F475555

General Info

Members Datasets Scaffolds Average Seq Length
691 240 1382 141

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_883073_c1|nmdc:mga0qj67_883073_c1_131_577
Length 148
Sequence MVRHGEKAMATSKPKQLFSASLAKDAVYKTGLRSFMEYRDLGIEKATHGQFRAHVIRIKKDAGAHDLHTTGLHQHLCDFQMFYVLKGWIKFVYEGEGEHLFHAGDCVLQPAGIVHNELDCSDDLEVLEIYSPAIHQTVAVANMAAAAD

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 98.7
Stem 0
Stem Tuber 0
Unclassified 32.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_883073_c1 3300050509 Unclassified 705
2 JGI25406J46586_10009822 3300003203 Bacteria 4273
3 JGI25406J46586_10120152 3300003203 Unclassified 774
4 JGI25405J52794_10013373 3300003911 Bacteria 1591
5 Ga0058859_11734936 3300004798 Bacteria 2016
6 Ga0058859_11809412 3300004798 Unclassified 542
7 Ga0058861_11464219 3300004800 Unclassified 757
8 Ga0058860_12017444 3300004801 Unclassified 542
9 Ga0058860_12051980 3300004801 Bacteria 1633
10 Ga0058862_11757287 3300004803 Unclassified 540
11 Ga0058862_12124495 3300004803 Unclassified 667
12 Ga0065704_10642448 3300005289 Unclassified 586
13 Ga0065715_10243779 3300005293 Bacteria 1190
14 Ga0065707_10265945 3300005295 Bacteria 1084
15 Ga0065707_10295761 3300005295 Unclassified 1015
16 Ga0065707_10409273 3300005295 Bacteria 843
17 Ga0065707_10738600 3300005295 Unclassified 623
18 Ga0065707_10823083 3300005295 Unclassified 591
19 Ga0070676_10291305 3300005328 Unclassified 1103
20 Ga0070690_100081121 3300005330 Bacteria 2122
21 Ga0070670_100361711 3300005331 Unclassified 1276
22 Ga0070670_100442388 3300005331 Bacteria 1151
23 Ga0068869_100027257 3300005334 Bacteria 3981
24 Ga0068869_100400671 3300005334 Unclassified 1129
25 Ga0068869_100715762 3300005334 Unclassified 855
26 Ga0070666_10172021 3300005335 Bacteria 1517
27 Ga0070680_100016864 3300005336 Bacteria 5749
28 Ga0070680_101302156 3300005336 Unclassified 629
29 Ga0070682_100185076 3300005337 Bacteria 1458
30 Ga0068868_100424836 3300005338 Bacteria 1151
31 Ga0068868_101443176 3300005338 Unclassified 643
32 Ga0070660_100430484 3300005339 Bacteria 1093
33 Ga0070689_101931598 3300005340 Unclassified 539
34 Ga0070691_10015166 3300005341 Bacteria 3539
35 Ga0070692_10004546 3300005345 Bacteria 5808
36 Ga0070692_10035210 3300005345 Bacteria 2533
37 Ga0070668_100508009 3300005347 Unclassified 1044
38 Ga0070668_101040971 3300005347 Unclassified 737
39 Ga0070669_100226195 3300005353 Unclassified 1481
40 Ga0070669_100241299 3300005353 Bacteria 1436
41 Ga0070669_100289633 3300005353 Unclassified 1314
42 Ga0070675_100141832 3300005354 Bacteria 2054
43 Ga0070675_101038001 3300005354 Unclassified 753
44 Ga0070671_101226164 3300005355 Unclassified 660
45 Ga0070674_100128369 3300005356 Unclassified 1887
46 Ga0070673_100322399 3300005364 Bacteria 1365
47 Ga0070673_101233695 3300005364 Unclassified 701
48 Ga0070688_100284561 3300005365 Unclassified 1189
49 Ga0070659_100316033 3300005366 Unclassified 1305
50 Ga0070667_101639972 3300005367 Bacteria 605
51 Ga0070667_101644952 3300005367 Unclassified 604
52 Ga0070667_101759040 3300005367 Unclassified 583
53 Ga0070701_10013918 3300005438 Bacteria 3673
54 Ga0070701_10042546 3300005438 Bacteria 2320
55 Ga0070711_101267878 3300005439 Unclassified 639
56 Ga0070705_100012313 3300005440 Bacteria 4345
57 Ga0070705_100026993 3300005440 Bacteria 3130
58 Ga0070705_100036510 3300005440 Bacteria 2764
59 Ga0070705_100604545 3300005440 Bacteria 849
60 Ga0070700_100197636 3300005441 Bacteria 1410
61 Ga0070694_100123671 3300005444 Bacteria 1859
62 Ga0070694_100134171 3300005444 Bacteria 1792
63 Ga0070694_100309099 3300005444 Unclassified 1213
64 Ga0070694_100462753 3300005444 Bacteria 1003
65 Ga0070694_100577115 3300005444 Bacteria 903
66 Ga0070694_101874133 3300005444 Unclassified 512
67 Ga0070708_100225123 3300005445 Bacteria 1759
68 Ga0070708_100259216 3300005445 Unclassified 1634
69 Ga0070708_100353250 3300005445 Bacteria 1385
70 Ga0070708_100416206 3300005445 Bacteria 1267
71 Ga0070708_100626686 3300005445 Bacteria 1014
72 Ga0070708_100862583 3300005445 Bacteria 850
73 Ga0070708_102188293 3300005445 Unclassified 511
74 Ga0070663_100107018 3300005455 Bacteria 2096
75 Ga0070663_100523111 3300005455 Unclassified 988
76 Ga0070678_100066659 3300005456 Bacteria 2677
77 Ga0070681_10029789 3300005458 Bacteria 5478
78 Ga0068867_100023303 3300005459 Bacteria 4432
79 Ga0068867_100088086 3300005459 Unclassified 2352
80 Ga0068867_100460339 3300005459 Bacteria 1086
81 Ga0068867_100493828 3300005459 Bacteria 1051
82 Ga0068867_101088709 3300005459 Bacteria 729
83 Ga0070685_10732331 3300005466 Unclassified 723
84 Ga0070685_10912221 3300005466 Unclassified 654
85 Ga0070706_100052368 3300005467 Bacteria 3767
86 Ga0070706_100222854 3300005467 Bacteria 1760
87 Ga0070706_100443057 3300005467 Bacteria 1209
88 Ga0070706_100656643 3300005467 Bacteria 973
89 Ga0070707_100001920 3300005468 Bacteria 19925
90 Ga0070707_100018777 3300005468 Bacteria 6509
91 Ga0070707_100306080 3300005468 Bacteria 1544
92 Ga0070707_100352324 3300005468 Bacteria 1430
93 Ga0070707_100568988 3300005468 Bacteria 1095
94 Ga0070707_100629182 3300005468 Bacteria 1036
95 Ga0070707_100680105 3300005468 Bacteria 992
96 Ga0070698_100016896 3300005471 Bacteria 7696
97 Ga0070698_100143307 3300005471 Bacteria 2340
98 Ga0070698_100274634 3300005471 Bacteria 1617
99 Ga0070698_100298852 3300005471 Bacteria 1541
100 Ga0070698_100519909 3300005471 Bacteria 1129
101 Ga0070698_100580050 3300005471 Bacteria 1061
102 Ga0070698_100988634 3300005471 Bacteria 788
103 Ga0070698_101057902 3300005471 Bacteria 759
104 Ga0070699_100003894 3300005518 Bacteria 13196
105 Ga0070699_100013128 3300005518 Bacteria 7141
106 Ga0070699_100443446 3300005518 Unclassified 1176
107 Ga0070699_100482795 3300005518 Bacteria 1125
108 Ga0070699_100829326 3300005518 Bacteria 846
109 Ga0070699_101439106 3300005518 Bacteria 632
110 Ga0070699_101595110 3300005518 Unclassified 598
111 Ga0070679_100453026 3300005530 Bacteria 1228
112 Ga0070679_100744268 3300005530 Unclassified 923
113 Ga0070697_100000306 3300005536 Bacteria 38931
114 Ga0070697_100091517 3300005536 Bacteria 2515
115 Ga0070697_100108426 3300005536 Bacteria 2311
116 Ga0070697_100279681 3300005536 Bacteria 1432
117 Ga0070697_100388989 3300005536 Unclassified 1209
118 Ga0070697_100646638 3300005536 Bacteria 931
119 Ga0070697_100979202 3300005536 Bacteria 751
120 Ga0070697_101041532 3300005536 Bacteria 728
121 Ga0070697_101180207 3300005536 Unclassified 682
122 Ga0068853_100013426 3300005539 Bacteria 6686
123 Ga0070686_100201942 3300005544 Bacteria 1426
124 Ga0070686_100412868 3300005544 Unclassified 1029
125 Ga0070686_101243720 3300005544 Unclassified 620
126 Ga0070695_100060469 3300005545 Bacteria 2455
127 Ga0070695_100345856 3300005545 Unclassified 1113
128 Ga0070696_100009477 3300005546 Bacteria 6522
129 Ga0070696_100067801 3300005546 Bacteria 2504
130 Ga0070696_100147647 3300005546 Unclassified 1723
131 Ga0070696_100176997 3300005546 Bacteria 1580
132 Ga0070665_100062887 3300005548 Bacteria 3721
133 Ga0070665_100219311 3300005548 Bacteria 1902
134 Ga0070704_100041275 3300005549 Bacteria 3183
135 Ga0070704_100104429 3300005549 Bacteria 2143
136 Ga0070704_100152104 3300005549 Unclassified 1820
137 Ga0070704_100435544 3300005549 Bacteria 1126
138 Ga0070704_100689324 3300005549 Bacteria 905
139 Ga0070704_100840970 3300005549 Unclassified 822
140 Ga0070704_101767579 3300005549 Bacteria 572
141 Ga0068855_100090483 3300005563 Bacteria 3532
142 Ga0070664_100206368 3300005564 Bacteria 1755
143 Ga0068857_100008709 3300005577 Bacteria 8782
144 Ga0068857_100149422 3300005577 Unclassified 2116
145 Ga0068857_100406499 3300005577 Bacteria 1267
146 Ga0068854_101512017 3300005578 Unclassified 610
147 Ga0068854_101775849 3300005578 Unclassified 565
148 Ga0068856_100354893 3300005614 Bacteria 1485
149 Ga0070702_101457071 3300005615 Unclassified 562
150 Ga0068852_100379847 3300005616 Bacteria 1386
151 Ga0068859_100020684 3300005617 Bacteria 6605
152 Ga0068859_100021964 3300005617 Bacteria 6400
153 Ga0068859_100058049 3300005617 Bacteria 3898
154 Ga0068859_100399997 3300005617 Bacteria 1469
155 Ga0068859_101247837 3300005617 Bacteria 819
156 Ga0068864_100304949 3300005618 Unclassified 1492
157 Ga0068864_101089811 3300005618 Bacteria 795
158 Ga0068866_10075342 3300005718 Unclassified 1796
159 Ga0068866_10171950 3300005718 Unclassified 1272
160 Ga0068866_10564933 3300005718 Unclassified 763
161 Ga0068861_100047477 3300005719 Bacteria 3241
162 Ga0068861_100295396 3300005719 Bacteria 1401
163 Ga0068861_101973544 3300005719 Bacteria 582
164 Ga0068870_10246613 3300005840 Unclassified 1105
165 Ga0068863_100185929 3300005841 Bacteria 1996
166 Ga0068863_102303222 3300005841 Unclassified 548
167 Ga0068858_100066399 3300005842 Bacteria 3339
168 Ga0068858_100509635 3300005842 Unclassified 1163
169 Ga0068860_100044333 3300005843 Bacteria 4239
170 Ga0068860_100121361 3300005843 Bacteria 2502
171 Ga0068860_100291112 3300005843 Unclassified 1598
172 Ga0068860_100916494 3300005843 Unclassified 893
173 Ga0068860_101247720 3300005843 Unclassified 764
174 Ga0068860_102042367 3300005843 Unclassified 595
175 Ga0068862_100126790 3300005844 Unclassified 2254
176 Ga0068862_100246078 3300005844 Unclassified 1628
177 Ga0068862_100281700 3300005844 Bacteria 1524
178 Ga0068862_100439633 3300005844 Unclassified 1227
179 Ga0068862_102239795 3300005844 Unclassified 558
180 Ga0081455_10013059 3300005937 Bacteria 8232
181 Ga0081455_10128874 3300005937 Bacteria 1981
182 Ga0081455_10131175 3300005937 Bacteria 1959
183 Ga0081538_10017567 3300005981 Bacteria 5422
184 Ga0081538_10071895 3300005981 Unclassified 1900
185 Ga0081540_1003045 3300005983 Bacteria 13426
186 Ga0081540_1039402 3300005983 Unclassified 2477
187 Ga0081540_1210457 3300005983 Unclassified 700
188 Ga0081539_10000002 3300005985 Bacteria 601032
189 Ga0081539_10026753 3300005985 Unclassified 3670
190 Ga0075432_10017830 3300006058 Bacteria 2421
191 Ga0075432_10481088 3300006058 Unclassified 550
192 Ga0097621_100039351 3300006237 Bacteria 3797
193 Ga0068871_100014151 3300006358 Bacteria 5936
194 Ga0068871_101012108 3300006358 Unclassified 774
195 Ga0075428_100000401 3300006844 Bacteria 42962
196 Ga0075428_100016398 3300006844 Bacteria 8186
197 Ga0075428_100050598 3300006844 Bacteria 4556
198 Ga0075428_100104581 3300006844 Bacteria 3088
199 Ga0075428_100122215 3300006844 Bacteria 2834
200 Ga0075428_100151186 3300006844 Bacteria 2522
201 Ga0075428_100425478 3300006844 Bacteria 1423
202 Ga0075428_100488925 3300006844 Bacteria 1317
203 Ga0075428_100980934 3300006844 Unclassified 895
204 Ga0075428_101249005 3300006844 Bacteria 782
205 Ga0075430_100001040 3300006846 Bacteria 21918
206 Ga0075430_100002353 3300006846 Bacteria 15709
207 Ga0075430_100109836 3300006846 Bacteria 2300
208 Ga0075430_100129802 3300006846 Bacteria 2101
209 Ga0075430_100344994 3300006846 Unclassified 1230
210 Ga0075430_100350142 3300006846 Bacteria 1220
211 Ga0075430_100406363 3300006846 Unclassified 1124
212 Ga0075430_100983826 3300006846 Bacteria 695
213 Ga0075430_101202733 3300006846 Unclassified 624
214 Ga0075430_101535853 3300006846 Unclassified 547
215 Ga0075431_100000044 3300006847 Bacteria 65584
216 Ga0075431_100003282 3300006847 Bacteria 15654
217 Ga0075431_100003487 3300006847 Bacteria 15248
218 Ga0075431_100005687 3300006847 Bacteria 12318
219 Ga0075431_100014010 3300006847 Bacteria 8099
220 Ga0075431_100024059 3300006847 Bacteria 6237
221 Ga0075431_100155505 3300006847 Bacteria 2353
222 Ga0075431_100248008 3300006847 Unclassified 1810
223 Ga0075431_100302112 3300006847 Bacteria 1617
224 Ga0075431_100323837 3300006847 Bacteria 1554
225 Ga0075431_100680344 3300006847 Bacteria 1007
226 Ga0075431_100712297 3300006847 Unclassified 981
227 Ga0075431_101811117 3300006847 Unclassified 567
228 Ga0075433_10000086 3300006852 Bacteria 42813
229 Ga0075433_10002894 3300006852 Bacteria 13156
230 Ga0075433_10047339 3300006852 Bacteria 3740
231 Ga0075433_10050696 3300006852 Bacteria 3614
232 Ga0075433_10101438 3300006852 Bacteria 2548
233 Ga0075433_10119649 3300006852 Unclassified 2338
234 Ga0075433_10450378 3300006852 Bacteria 1135
235 Ga0075433_11009896 3300006852 Bacteria 725
236 Ga0075433_11212349 3300006852 Bacteria 655
237 Ga0075434_100004175 3300006871 Bacteria 12946
238 Ga0075434_100019747 3300006871 Bacteria 6524
239 Ga0075434_100031947 3300006871 Bacteria 5190
240 Ga0075434_100032220 3300006871 Bacteria 5167
241 Ga0075434_100050891 3300006871 Bacteria 4115
242 Ga0075434_100057678 3300006871 Bacteria 3859
243 Ga0075434_100095857 3300006871 Bacteria 2972
244 Ga0075434_100786444 3300006871 Unclassified 968
245 Ga0075434_100827597 3300006871 Unclassified 942
246 Ga0075434_101814252 3300006871 Unclassified 617
247 Ga0075429_100000897 3300006880 Bacteria 23531
248 Ga0075429_100008463 3300006880 Bacteria 8956
249 Ga0075429_100014743 3300006880 Bacteria 6774
250 Ga0075429_100039051 3300006880 Bacteria 4132
251 Ga0075429_100077024 3300006880 Bacteria 2905
252 Ga0075429_100100668 3300006880 Unclassified 2522
253 Ga0075429_100217542 3300006880 Bacteria 1673
254 Ga0075429_100267303 3300006880 Unclassified 1498
255 Ga0075429_100421571 3300006880 Bacteria 1169
256 Ga0075429_100423113 3300006880 Bacteria 1166
257 Ga0075429_100497159 3300006880 Unclassified 1069
258 Ga0068865_100183034 3300006881 Unclassified 1615
259 Ga0068865_100231034 3300006881 Bacteria 1451
260 Ga0075436_100002427 3300006914 Bacteria 12844
261 Ga0075436_100017212 3300006914 Bacteria 4946
262 Ga0075436_100057059 3300006914 Unclassified 2697
263 Ga0075436_100090574 3300006914 Unclassified 2126
264 Ga0075436_100144445 3300006914 Bacteria 1673
265 Ga0075436_100181412 3300006914 Bacteria 1488
266 Ga0075436_100381961 3300006914 Bacteria 1019
267 Ga0097620_100020684 3300006931 Bacteria 6605
268 Ga0097620_100021964 3300006931 Bacteria 6400
269 Ga0097620_100058047 3300006931 Bacteria 3898
270 Ga0097620_100400006 3300006931 Bacteria 1469
271 Ga0097620_101247562 3300006931 Bacteria 819
272 Ga0075435_100004767 3300007076 Bacteria 9365
273 Ga0075435_100007018 3300007076 Bacteria 7994
274 Ga0075435_100011744 3300007076 Bacteria 6462
275 Ga0075435_100034184 3300007076 Bacteria 4025
276 Ga0075435_100041701 3300007076 Bacteria 3670
277 Ga0075435_100082223 3300007076 Unclassified 2647
278 Ga0075435_100474995 3300007076 Bacteria 1079
279 Ga0075435_101200663 3300007076 Bacteria 664
280 Ga0099794_10501386 3300007265 Unclassified 639
281 Ga0111539_10006976 3300009094 Bacteria 14497
282 Ga0111539_10066446 3300009094 Bacteria 4260
283 Ga0111539_10462531 3300009094 Bacteria 1477
284 Ga0111539_10808620 3300009094 Unclassified 1091
285 Ga0111539_10942592 3300009094 Unclassified 1004
286 Ga0111539_11522941 3300009094 Unclassified 776
287 Ga0105245_10043690 3300009098 Bacteria 3997
288 Ga0105245_10481062 3300009098 Bacteria 1255
289 Ga0105247_10050290 3300009101 Bacteria 2564
290 Ga0105247_10619185 3300009101 Unclassified 805
291 Ga0114129_10000089 3300009147 Bacteria 86570
292 Ga0114129_10000385 3300009147 Bacteria 51411
293 Ga0114129_10001642 3300009147 Bacteria 30374
294 Ga0114129_10010238 3300009147 Bacteria 13377
295 Ga0114129_10017316 3300009147 Bacteria 10259
296 Ga0114129_10020844 3300009147 Bacteria 9311
297 Ga0114129_10029628 3300009147 Bacteria 7751
298 Ga0114129_10039200 3300009147 Bacteria 6680
299 Ga0114129_10082971 3300009147 Bacteria 4453
300 Ga0114129_10087714 3300009147 Unclassified 4314
301 Ga0114129_10088783 3300009147 Bacteria 4285
302 Ga0114129_10093173 3300009147 Bacteria 4173
303 Ga0114129_10217014 3300009147 Bacteria 2583
304 Ga0114129_10224169 3300009147 Bacteria 2535
305 Ga0114129_10421761 3300009147 Bacteria 1755
306 Ga0114129_10422260 3300009147 Unclassified 1753
307 Ga0114129_10441863 3300009147 Bacteria 1707
308 Ga0114129_10813723 3300009147 Bacteria 1191
309 Ga0114129_11104243 3300009147 Unclassified 993
310 Ga0114129_11132157 3300009147 Bacteria 978
311 Ga0114129_11956337 3300009147 Bacteria 710
312 Ga0105243_10112676 3300009148 Bacteria 2279
313 Ga0105243_10471145 3300009148 Unclassified 1183
314 Ga0105243_11178826 3300009148 Bacteria 778
315 Ga0105241_10015832 3300009174 Bacteria 5523
316 Ga0105241_10335538 3300009174 Bacteria 1308
317 Ga0105241_11075141 3300009174 Bacteria 756
318 Ga0105242_10004108 3300009176 Bacteria 11323
319 Ga0105242_11094819 3300009176 Unclassified 810
320 Ga0105248_10015275 3300009177 Bacteria 8465
321 Ga0105248_10678919 3300009177 Unclassified 1162
322 Ga0105237_10087268 3300009545 Bacteria 3109
323 Ga0105237_10427037 3300009545 Unclassified 1331
324 Ga0105249_10084909 3300009553 Bacteria 2949
325 Ga0105249_10109399 3300009553 Bacteria 2610
326 Ga0105249_10371993 3300009553 Bacteria 1453
327 Ga0105249_10651747 3300009553 Bacteria 1111
328 Ga0105249_11303633 3300009553 Unclassified 798
329 Ga0105239_10063437 3300010375 Bacteria 4057
330 Ga0105239_10084538 3300010375 Bacteria 3495
331 Ga0105239_10091427 3300010375 Bacteria 3358
332 Ga0105239_10236125 3300010375 Bacteria 2052
333 Ga0105246_10181200 3300011119 Bacteria 1622
334 Ga0105246_10416564 3300011119 Unclassified 1120
335 Ga0157373_11009558 3300013100 Unclassified 621
336 Ga0157374_10120023 3300013296 Bacteria 2536
337 Ga0157374_10194766 3300013296 Unclassified 1983
338 Ga0157374_10515466 3300013296 Bacteria 1201
339 Ga0157378_10024073 3300013297 Bacteria 5356
340 Ga0157378_10318567 3300013297 Unclassified 1510
341 Ga0157378_10430774 3300013297 Bacteria 1305
342 Ga0157378_11579624 3300013297 Bacteria 702
343 Ga0163162_10043934 3300013306 Unclassified 4474
344 Ga0163162_10090572 3300013306 Bacteria 3140
345 Ga0163162_10929940 3300013306 Bacteria 981
346 Ga0157375_10012444 3300013308 Bacteria 7551
347 Ga0157375_10107389 3300013308 Bacteria 2884
348 Ga0157375_10167839 3300013308 Unclassified 2341
349 Ga0157375_10354980 3300013308 Bacteria 1632
350 Ga0157380_10591421 3300014326 Bacteria 1096
351 Ga0157380_11230521 3300014326 Unclassified 793
352 Ga0157380_12520065 3300014326 Bacteria 580
353 Ga0157379_10047620 3300014968 Unclassified 3825
354 Ga0157379_10086879 3300014968 Bacteria 2804
355 Ga0157376_10035527 3300014969 Bacteria 4031
356 Ga0206353_11510663 3300020082 Unclassified 509
357 Ga0207653_10004291 3300025885 Bacteria 4479
358 Ga0207642_10013135 3300025899 Unclassified 3013
359 Ga0207642_10048506 3300025899 Bacteria 1904
360 Ga0207710_10140116 3300025900 Bacteria 1167
361 Ga0207688_10092075 3300025901 Unclassified 1742
362 Ga0207680_10397333 3300025903 Bacteria 974
363 Ga0207645_10498010 3300025907 Unclassified 825
364 Ga0207684_10000961 3300025910 Bacteria 32329
365 Ga0207684_10019957 3300025910 Bacteria 5727
366 Ga0207684_10040590 3300025910 Bacteria 3945
367 Ga0207684_10421782 3300025910 Bacteria 1146
368 Ga0207654_10010877 3300025911 Bacteria 4631
369 Ga0207654_10233652 3300025911 Unclassified 1226
370 Ga0207654_10276648 3300025911 Bacteria 1134
371 Ga0207707_10224367 3300025912 Bacteria 1635
372 Ga0207707_11065665 3300025912 Bacteria 660
373 Ga0207671_10189170 3300025914 Unclassified 1605
374 Ga0207671_11562618 3300025914 Unclassified 508
375 Ga0207660_10510736 3300025917 Bacteria 975
376 Ga0207660_11295815 3300025917 Bacteria 592
377 Ga0207657_10391473 3300025919 Bacteria 1093
378 Ga0207652_10242226 3300025921 Bacteria 1626
379 Ga0207652_10768579 3300025921 Unclassified 857
380 Ga0207646_10006796 3300025922 Bacteria 11770
381 Ga0207646_10043827 3300025922 Bacteria 4016
382 Ga0207646_10080484 3300025922 Bacteria 2913
383 Ga0207646_10402457 3300025922 Bacteria 1236
384 Ga0207681_10037324 3300025923 Bacteria 3211
385 Ga0207681_10394101 3300025923 Unclassified 1117
386 Ga0207694_11709286 3300025924 Unclassified 529
387 Ga0207650_10503697 3300025925 Bacteria 1012
388 Ga0207659_10880817 3300025926 Unclassified 770
389 Ga0207687_10296880 3300025927 Bacteria 1300
390 Ga0207687_10584892 3300025927 Unclassified 939
391 Ga0207644_11132639 3300025931 Bacteria 658
392 Ga0207690_10359779 3300025932 Bacteria 1152
393 Ga0207686_10297118 3300025934 Unclassified 1198
394 Ga0207686_10607506 3300025934 Bacteria 861
395 Ga0207709_10003251 3300025935 Bacteria 9744
396 Ga0207709_10234363 3300025935 Bacteria 1331
397 Ga0207670_10637011 3300025936 Unclassified 878
398 Ga0207669_10030337 3300025937 Unclassified 3004
399 Ga0207691_10475998 3300025940 Bacteria 1062
400 Ga0207691_10492007 3300025940 Bacteria 1042
401 Ga0207711_10060322 3300025941 Bacteria 3268
402 Ga0207689_10002168 3300025942 Bacteria 18474
403 Ga0207689_10404356 3300025942 Unclassified 1138
404 Ga0207689_10610468 3300025942 Unclassified 918
405 Ga0207679_10055894 3300025945 Unclassified 2912
406 Ga0207667_10168739 3300025949 Unclassified 2249
407 Ga0207651_10442363 3300025960 Unclassified 1114
408 Ga0207651_10862301 3300025960 Unclassified 805
409 Ga0207712_10367642 3300025961 Unclassified 1200
410 Ga0207712_11408453 3300025961 Bacteria 624
411 Ga0207712_11462266 3300025961 Unclassified 612
412 Ga0207712_11731905 3300025961 Bacteria 560
413 Ga0207658_10655236 3300025986 Bacteria 947
414 Ga0207677_10109045 3300026023 Bacteria 2057
415 Ga0207703_10047868 3300026035 Bacteria 3448
416 Ga0207703_10127282 3300026035 Bacteria 2195
417 Ga0207703_10274614 3300026035 Bacteria 1528
418 Ga0207639_10039923 3300026041 Bacteria 3500
419 Ga0207678_10383067 3300026067 Unclassified 1216
420 Ga0207708_10063664 3300026075 Unclassified 2817
421 Ga0207708_10318374 3300026075 Unclassified 1269
422 Ga0207702_11347726 3300026078 Unclassified 707
423 Ga0207641_10311803 3300026088 Bacteria 1489
424 Ga0207648_10038656 3300026089 Bacteria 4199
425 Ga0207648_10245227 3300026089 Bacteria 1596
426 Ga0207648_10448026 3300026089 Unclassified 1175
427 Ga0207676_10216486 3300026095 Bacteria 1703
428 Ga0207676_11710362 3300026095 Bacteria 627
429 Ga0207674_10036752 3300026116 Bacteria 5099
430 Ga0207674_10223665 3300026116 Unclassified 1830
431 Ga0207674_10235111 3300026116 Bacteria 1780
432 Ga0207674_10280005 3300026116 Bacteria 1616
433 Ga0207675_100054121 3300026118 Bacteria 3744
434 Ga0207675_100118459 3300026118 Bacteria 2504
435 Ga0207675_101121143 3300026118 Unclassified 807
436 Ga0207683_10292592 3300026121 Bacteria 1489
437 Ga0207683_10548971 3300026121 Bacteria 1068
438 Ga0209974_10038963 3300027876 Bacteria 1580
439 Ga0207428_10000029 3300027907 Bacteria 241338
440 Ga0207428_10000613 3300027907 Bacteria 42147
441 Ga0207428_10532911 3300027907 Unclassified 850
442 Ga0207428_11137117 3300027907 Bacteria 545
443 Ga0268265_10139681 3300028380 Bacteria 2026
444 Ga0268265_10236507 3300028380 Unclassified 1609
445 Ga0268265_10604545 3300028380 Unclassified 1048
446 Ga0268265_11353750 3300028380 Unclassified 713
447 Ga0268264_10061131 3300028381 Bacteria 3159
448 Ga0268264_10577247 3300028381 Bacteria 1106
449 Ga0268264_11197815 3300028381 Unclassified 769
450 Ga0307408_100011282 3300031548 Bacteria 5902
451 Ga0307408_100064543 3300031548 Unclassified 2682
452 Ga0307408_100085953 3300031548 Unclassified 2363
453 Ga0307405_11301038 3300031731 Unclassified 632
454 Ga0307406_10162491 3300031901 Bacteria 1607
455 Ga0307406_10535063 3300031901 Unclassified 956
456 Ga0307406_11529436 3300031901 Unclassified 588
457 Ga0307412_10378710 3300031911 Bacteria 1145
458 Ga0307412_10434875 3300031911 Bacteria 1077
459 Ga0307409_100903405 3300031995 Unclassified 897
460 Ga0307416_100685697 3300032002 Unclassified 1112
461 Ga0307416_100715978 3300032002 Unclassified 1091
462 Ga0307416_101006900 3300032002 Bacteria 936
463 Ga0307411_10559226 3300032005 Bacteria 977
464 Ga0373940_0005103 3300035088 Bacteria 2825
465 Ga0373940_0201393 3300035088 Unclassified 654
466 Ga0373949_0043941 3300035090 Unclassified 1107
467 Ga0373932_0068842 3300035112 Bacteria 1093
468 Ga0373956_0198935 3300035119 Bacteria 950
469 Ga0373960_0044977 3300035121 Bacteria 1291
470 Ga0373946_0219035 3300035171 Unclassified 918
471 Ga0373961_0131463 3300035241 Bacteria 838
472 Ga0373962_0009527 3300035242 Bacteria 2409
473 Ga0373931_0000725 3300035691 Bacteria 13714
474 Ga0373931_0037364 3300035691 Unclassified 2536
475 Ga0373931_0206871 3300035691 Unclassified 1175
476 Ga0373937_1022778 3300036401 Unclassified 775
477 Ga0395899_0017904 3300037312 Bacteria 5392
478 Ga0395899_0079931 3300037312 Bacteria 2381
479 Ga0395900_0061158 3300037418 Bacteria 3873
480 Ga0395900_0182077 3300037418 Bacteria 2134
481 Ga0395898_0001915 3300037466 Bacteria 26488
482 Ga0395905_0241423 3300037471 Bacteria 1688
483 Ga0395901_0000430 3300038443 Bacteria 49340
484 Ga0395901_1669781 3300038443 Unclassified 589
485 Ga0439441_001378 3300042001 Bacteria 3149
486 Ga0439444_0072769 3300042437 Unclassified 739
487 Ga0439464_0178821 3300042439 Bacteria 671
488 Ga0451577_0549229 3300042876 Unclassified 1049
489 Ga0453684_1885174 3300044712 Bacteria 605
490 Ga0451576_0416386 3300045051 Unclassified 1409
491 Ga0495580_0030004 3300046472 Bacteria 3941
492 Ga0495584_0354940 3300046491 Bacteria 745
493 Ga0495642_0057388 3300046528 Unclassified 1610
494 Ga0495654_0238142 3300046530 Unclassified 763
495 Ga0495670_0266490 3300046691 Bacteria 915
496 Ga0495636_0259056 3300047318 Bacteria 806
497 Ga0496102_0104125 3300048905 Bacteria 2639
498 Ga0496102_0110918 3300048905 Bacteria 2557
499 Ga0496103_0858047 3300048906 Unclassified 571
500 Ga0496106_0021415 3300048909 Bacteria 4801
501 Ga0496110_1504087 3300048913 Unclassified 583
502 Ga0501317_018024 3300049533 Unclassified 931
503 Ga0501031_0703699 3300049568 Unclassified 649
504 Ga0501031_0827132 3300049568 Bacteria 593
505 Ga0501032_0738831 3300049569 Unclassified 623
506 Ga0501033_0620082 3300049570 Unclassified 741
507 Ga0501036_0513435 3300049572 Bacteria 997
508 Ga0501036_0806933 3300049572 Unclassified 773
509 Ga0501036_1104303 3300049572 Bacteria 648
510 Ga0501038_0531185 3300049574 Unclassified 897
511 Ga0501039_0210773 3300049575 Bacteria 1528
512 Ga0501040_0128443 3300049576 Bacteria 1781
513 Ga0501041_0011758 3300049577 Bacteria 5181
514 Ga0501041_0064059 3300049577 Bacteria 2251
515 Ga0501041_0075851 3300049577 Bacteria 2068
516 Ga0501041_0142653 3300049577 Bacteria 1494
517 Ga0501041_0973499 3300049577 Bacteria 546
518 Ga0501042_0009775 3300049578 Bacteria 6409
519 Ga0501042_0058818 3300049578 Bacteria 2744
520 Ga0501042_0638607 3300049578 Unclassified 774
521 Ga0501043_0437652 3300049579 Bacteria 984
522 Ga0501046_0077255 3300049580 Unclassified 2578
523 Ga0501046_0503483 3300049580 Bacteria 867
524 Ga0501046_0869614 3300049580 Unclassified 630
525 Ga0501048_0150372 3300049582 Bacteria 1647
526 Ga0501048_0322890 3300049582 Unclassified 1100
527 Ga0501067_0017202 3300049583 Bacteria 3996
528 Ga0501068_0129610 3300049584 Bacteria 1577
529 Ga0501068_0462090 3300049584 Unclassified 822
530 Ga0501068_0664183 3300049584 Unclassified 681
531 Ga0501069_0008585 3300049585 Bacteria 5373
532 Ga0501070_1004361 3300049586 Unclassified 647
533 Ga0501071_0019674 3300049587 Bacteria 4686
534 Ga0501071_0289572 3300049587 Bacteria 1240
535 Ga0501071_0497471 3300049587 Unclassified 935
536 Ga0501071_0961792 3300049587 Bacteria 659
537 Ga0501072_0003938 3300049588 Bacteria 11233
538 Ga0501072_0137467 3300049588 Bacteria 1948
539 Ga0501072_0337373 3300049588 Unclassified 1197
540 Ga0501072_0524792 3300049588 Bacteria 936
541 Ga0501073_0124917 3300049589 Unclassified 1784
542 Ga0501074_0243447 3300049590 Bacteria 1279
543 Ga0501075_0067218 3300049591 Bacteria 2706
544 Ga0501075_0070610 3300049591 Bacteria 2639
545 Ga0501075_0110793 3300049591 Bacteria 2087
546 Ga0501075_0145245 3300049591 Bacteria 1808
547 Ga0501075_0228051 3300049591 Unclassified 1420
548 Ga0501075_0473611 3300049591 Bacteria 955
549 Ga0501075_0545362 3300049591 Unclassified 885
550 Ga0501075_0699927 3300049591 Unclassified 772
551 Ga0501075_0877478 3300049591 Unclassified 682
552 Ga0501075_1195388 3300049591 Unclassified 577
553 Ga0501076_0074896 3300049592 Bacteria 2713
554 Ga0501076_0096615 3300049592 Bacteria 2380
555 Ga0501076_0198069 3300049592 Unclassified 1640
556 Ga0501076_0481610 3300049592 Bacteria 1022
557 Ga0501077_0002088 3300049593 Bacteria 12047
558 Ga0501077_0011132 3300049593 Bacteria 5612
559 Ga0501077_0195462 3300049593 Unclassified 1285
560 Ga0501077_0503742 3300049593 Bacteria 776
561 Ga0501079_0003818 3300049741 Bacteria 11132
562 Ga0501079_0561324 3300049741 Bacteria 898
563 Ga0501080_0250599 3300049742 Bacteria 1615
564 Ga0501081_0020048 3300049743 Bacteria 4457
565 Ga0501081_0054459 3300049743 Bacteria 2764
566 Ga0501081_0056528 3300049743 Bacteria 2712
567 Ga0501081_0058236 3300049743 Bacteria 2673
568 Ga0501081_0066553 3300049743 Bacteria 2506
569 Ga0501081_0172116 3300049743 Bacteria 1564
570 Ga0501081_0322301 3300049743 Bacteria 1136
571 Ga0501083_0446617 3300049744 Bacteria 842
572 Ga0501035_0318966 3300049822 Bacteria 1306
573 Ga0501045_0084753 3300049824 Unclassified 2338
574 Ga0501045_0214883 3300049824 Bacteria 1432
575 Ga0501045_0215149 3300049824 Bacteria 1431
576 Ga0501045_0320316 3300049824 Bacteria 1154
577 Ga0501045_1184444 3300049824 Unclassified 558
578 Ga0501204_079352 3300049850 Bacteria 555
579 nmdc:mga05p37_103863_c1 3300050507 Bacteria 3497
580 nmdc:mga05p37_1211378_c1 3300050507 Bacteria 779
581 nmdc:mga05p37_1387024_c1 3300050507 Unclassified 709
582 nmdc:mga05p37_15051_c1 3300050507 Bacteria 9287
583 nmdc:mga05p37_215918_c1 3300050507 Bacteria 2317
584 nmdc:mga05p37_2490_c1 3300050507 Bacteria 21416
585 nmdc:mga05p37_2587_c1 3300050507 Bacteria 21039
586 nmdc:mga05p37_304190_c1 3300050507 Bacteria 1893
587 nmdc:mga05p37_348870_c1 3300050507 Bacteria 1743
588 nmdc:mga05p37_352422_c1 3300050507 Unclassified 1733
589 nmdc:mga05p37_412_c1 3300050507 Bacteria 46171
590 nmdc:mga05p37_44015_c1 3300050507 Bacteria 5493
591 nmdc:mga05p37_49118_c1 3300050507 Bacteria 5190
592 nmdc:mga05p37_502695_c1 3300050507 Bacteria 1391
593 nmdc:mga05p37_511_c1 3300050507 Bacteria 42907
594 nmdc:mga05p37_51647_c1 3300050507 Bacteria 5055
595 nmdc:mga05p37_77724_c1 3300050507 Bacteria 4086
596 nmdc:mga05p37_82770_c1 3300050507 Bacteria 3955
597 nmdc:mga05p37_953772_c1 3300050507 Unclassified 918
598 nmdc:mga09592_21201_c1 3300050508 Bacteria 5354
599 nmdc:mga09592_218172_c1 3300050508 Bacteria 1653
600 nmdc:mga09592_308206_c1 3300050508 Bacteria 1372
601 nmdc:mga09592_381588_c1 3300050508 Bacteria 1219
602 nmdc:mga09592_467418_c1 3300050508 Bacteria 1088
603 nmdc:mga09592_470418_c1 3300050508 Unclassified 1084
604 nmdc:mga09592_485411_c1 3300050508 Unclassified 1064
605 nmdc:mga09592_5825_c1 3300050508 Bacteria 10049
606 nmdc:mga09592_601_c1 3300050508 Bacteria 27297
607 nmdc:mga09592_67856_c1 3300050508 Bacteria 3025
608 nmdc:mga09592_89150_c1 3300050508 Bacteria 2635
609 nmdc:mga09592_9693_c1 3300050508 Bacteria 7822
610 nmdc:mga0qj67_108165_c1 3300050509 Bacteria 2243
611 nmdc:mga0qj67_16544_c1 3300050509 Bacteria 5596
612 nmdc:mga0qj67_18662_c1 3300050509 Bacteria 5288
613 nmdc:mga0qj67_23312_c1 3300050509 Bacteria 4760
614 nmdc:mga0qj67_282401_c1 3300050509 Bacteria 1345
615 nmdc:mga0qj67_317482_c1 3300050509 Bacteria 1261
616 nmdc:mga0qj67_382325_c1 3300050509 Unclassified 1137
617 nmdc:mga0qj67_486482_c1 3300050509 Bacteria 993
618 nmdc:mga0qj67_611164_c1 3300050509 Bacteria 871
619 nmdc:mga0qj67_619009_c1 3300050509 Unclassified 865
620 nmdc:mga06r32_11696_c1 3300050510 Bacteria 7899
621 nmdc:mga06r32_150409_c1 3300050510 Bacteria 2306
622 nmdc:mga06r32_1555796_c1 3300050510 Unclassified 601
623 nmdc:mga06r32_2397_c1 3300050510 Bacteria 16778
624 nmdc:mga06r32_32903_c1 3300050510 Bacteria 4882
625 nmdc:mga06r32_40106_c1 3300050510 Unclassified 981
626 nmdc:mga06r32_4095_c1 3300050510 Bacteria 13070
627 nmdc:mga06r32_468028_c1 3300050510 Unclassified 1239
628 nmdc:mga06r32_492085_c1 3300050510 Unclassified 1204
629 nmdc:mga06r32_596668_c1 3300050510 Bacteria 1075
630 nmdc:mga06r32_6019_c1 3300050510 Bacteria 10915
631 nmdc:mga06r32_66716_c1 3300050510 Bacteria 3473
632 nmdc:mga06r32_855231_c1 3300050510 Bacteria 868
633 nmdc:mga06r32_914743_c1 3300050510 Bacteria 833
634 nmdc:mga08y16_1300_c1 3300050511 Bacteria 24801
635 nmdc:mga08y16_146857_c1 3300050511 Bacteria 2452
636 nmdc:mga08y16_1554504_c1 3300050511 Unclassified 621
637 nmdc:mga08y16_166466_c1 3300050511 Unclassified 2290
638 nmdc:mga08y16_241485_c1 3300050511 Unclassified 776
639 nmdc:mga0n895_106788_c1 3300050512 Bacteria 2813
640 nmdc:mga0n895_169853_c1 3300050512 Bacteria 2213
641 nmdc:mga0n895_170199_c1 3300050512 Bacteria 2210
642 nmdc:mga0n895_269468_c1 3300050512 Bacteria 1727
643 nmdc:mga0n895_347_c1 3300050512 Bacteria 31070
644 nmdc:mga0n895_520694_c1 3300050512 Bacteria 1197
645 nmdc:mga0n895_5437_c1 3300050512 Bacteria 10646
646 nmdc:mga0n895_64928_c1 3300050512 Bacteria 3612
647 nmdc:mga0n895_84875_c1 3300050512 Bacteria 3160
648 nmdc:mga0rr50_1154777_c1 3300050513 Bacteria 658
649 nmdc:mga0rr50_222320_c1 3300050513 Unclassified 1560
650 nmdc:mga0rr50_25011_c1 3300050513 Bacteria 4146
651 nmdc:mga0rr50_336777_c1 3300050513 Bacteria 1267
652 nmdc:mga0rr50_387795_c1 3300050513 Bacteria 1179
653 nmdc:mga0rr50_7002_c1 3300050513 Bacteria 6919
654 nmdc:mga0rr50_821_c1 3300050513 Bacteria 16708
655 nmdc:mga0rr50_845476_c1 3300050513 Unclassified 780
656 nmdc:mga08x19_135893_c1 3300050514 Bacteria 1657
657 nmdc:mga08x19_154804_c1 3300050514 Bacteria 1554
658 nmdc:mga08x19_19015_c1 3300050514 Bacteria 4212
659 nmdc:mga08x19_343203_c1 3300050514 Bacteria 1042
660 nmdc:mga08x19_5074_c1 3300050514 Bacteria 7788
661 nmdc:mga08x19_99898_c1 3300050514 Unclassified 1924
662 nmdc:mga0a205_129716_c1 3300050515 Unclassified 2422
663 nmdc:mga0a205_1494_c1 3300050515 Bacteria 19946
664 nmdc:mga0a205_2686_c1 3300050515 Bacteria 7775
665 nmdc:mga0a205_30369_c1 3300050515 Bacteria 5174
666 nmdc:mga0a205_322146_c1 3300050515 Unclassified 1417
667 nmdc:mga0a205_442866_c1 3300050515 Bacteria 1160
668 nmdc:mga0a205_81518_c1 3300050515 Bacteria 3125
669 Ga0501084_0005538 3300054114 Bacteria 10365
670 Ga0501084_0047935 3300054114 Bacteria 3578
671 Ga0501084_0282001 3300054114 Bacteria 1403
672 Ga0501084_0623563 3300054114 Bacteria 911
673 Ga0501084_0696004 3300054114 Unclassified 857
674 Ga0590075_058909 3300059424 Bacteria 989
675 Ga0587080_165429 3300059503 Unclassified 521
676 Ga0501082_0002253 3300060353 Bacteria 16888
677 Ga0501082_0022418 3300060353 Bacteria 5439
678 Ga0501082_0108291 3300060353 Bacteria 2405
679 Ga0501082_0553255 3300060353 Bacteria 1006
680 Ga0501082_0617975 3300060353 Unclassified 948
681 Ga0501082_1066191 3300060353 Bacteria 706
682 Ga0501082_1113343 3300060353 Unclassified 690
683 Ga0530510_0035107 3300061734 Unclassified 3613
684 Ga0530510_0050821 3300061734 Bacteria 2995
685 Ga0530510_0059723 3300061734 Bacteria 2758
686 Ga0530510_0098095 3300061734 Unclassified 2143
687 Ga0530510_0169870 3300061734 Bacteria 1615
688 Ga0530510_0212096 3300061734 Bacteria 1439
689 Ga0530510_0521046 3300061734 Bacteria 902
690 Ga0530510_0710785 3300061734 Bacteria 766
691 Ga0530510_0717681 3300061734 Bacteria 762
692 nmdc:mga0qj67_883073_c1
693 JGI25406J46586_10009822
694 JGI25406J46586_10120152
695 JGI25405J52794_10013373
696 Ga0058859_11734936
697 Ga0058859_11809412
698 Ga0058861_11464219
699 Ga0058860_12017444
700 Ga0058860_12051980
701 Ga0058862_11757287
702 Ga0058862_12124495
703 Ga0065704_10642448
704 Ga0065715_10243779
705 Ga0065707_10265945
706 Ga0065707_10295761
707 Ga0065707_10409273
708 Ga0065707_10738600
709 Ga0065707_10823083
710 Ga0070676_10291305
711 Ga0070690_100081121
712 Ga0070670_100361711
713 Ga0070670_100442388
714 Ga0068869_100027257
715 Ga0068869_100400671
716 Ga0068869_100715762
717 Ga0070666_10172021
718 Ga0070680_100016864
719 Ga0070680_101302156
720 Ga0070682_100185076
721 Ga0068868_100424836
722 Ga0068868_101443176
723 Ga0070660_100430484
724 Ga0070689_101931598
725 Ga0070691_10015166
726 Ga0070692_10004546
727 Ga0070692_10035210
728 Ga0070668_100508009
729 Ga0070668_101040971
730 Ga0070669_100226195
731 Ga0070669_100241299
732 Ga0070669_100289633
733 Ga0070675_100141832
734 Ga0070675_101038001
735 Ga0070671_101226164
736 Ga0070674_100128369
737 Ga0070673_100322399
738 Ga0070673_101233695
739 Ga0070688_100284561
740 Ga0070659_100316033
741 Ga0070667_101639972
742 Ga0070667_101644952
743 Ga0070667_101759040
744 Ga0070701_10013918
745 Ga0070701_10042546
746 Ga0070711_101267878
747 Ga0070705_100012313
748 Ga0070705_100026993
749 Ga0070705_100036510
750 Ga0070705_100604545
751 Ga0070700_100197636
752 Ga0070694_100123671
753 Ga0070694_100134171
754 Ga0070694_100309099
755 Ga0070694_100462753
756 Ga0070694_100577115
757 Ga0070694_101874133
758 Ga0070708_100225123
759 Ga0070708_100259216
760 Ga0070708_100353250
761 Ga0070708_100416206
762 Ga0070708_100626686
763 Ga0070708_100862583
764 Ga0070708_102188293
765 Ga0070663_100107018
766 Ga0070663_100523111
767 Ga0070678_100066659
768 Ga0070681_10029789
769 Ga0068867_100023303
770 Ga0068867_100088086
771 Ga0068867_100460339
772 Ga0068867_100493828
773 Ga0068867_101088709
774 Ga0070685_10732331
775 Ga0070685_10912221
776 Ga0070706_100052368
777 Ga0070706_100222854
778 Ga0070706_100443057
779 Ga0070706_100656643
780 Ga0070707_100001920
781 Ga0070707_100018777
782 Ga0070707_100306080
783 Ga0070707_100352324
784 Ga0070707_100568988
785 Ga0070707_100629182
786 Ga0070707_100680105
787 Ga0070698_100016896
788 Ga0070698_100143307
789 Ga0070698_100274634
790 Ga0070698_100298852
791 Ga0070698_100519909
792 Ga0070698_100580050
793 Ga0070698_100988634
794 Ga0070698_101057902
795 Ga0070699_100003894
796 Ga0070699_100013128
797 Ga0070699_100443446
798 Ga0070699_100482795
799 Ga0070699_100829326
800 Ga0070699_101439106
801 Ga0070699_101595110
802 Ga0070679_100453026
803 Ga0070679_100744268
804 Ga0070697_100000306
805 Ga0070697_100091517
806 Ga0070697_100108426
807 Ga0070697_100279681
808 Ga0070697_100388989
809 Ga0070697_100646638
810 Ga0070697_100979202
811 Ga0070697_101041532
812 Ga0070697_101180207
813 Ga0068853_100013426
814 Ga0070686_100201942
815 Ga0070686_100412868
816 Ga0070686_101243720
817 Ga0070695_100060469
818 Ga0070695_100345856
819 Ga0070696_100009477
820 Ga0070696_100067801
821 Ga0070696_100147647
822 Ga0070696_100176997
823 Ga0070665_100062887
824 Ga0070665_100219311
825 Ga0070704_100041275
826 Ga0070704_100104429
827 Ga0070704_100152104
828 Ga0070704_100435544
829 Ga0070704_100689324
830 Ga0070704_100840970
831 Ga0070704_101767579
832 Ga0068855_100090483
833 Ga0070664_100206368
834 Ga0068857_100008709
835 Ga0068857_100149422
836 Ga0068857_100406499
837 Ga0068854_101512017
838 Ga0068854_101775849
839 Ga0068856_100354893
840 Ga0070702_101457071
841 Ga0068852_100379847
842 Ga0068859_100020684
843 Ga0068859_100021964
844 Ga0068859_100058049
845 Ga0068859_100399997
846 Ga0068859_101247837
847 Ga0068864_100304949
848 Ga0068864_101089811
849 Ga0068866_10075342
850 Ga0068866_10171950
851 Ga0068866_10564933
852 Ga0068861_100047477
853 Ga0068861_100295396
854 Ga0068861_101973544
855 Ga0068870_10246613
856 Ga0068863_100185929
857 Ga0068863_102303222
858 Ga0068858_100066399
859 Ga0068858_100509635
860 Ga0068860_100044333
861 Ga0068860_100121361
862 Ga0068860_100291112
863 Ga0068860_100916494
864 Ga0068860_101247720
865 Ga0068860_102042367
866 Ga0068862_100126790
867 Ga0068862_100246078
868 Ga0068862_100281700
869 Ga0068862_100439633
870 Ga0068862_102239795
871 Ga0081455_10013059
872 Ga0081455_10128874
873 Ga0081455_10131175
874 Ga0081538_10017567
875 Ga0081538_10071895
876 Ga0081540_1003045
877 Ga0081540_1039402
878 Ga0081540_1210457
879 Ga0081539_10000002
880 Ga0081539_10026753
881 Ga0075432_10017830
882 Ga0075432_10481088
883 Ga0097621_100039351
884 Ga0068871_100014151
885 Ga0068871_101012108
886 Ga0075428_100000401
887 Ga0075428_100016398
888 Ga0075428_100050598
889 Ga0075428_100104581
890 Ga0075428_100122215
891 Ga0075428_100151186
892 Ga0075428_100425478
893 Ga0075428_100488925
894 Ga0075428_100980934
895 Ga0075428_101249005
896 Ga0075430_100001040
897 Ga0075430_100002353
898 Ga0075430_100109836
899 Ga0075430_100129802
900 Ga0075430_100344994
901 Ga0075430_100350142
902 Ga0075430_100406363
903 Ga0075430_100983826
904 Ga0075430_101202733
905 Ga0075430_101535853
906 Ga0075431_100000044
907 Ga0075431_100003282
908 Ga0075431_100003487
909 Ga0075431_100005687
910 Ga0075431_100014010
911 Ga0075431_100024059
912 Ga0075431_100155505
913 Ga0075431_100248008
914 Ga0075431_100302112
915 Ga0075431_100323837
916 Ga0075431_100680344
917 Ga0075431_100712297
918 Ga0075431_101811117
919 Ga0075433_10000086
920 Ga0075433_10002894
921 Ga0075433_10047339
922 Ga0075433_10050696
923 Ga0075433_10101438
924 Ga0075433_10119649
925 Ga0075433_10450378
926 Ga0075433_11009896
927 Ga0075433_11212349
928 Ga0075434_100004175
929 Ga0075434_100019747
930 Ga0075434_100031947
931 Ga0075434_100032220
932 Ga0075434_100050891
933 Ga0075434_100057678
934 Ga0075434_100095857
935 Ga0075434_100786444
936 Ga0075434_100827597
937 Ga0075434_101814252
938 Ga0075429_100000897
939 Ga0075429_100008463
940 Ga0075429_100014743
941 Ga0075429_100039051
942 Ga0075429_100077024
943 Ga0075429_100100668
944 Ga0075429_100217542
945 Ga0075429_100267303
946 Ga0075429_100421571
947 Ga0075429_100423113
948 Ga0075429_100497159
949 Ga0068865_100183034
950 Ga0068865_100231034
951 Ga0075436_100002427
952 Ga0075436_100017212
953 Ga0075436_100057059
954 Ga0075436_100090574
955 Ga0075436_100144445
956 Ga0075436_100181412
957 Ga0075436_100381961
958 Ga0097620_100020684
959 Ga0097620_100021964
960 Ga0097620_100058047
961 Ga0097620_100400006
962 Ga0097620_101247562
963 Ga0075435_100004767
964 Ga0075435_100007018
965 Ga0075435_100011744
966 Ga0075435_100034184
967 Ga0075435_100041701
968 Ga0075435_100082223
969 Ga0075435_100474995
970 Ga0075435_101200663
971 Ga0099794_10501386
972 Ga0111539_10006976
973 Ga0111539_10066446
974 Ga0111539_10462531
975 Ga0111539_10808620
976 Ga0111539_10942592
977 Ga0111539_11522941
978 Ga0105245_10043690
979 Ga0105245_10481062
980 Ga0105247_10050290
981 Ga0105247_10619185
982 Ga0114129_10000089
983 Ga0114129_10000385
984 Ga0114129_10001642
985 Ga0114129_10010238
986 Ga0114129_10017316
987 Ga0114129_10020844
988 Ga0114129_10029628
989 Ga0114129_10039200
990 Ga0114129_10082971
991 Ga0114129_10087714
992 Ga0114129_10088783
993 Ga0114129_10093173
994 Ga0114129_10217014
995 Ga0114129_10224169
996 Ga0114129_10421761
997 Ga0114129_10422260
998 Ga0114129_10441863
999 Ga0114129_10813723
1000 Ga0114129_11104243
1001 Ga0114129_11132157
1002 Ga0114129_11956337
1003 Ga0105243_10112676
1004 Ga0105243_10471145
1005 Ga0105243_11178826
1006 Ga0105241_10015832
1007 Ga0105241_10335538
1008 Ga0105241_11075141
1009 Ga0105242_10004108
1010 Ga0105242_11094819
1011 Ga0105248_10015275
1012 Ga0105248_10678919
1013 Ga0105237_10087268
1014 Ga0105237_10427037
1015 Ga0105249_10084909
1016 Ga0105249_10109399
1017 Ga0105249_10371993
1018 Ga0105249_10651747
1019 Ga0105249_11303633
1020 Ga0105239_10063437
1021 Ga0105239_10084538
1022 Ga0105239_10091427
1023 Ga0105239_10236125
1024 Ga0105246_10181200
1025 Ga0105246_10416564
1026 Ga0157373_11009558
1027 Ga0157374_10120023
1028 Ga0157374_10194766
1029 Ga0157374_10515466
1030 Ga0157378_10024073
1031 Ga0157378_10318567
1032 Ga0157378_10430774
1033 Ga0157378_11579624
1034 Ga0163162_10043934
1035 Ga0163162_10090572
1036 Ga0163162_10929940
1037 Ga0157375_10012444
1038 Ga0157375_10107389
1039 Ga0157375_10167839
1040 Ga0157375_10354980
1041 Ga0157380_10591421
1042 Ga0157380_11230521
1043 Ga0157380_12520065
1044 Ga0157379_10047620
1045 Ga0157379_10086879
1046 Ga0157376_10035527
1047 Ga0206353_11510663
1048 Ga0207653_10004291
1049 Ga0207642_10013135
1050 Ga0207642_10048506
1051 Ga0207710_10140116
1052 Ga0207688_10092075
1053 Ga0207680_10397333
1054 Ga0207645_10498010
1055 Ga0207684_10000961
1056 Ga0207684_10019957
1057 Ga0207684_10040590
1058 Ga0207684_10421782
1059 Ga0207654_10010877
1060 Ga0207654_10233652
1061 Ga0207654_10276648
1062 Ga0207707_10224367
1063 Ga0207707_11065665
1064 Ga0207671_10189170
1065 Ga0207671_11562618
1066 Ga0207660_10510736
1067 Ga0207660_11295815
1068 Ga0207657_10391473
1069 Ga0207652_10242226
1070 Ga0207652_10768579
1071 Ga0207646_10006796
1072 Ga0207646_10043827
1073 Ga0207646_10080484
1074 Ga0207646_10402457
1075 Ga0207681_10037324
1076 Ga0207681_10394101
1077 Ga0207694_11709286
1078 Ga0207650_10503697
1079 Ga0207659_10880817
1080 Ga0207687_10296880
1081 Ga0207687_10584892
1082 Ga0207644_11132639
1083 Ga0207690_10359779
1084 Ga0207686_10297118
1085 Ga0207686_10607506
1086 Ga0207709_10003251
1087 Ga0207709_10234363
1088 Ga0207670_10637011
1089 Ga0207669_10030337
1090 Ga0207691_10475998
1091 Ga0207691_10492007
1092 Ga0207711_10060322
1093 Ga0207689_10002168
1094 Ga0207689_10404356
1095 Ga0207689_10610468
1096 Ga0207679_10055894
1097 Ga0207667_10168739
1098 Ga0207651_10442363
1099 Ga0207651_10862301
1100 Ga0207712_10367642
1101 Ga0207712_11408453
1102 Ga0207712_11462266
1103 Ga0207712_11731905
1104 Ga0207658_10655236
1105 Ga0207677_10109045
1106 Ga0207703_10047868
1107 Ga0207703_10127282
1108 Ga0207703_10274614
1109 Ga0207639_10039923
1110 Ga0207678_10383067
1111 Ga0207708_10063664
1112 Ga0207708_10318374
1113 Ga0207702_11347726
1114 Ga0207641_10311803
1115 Ga0207648_10038656
1116 Ga0207648_10245227
1117 Ga0207648_10448026
1118 Ga0207676_10216486
1119 Ga0207676_11710362
1120 Ga0207674_10036752
1121 Ga0207674_10223665
1122 Ga0207674_10235111
1123 Ga0207674_10280005
1124 Ga0207675_100054121
1125 Ga0207675_100118459
1126 Ga0207675_101121143
1127 Ga0207683_10292592
1128 Ga0207683_10548971
1129 Ga0209974_10038963
1130 Ga0207428_10000029
1131 Ga0207428_10000613
1132 Ga0207428_10532911
1133 Ga0207428_11137117
1134 Ga0268265_10139681
1135 Ga0268265_10236507
1136 Ga0268265_10604545
1137 Ga0268265_11353750
1138 Ga0268264_10061131
1139 Ga0268264_10577247
1140 Ga0268264_11197815
1141 Ga0307408_100011282
1142 Ga0307408_100064543
1143 Ga0307408_100085953
1144 Ga0307405_11301038
1145 Ga0307406_10162491
1146 Ga0307406_10535063
1147 Ga0307406_11529436
1148 Ga0307412_10378710
1149 Ga0307412_10434875
1150 Ga0307409_100903405
1151 Ga0307416_100685697
1152 Ga0307416_100715978
1153 Ga0307416_101006900
1154 Ga0307411_10559226
1155 Ga0373940_0005103
1156 Ga0373940_0201393
1157 Ga0373949_0043941
1158 Ga0373932_0068842
1159 Ga0373956_0198935
1160 Ga0373960_0044977
1161 Ga0373946_0219035
1162 Ga0373961_0131463
1163 Ga0373962_0009527
1164 Ga0373931_0000725
1165 Ga0373931_0037364
1166 Ga0373931_0206871
1167 Ga0373937_1022778
1168 Ga0395899_0017904
1169 Ga0395899_0079931
1170 Ga0395900_0061158
1171 Ga0395900_0182077
1172 Ga0395898_0001915
1173 Ga0395905_0241423
1174 Ga0395901_0000430
1175 Ga0395901_1669781
1176 Ga0439441_001378
1177 Ga0439444_0072769
1178 Ga0439464_0178821
1179 Ga0451577_0549229
1180 Ga0453684_1885174
1181 Ga0451576_0416386
1182 Ga0495580_0030004
1183 Ga0495584_0354940
1184 Ga0495642_0057388
1185 Ga0495654_0238142
1186 Ga0495670_0266490
1187 Ga0495636_0259056
1188 Ga0496102_0104125
1189 Ga0496102_0110918
1190 Ga0496103_0858047
1191 Ga0496106_0021415
1192 Ga0496110_1504087
1193 Ga0501317_018024
1194 Ga0501031_0703699
1195 Ga0501031_0827132
1196 Ga0501032_0738831
1197 Ga0501033_0620082
1198 Ga0501036_0513435
1199 Ga0501036_0806933
1200 Ga0501036_1104303
1201 Ga0501038_0531185
1202 Ga0501039_0210773
1203 Ga0501040_0128443
1204 Ga0501041_0011758
1205 Ga0501041_0064059
1206 Ga0501041_0075851
1207 Ga0501041_0142653
1208 Ga0501041_0973499
1209 Ga0501042_0009775
1210 Ga0501042_0058818
1211 Ga0501042_0638607
1212 Ga0501043_0437652
1213 Ga0501046_0077255
1214 Ga0501046_0503483
1215 Ga0501046_0869614
1216 Ga0501048_0150372
1217 Ga0501048_0322890
1218 Ga0501067_0017202
1219 Ga0501068_0129610
1220 Ga0501068_0462090
1221 Ga0501068_0664183
1222 Ga0501069_0008585
1223 Ga0501070_1004361
1224 Ga0501071_0019674
1225 Ga0501071_0289572
1226 Ga0501071_0497471
1227 Ga0501071_0961792
1228 Ga0501072_0003938
1229 Ga0501072_0137467
1230 Ga0501072_0337373
1231 Ga0501072_0524792
1232 Ga0501073_0124917
1233 Ga0501074_0243447
1234 Ga0501075_0067218
1235 Ga0501075_0070610
1236 Ga0501075_0110793
1237 Ga0501075_0145245
1238 Ga0501075_0228051
1239 Ga0501075_0473611
1240 Ga0501075_0545362
1241 Ga0501075_0699927
1242 Ga0501075_0877478
1243 Ga0501075_1195388
1244 Ga0501076_0074896
1245 Ga0501076_0096615
1246 Ga0501076_0198069
1247 Ga0501076_0481610
1248 Ga0501077_0002088
1249 Ga0501077_0011132
1250 Ga0501077_0195462
1251 Ga0501077_0503742
1252 Ga0501079_0003818
1253 Ga0501079_0561324
1254 Ga0501080_0250599
1255 Ga0501081_0020048
1256 Ga0501081_0054459
1257 Ga0501081_0056528
1258 Ga0501081_0058236
1259 Ga0501081_0066553
1260 Ga0501081_0172116
1261 Ga0501081_0322301
1262 Ga0501083_0446617
1263 Ga0501035_0318966
1264 Ga0501045_0084753
1265 Ga0501045_0214883
1266 Ga0501045_0215149
1267 Ga0501045_0320316
1268 Ga0501045_1184444
1269 Ga0501204_079352
1270 nmdc:mga05p37_103863_c1
1271 nmdc:mga05p37_1211378_c1
1272 nmdc:mga05p37_1387024_c1
1273 nmdc:mga05p37_15051_c1
1274 nmdc:mga05p37_215918_c1
1275 nmdc:mga05p37_2490_c1
1276 nmdc:mga05p37_2587_c1
1277 nmdc:mga05p37_304190_c1
1278 nmdc:mga05p37_348870_c1
1279 nmdc:mga05p37_352422_c1
1280 nmdc:mga05p37_412_c1
1281 nmdc:mga05p37_44015_c1
1282 nmdc:mga05p37_49118_c1
1283 nmdc:mga05p37_502695_c1
1284 nmdc:mga05p37_511_c1
1285 nmdc:mga05p37_51647_c1
1286 nmdc:mga05p37_77724_c1
1287 nmdc:mga05p37_82770_c1
1288 nmdc:mga05p37_953772_c1
1289 nmdc:mga09592_21201_c1
1290 nmdc:mga09592_218172_c1
1291 nmdc:mga09592_308206_c1
1292 nmdc:mga09592_381588_c1
1293 nmdc:mga09592_467418_c1
1294 nmdc:mga09592_470418_c1
1295 nmdc:mga09592_485411_c1
1296 nmdc:mga09592_5825_c1
1297 nmdc:mga09592_601_c1
1298 nmdc:mga09592_67856_c1
1299 nmdc:mga09592_89150_c1
1300 nmdc:mga09592_9693_c1
1301 nmdc:mga0qj67_108165_c1
1302 nmdc:mga0qj67_16544_c1
1303 nmdc:mga0qj67_18662_c1
1304 nmdc:mga0qj67_23312_c1
1305 nmdc:mga0qj67_282401_c1
1306 nmdc:mga0qj67_317482_c1
1307 nmdc:mga0qj67_382325_c1
1308 nmdc:mga0qj67_486482_c1
1309 nmdc:mga0qj67_611164_c1
1310 nmdc:mga0qj67_619009_c1
1311 nmdc:mga06r32_11696_c1
1312 nmdc:mga06r32_150409_c1
1313 nmdc:mga06r32_1555796_c1
1314 nmdc:mga06r32_2397_c1
1315 nmdc:mga06r32_32903_c1
1316 nmdc:mga06r32_40106_c1
1317 nmdc:mga06r32_4095_c1
1318 nmdc:mga06r32_468028_c1
1319 nmdc:mga06r32_492085_c1
1320 nmdc:mga06r32_596668_c1
1321 nmdc:mga06r32_6019_c1
1322 nmdc:mga06r32_66716_c1
1323 nmdc:mga06r32_855231_c1
1324 nmdc:mga06r32_914743_c1
1325 nmdc:mga08y16_1300_c1
1326 nmdc:mga08y16_146857_c1
1327 nmdc:mga08y16_1554504_c1
1328 nmdc:mga08y16_166466_c1
1329 nmdc:mga08y16_241485_c1
1330 nmdc:mga0n895_106788_c1
1331 nmdc:mga0n895_169853_c1
1332 nmdc:mga0n895_170199_c1
1333 nmdc:mga0n895_269468_c1
1334 nmdc:mga0n895_347_c1
1335 nmdc:mga0n895_520694_c1
1336 nmdc:mga0n895_5437_c1
1337 nmdc:mga0n895_64928_c1
1338 nmdc:mga0n895_84875_c1
1339 nmdc:mga0rr50_1154777_c1
1340 nmdc:mga0rr50_222320_c1
1341 nmdc:mga0rr50_25011_c1
1342 nmdc:mga0rr50_336777_c1
1343 nmdc:mga0rr50_387795_c1
1344 nmdc:mga0rr50_7002_c1
1345 nmdc:mga0rr50_821_c1
1346 nmdc:mga0rr50_845476_c1
1347 nmdc:mga08x19_135893_c1
1348 nmdc:mga08x19_154804_c1
1349 nmdc:mga08x19_19015_c1
1350 nmdc:mga08x19_343203_c1
1351 nmdc:mga08x19_5074_c1
1352 nmdc:mga08x19_99898_c1
1353 nmdc:mga0a205_129716_c1
1354 nmdc:mga0a205_1494_c1
1355 nmdc:mga0a205_2686_c1
1356 nmdc:mga0a205_30369_c1
1357 nmdc:mga0a205_322146_c1
1358 nmdc:mga0a205_442866_c1
1359 nmdc:mga0a205_81518_c1
1360 Ga0501084_0005538
1361 Ga0501084_0047935
1362 Ga0501084_0282001
1363 Ga0501084_0623563
1364 Ga0501084_0696004
1365 Ga0590075_058909
1366 Ga0587080_165429
1367 Ga0501082_0002253
1368 Ga0501082_0022418
1369 Ga0501082_0108291
1370 Ga0501082_0553255
1371 Ga0501082_0617975
1372 Ga0501082_1066191
1373 Ga0501082_1113343
1374 Ga0530510_0035107
1375 Ga0530510_0050821
1376 Ga0530510_0059723
1377 Ga0530510_0098095
1378 Ga0530510_0169870
1379 Ga0530510_0212096
1380 Ga0530510_0521046
1381 Ga0530510_0710785
1382 Ga0530510_0717681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

65

130

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8q-assembly1.cif.gz_B-2 crystal structure of a protein with a cupin-like fold and unknown function (bxe_c0505) from burkholderia xenovorans lb400 at 1.55 a resolution 0.8573 19 131
2h0v-assembly1.cif.gz_B crystal structure of a putative quercetin 2,3-dioxygenase (yxag, bsu39980) from bacillus subtilis at 2.60 a resolution 0.8376 18 123
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.8346 18 122
2o8q-assembly1.cif.gz_A-2 crystal structure of a protein with a cupin-like fold and unknown function (bxe_c0505) from burkholderia xenovorans lb400 at 1.55 a resolution 0.8274 9 131
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8272 39 121
ID Description Score Start End Superfamily
2o8qB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8506 19 131 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8477 41 120 2.60.120.10
af_P91416_1_157_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8293 63 121 2.60.120.10
af_Q2G1P7_1_117_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8057 69 121 2.60.120.10
af_Q54S02_3_181_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8039 40 121 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2D5FXH2-F1-model_v4 deleted 0.9282 1 131
AF-A0A068YYX7-F1-model_v4 Identified by similarity to GB:BAC50887.1 0.9251 36 131
AF-A0A7X2KEC3-F1-model_v4 Cupin domain-containing protein 0.921 8 130
AF-A0A6A7KNZ7-F1-model_v4 Cupin domain-containing protein 0.9191 53 130
AF-A0A2E8Y7V5-F1-model_v4 Cupin type-2 domain-containing protein 0.914 52 131

Map