009177 Ga0105248_10292608 Ga0105248_102926082 314
543 3300009553 Ga0105249_10018869 Ga0105249_100188693 314
544 3300013307 Ga0157372_10000846 Ga0157372_100008466 314
545 3300013307 Ga0157372_10092431 Ga0157372_100924314 314
546 3300013308 Ga0157375_10041557 Ga0157375_100415575 314
547 3300025885 Ga0207653_10001521 Ga0207653_100015214 314
548 3300025885 Ga0207653_10007870 Ga0207653_100078703 314
549 3300025904 Ga0207647_10029432 Ga0207647_100294324 314
550 3300025904 Ga0207647_10167732 Ga0207647_101677322 314
551 3300025906 Ga0207699_10317904 Ga0207699_103179042 314
552 3300025907 Ga0207645_10000340 Ga0207645_1000034031 314
553 3300025907 Ga0207645_10019898 Ga0207645_100198985 314
554 3300025908 Ga0207643_10000105 Ga0207643_1000010522 314
555 3300025910 Ga0207684_10009125 Ga0207684_100091253 314
556 3300025910 Ga0207684_10025708 Ga0207684_100257085 314
557 3300025910 Ga0207684_10102886 Ga0207684_101028864 314
558 3300025910 Ga0207684_10110774 Ga0207684_101107743 314
559 3300025910 Ga0207684_10464493 Ga0207684_104644931 314
560 3300025911 Ga0207654_10007386 Ga0207654_100073864 314
561 3300025911 Ga0207654_10107796 Ga0207654_101077962 314
562 3300025912 Ga0207707_10000034 Ga0207707_10000034140 314
563 3300025915 Ga0207693_10009502 Ga0207693_100095025 314
564 3300025915 Ga0207693_10189345 Ga0207693_101893452 314
565 3300025917 Ga0207660_10165539 Ga0207660_101655392 314
566 3300025919 Ga0207657_10000066 Ga0207657_1000006675 314
567 3300025920 Ga0207649_10027797 Ga0207649_100277972 314
568 3300025921 Ga0207652_10000740 Ga0207652_1000074029 314
569 3300025922 Ga0207646_10004220 Ga0207646_100042206 314
570 3300025922 Ga0207646_10033355 Ga0207646_100333553 314
571 3300025922 Ga0207646_10077131 Ga0207646_100771314 314
572 3300025922 Ga0207646_10162357 Ga0207646_101623573 314
573 3300025922 Ga0207646_10261551 Ga0207646_102615512 314
574 3300025925 Ga0207650_10031007 Ga0207650_100310074 314
575 3300025928 Ga0207700_10219506 Ga0207700_102195063 314
576 3300025932 Ga0207690_10001729 Ga0207690_100017296 314
577 3300025933 Ga0207706_10273292 Ga0207706_102732922 314
578 3300025942 Ga0207689_10000365 Ga0207689_1000036526 314
579 3300025942 Ga0207689_10004878 Ga0207689_100048783 314
580 3300025942 Ga0207689_10193462 Ga0207689_101934622 314
581 3300025945 Ga0207679_10000248 Ga0207679_1000024825 314
582 3300025949 Ga0207667_10000790 Ga0207667_1000079034 314
583 3300025960 Ga0207651_10030135 Ga0207651_100301354 314
584 3300025981 Ga0207640_10003504 Ga0207640_100035044 314
585 3300026041 Ga0207639_10017235 Ga0207639_100172353 314
586 3300026067 Ga0207678_10002576 Ga0207678_1000257612 314
587 3300026075 Ga0207708_10011344 Ga0207708_100113443 314
588 3300026089 Ga0207648_10000856 Ga0207648_1000085630 314
589 3300026089 Ga0207648_10132025 Ga0207648_101320253 314
590 3300026095 Ga0207676_10024755 Ga0207676_100247555 314
591 3300026116 Ga0207674_10000050 Ga0207674_1000005095 314
592 3300027424 Ga0209984_1005626 Ga0209984_10056262 314
593 3300027462 Ga0210000_1003329 Ga0210000_10033292 314
594 3300027471 Ga0209995_1005718 Ga0209995_10057183 314
595 3300027526 Ga0209968_1008697 Ga0209968_10086972 314
596 3300027665 Ga0209983_1002812 Ga0209983_10028124 314
597 3300027682 Ga0209971_1000128 Ga0209971_100012814 314
598 3300027695 Ga0209966_1000071 Ga0209966_100007126 314
599 3300027717 Ga0209998_10000113 Ga0209998_1000011314 314
600 3300027876 Ga0209974_10022208 Ga0209974_100222082 314
601 3300028380 Ga0268265_10003185 Ga0268265_100031854 314
602 3300028381 Ga0268264_10004690 Ga0268264_100046906 314
603 3300028381 Ga0268264_10095295 Ga0268264_100952953 314
604 3300035091 Ga0373951_0001847 Ga0373951_0001847_1270_2214 314
605 3300035121 Ga0373960_0005205 Ga0373960_0005205_439_1383 314
606 3300042005 Ga0439448_0000205 Ga0439448_0000205_1928_2872 314
607 3300042438 Ga0439459_0012281 Ga0439459_0012281_243_1187 314
608 3300042439 Ga0439464_0015396 Ga0439464_0015396_339_1286 314
609 3300042461 Ga0439460_0000453 Ga0439460_0000453_4266_5213 314
610 3300042461 Ga0439460_0047034 Ga0439460_0047034_153_1097 314
611 3300042876 Ga0451577_0023769 Ga0451577_0023769_4371_5318 314
612 3300045051 Ga0451576_0030449 Ga0451576_0030449_4688_5635 314
613 3300045051 Ga0451576_0040536 Ga0451576_0040536_3827_4771 314
614 3300045051 Ga0451576_0085237 Ga0451576_0085237_282_1226 314
615 3300045051 Ga0451576_0087339 Ga0451576_0087339_1396_2340 314
616 3300045051 Ga0451576_0141805 Ga0451576_0141805_791_1738 314
617 3300046491 Ga0495584_0115460 Ga0495584_0115460_392_1336 314
618 3300048911 Ga0496108_0268576 Ga0496108_0268576_184_1128 314
619 3300048915 Ga0496112_0141679 Ga0496112_0141679_1128_2072 314
620 3300049570 Ga0501033_0063804 Ga0501033_0063804_485_1429 314
621 3300049572 Ga0501036_0088180 Ga0501036_0088180_1011_1955 314
622 3300049572 Ga0501036_0187665 Ga0501036_0187665_190_1134 314
623 3300049574 Ga0501038_0152989 Ga0501038_0152989_178_1122 314
624 3300049576 Ga0501040_0002803 Ga0501040_0002803_109_1056 314
625 3300049576 Ga0501040_0045132 Ga0501040_0045132_1745_2689 314
626 3300049576 Ga0501040_0088301 Ga0501040_0088301_653_1597 314
627 3300049576 Ga0501040_0111366 Ga0501040_0111366_301_1245 314
628 3300049577 Ga0501041_0003933 Ga0501041_0003933_5600_6547 314
629 3300049578 Ga0501042_0006045 Ga0501042_0006045_3321_4268 314
630 3300049578 Ga0501042_0174868 Ga0501042_0174868_445_1389 314
631 3300049580 Ga0501046_0000084 Ga0501046_0000084_2218_3165 314
632 3300049582 Ga0501048_0008354 Ga0501048_0008354_1593_2540 314
633 3300049584 Ga0501068_0071379 Ga0501068_0071379_280_1227 314
634 3300049588 Ga0501072_0011625 Ga0501072_0011625_1340_2287 314
635 3300049588 Ga0501072_0279597 Ga0501072_0279597_110_1087 314
636 3300049590 Ga0501074_0002552 Ga0501074_0002552_7675_8622 314
637 3300049590 Ga0501074_0159699 Ga0501074_0159699_286_1230 314
638 3300049591 Ga0501075_0024482 Ga0501075_0024482_541_1485 314
639 3300049591 Ga0501075_0024488 Ga0501075_0024488_1970_2917 314
640 3300049591 Ga0501075_0025151 Ga0501075_0025151_3045_4040 314
641 3300049591 Ga0501075_0030009 Ga0501075_0030009_1140_2084 314
642 3300049591 Ga0501075_0280989 Ga0501075_0280989_211_1158 314
643 3300049592 Ga0501076_0017009 Ga0501076_0017009_3453_4397 314
644 3300049592 Ga0501076_0042702 Ga0501076_0042702_2026_2973 314
645 3300049592 Ga0501076_0103543 Ga0501076_0103543_369_1313 314
646 3300049592 Ga0501076_0299531 Ga0501076_0299531_225_1220 314
647 3300049593 Ga0501077_0036677 Ga0501077_0036677_1101_2048 314
648 3300049593 Ga0501077_0192003 Ga0501077_0192003_246_1190 314
649 3300049741 Ga0501079_0001826 Ga0501079_0001826_8706_9653 314
650 3300049741 Ga0501079_0024179 Ga0501079_0024179_2365_3309 314
651 3300049741 Ga0501079_0040790 Ga0501079_0040790_412_1356 314
652 3300049741 Ga0501079_0207297 Ga0501079_0207297_352_1347 314
653 3300049742 Ga0501080_0106207 Ga0501080_0106207_360_1304 314
654 3300049742 Ga0501080_0257528 Ga0501080_0257528_369_1316 314
655 3300049743 Ga0501081_0005570 Ga0501081_0005570_1524_2468 314
656 3300049743 Ga0501081_0013375 Ga0501081_0013375_3138_4085 314
657 3300049743 Ga0501081_0030144 Ga0501081_0030144_345_1289 314
658 3300049744 Ga0501083_0003803 Ga0501083_0003803_7581_8528 314
659 3300049744 Ga0501083_0080269 Ga0501083_0080269_277_1221 314
660 3300049824 Ga0501045_0001154 Ga0501045_0001154_9133_10080 314
661 3300049824 Ga0501045_0218662 Ga0501045_0218662_175_1119 314
662 3300050507 nmdc:mga05p37_423819_c1 nmdc:mga05p37_423819_c1_341_1306 314
663 3300050507 nmdc:mga05p37_50612_c1 nmdc:mga05p37_50612_c1_751_1695 314
664 3300050507 nmdc:mga05p37_9265_c1 nmdc:mga05p37_9265_c1_9757_10701 314
665 3300050508 nmdc:mga09592_33695_c1 nmdc:mga09592_33695_c1_488_1453 314
666 3300050510 nmdc:mga06r32_214774_c1 nmdc:mga06r32_214774_c1_507_1472 314
667 3300050511 nmdc:mga08y16_101940_c1 nmdc:mga08y16_101940_c1_131_1078 314
668 3300050512 nmdc:mga0n895_191_c1 nmdc:mga0n895_191_c1_21624_22568 314
669 3300050512 nmdc:mga0n895_74710_c1 nmdc:mga0n895_74710_c1_1842_2786 314
670 3300050512 nmdc:mga0n895_79039_c1 nmdc:mga0n895_79039_c1_541_1488 314
671 3300050513 nmdc:mga0rr50_17563_c1 nmdc:mga0rr50_17563_c1_1539_2483 314
672 3300050513 nmdc:mga0rr50_79664_c1 nmdc:mga0rr50_79664_c1_584_1531 314
673 3300050514 nmdc:mga08x19_132107_c1 nmdc:mga08x19_132107_c1_722_1666 314
674 3300050514 nmdc:mga08x19_224099_c1 nmdc:mga08x19_224099_c1_59_1003 314
675 3300050514 nmdc:mga08x19_3113_c1 nmdc:mga08x19_3113_c1_59_1003 314
676 3300050514 nmdc:mga08x19_87694_c1 nmdc:mga08x19_87694_c1_78_1022 314
677 3300050515 nmdc:mga0a205_3171_c1 nmdc:mga0a205_3171_c1_10458_11405 314
678 3300050515 nmdc:mga0a205_332962_c1 nmdc:mga0a205_332962_c1_163_1110 314
679 3300050515 nmdc:mga0a205_5347_c1 nmdc:mga0a205_5347_c1_9489_10433 314
680 3300054114 Ga0501084_0000494 Ga0501084_0000494_2346_3293 314
681 3300054114 Ga0501084_0004153 Ga0501084_0004153_10118_11062 314
682 3300054114 Ga0501084_0137166 Ga0501084_0137166_278_1222 314
683 3300054114 Ga0501084_0250168 Ga0501084_0250168_356_1303 314
684 3300060353 Ga0501082_0000376 Ga0501082_0000376_27382_28329 314
685 3300060353 Ga0501082_0028785 Ga0501082_0028785_194_1138 314
686 3300060353 Ga0501082_0029329 Ga0501082_0029329_1354_2298 314
687 3300060353 Ga0501082_0256403 Ga0501082_0256403_424_1401 314
688 3300060353 Ga0501082_0284181 Ga0501082_0284181_119_1114 314
689 3300061734 Ga0530510_0002539 Ga0530510_0002539_11146_12093 314
690 3300061734 Ga0530510_0037506 Ga0530510_0037506_165_1112 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

23

310

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aec-assembly1.cif.gz_B crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyase c 0.9611 12 313
2eco-assembly1.cif.gz_A crystal structure of t.th. hb8 o-acetylserine sulfhydrylase complexed with 4-methylvalerate 0.9597 17 313
7n2t-assembly1.cif.gz_A-2 o-acetylserine sulfhydrylase from citrullus vulgaris in the internal aldimine state, with citrate bound 0.959 12 310
3spx-assembly1.cif.gz_A crystal structure of o-acetyl serine sulfhydrylase from leishmania donovani 0.9584 15 313
1z7y-assembly1.cif.gz_A crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant 0.9576 12 313
ID Description Score Start End Superfamily
af_K7L749_143_229_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9647 158 244 3.40.50.1100
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9631 57 157 3.40.50.1100
3dkiB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9581 56 165 3.40.50.1100
af_A0A0P0WXY8_178_256_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9575 158 223 3.40.50.1100
af_K7L749_14_232_2.10.25.10 Mainly Beta;Ribbon;Laminin;Laminin 0.956 21 246 2.10.25.10
ID Description Score Start End GO Terms
AF-A0A5K1GAW8-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9926 76 161
AF-A0A5K1BS56-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.992 76 162
AF-B7TQG2-F1-model_v4 Putative mitochondrial cysteine synthase 0.9825 56 267
AF-A0A7S0JKB7-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.981 70 169 GO:0016020
AF-C6SAH1-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9798 63 234 GO:0004124

Feature Viewer

pLDDT pTM Quality
89.38 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map