F475583
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 313 | 676 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300026121|Ga0207683_10229171|Ga0207683_102291712 |
| Length | 360 |
| Sequence | VIDLLVGGGGPAGLATALYAAQAGLEVVVVERRPGVLDKACGEGMMPHTIAHLDRLGVAVTGRPLRGITYLDADRRVDAPFRAGVGRGVRRTVLHAAMSDAVRSAGVKFVQGDVGELTQDAESVRAGQFRARYLAAADGLHSPIRKAMGLAKPHSGPRRWGIRRHIQVAPWTDSVEVHWASGAEAYVTPVADDCVGIAILSSGRGGFDCHLDEFPELRDRASGHAHGQDRAAGPLWQGARGRAAGRVLLVGDAAGYIDALTGEGMGLAFGAAEALVNCVIRERPGDYDRQWRRLTRRYRALTAGLVRAAAHPAIRSHIVPAAAALPRVFGVAAQAIRIAEVDIDRFDGRHFCGGRRVEAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 5 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 6 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 7 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 8 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 9 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 10 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 11 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 12 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 13 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 14 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 184 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 185 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 186 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 188 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 189 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 192 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 258 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 259 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 260 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 261 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 264 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 265 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 266 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 290 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 291 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 294 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 295 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 296 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 305 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 306 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 307 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 309 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.69 |
| Metatranscriptomes | 0 |
| Isolates | 2.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.4 |
| Nodule | 0.14 |
| Rhizoplane | 7.66 |
| Rhizosphere | 77.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1002207 | 3300002074 | Bacteria | 2182 |
| 2 | JGI24744J21845_10006091 | 3300002077 | Bacteria | 2501 |
| 3 | JGI24742J22300_10007280 | 3300002244 | Bacteria | 1825 |
| 4 | Ga0055540_1003459 | 3300003792 | Bacteria | 7627 |
| 5 | Ga0055540_1004892 | 3300003792 | Bacteria | 5855 |
| 6 | Ga0055540_1007819 | 3300003792 | Bacteria | 3959 |
| 7 | Ga0070690_100009368 | 3300005330 | Bacteria | 5671 |
| 8 | Ga0070690_100067610 | 3300005330 | Bacteria | 2315 |
| 9 | Ga0070677_10045961 | 3300005333 | Bacteria | 1744 |
| 10 | Ga0068869_100014804 | 3300005334 | Bacteria | 5217 |
| 11 | Ga0070666_10038481 | 3300005335 | Bacteria | 3183 |
| 12 | Ga0070666_10050045 | 3300005335 | Bacteria | 2810 |
| 13 | Ga0070680_100196710 | 3300005336 | Bacteria | 1700 |
| 14 | Ga0070682_100018767 | 3300005337 | Bacteria | 4049 |
| 15 | Ga0070682_100103958 | 3300005337 | Bacteria | 1880 |
| 16 | Ga0068868_100001534 | 3300005338 | Bacteria | 15815 |
| 17 | Ga0068868_100080455 | 3300005338 | Bacteria | 2611 |
| 18 | Ga0070689_100021792 | 3300005340 | Bacteria | 4775 |
| 19 | Ga0070691_10008853 | 3300005341 | Bacteria | 4608 |
| 20 | Ga0070691_10024492 | 3300005341 | Bacteria | 2805 |
| 21 | Ga0070691_10105690 | 3300005341 | Bacteria | 1403 |
| 22 | Ga0070692_10035561 | 3300005345 | Bacteria | 2523 |
| 23 | Ga0070668_100002331 | 3300005347 | Bacteria | 13963 |
| 24 | Ga0070668_100003591 | 3300005347 | Bacteria | 11440 |
| 25 | Ga0070668_100047349 | 3300005347 | Bacteria | 3306 |
| 26 | Ga0070675_100038759 | 3300005354 | Bacteria | 3886 |
| 27 | Ga0070675_100082654 | 3300005354 | Bacteria | 2680 |
| 28 | Ga0070671_100229625 | 3300005355 | Bacteria | 1575 |
| 29 | Ga0070671_100280683 | 3300005355 | Bacteria | 1417 |
| 30 | Ga0070674_100001422 | 3300005356 | Bacteria | 12714 |
| 31 | Ga0070674_100005222 | 3300005356 | Bacteria | 7472 |
| 32 | Ga0070674_100026065 | 3300005356 | Bacteria | 3814 |
| 33 | Ga0070688_100006042 | 3300005365 | Bacteria | 6428 |
| 34 | Ga0070688_100006500 | 3300005365 | Bacteria | 6250 |
| 35 | Ga0070688_100070618 | 3300005365 | Bacteria | 2233 |
| 36 | Ga0070659_100033533 | 3300005366 | Bacteria | 3988 |
| 37 | Ga0070659_100260570 | 3300005366 | Bacteria | 1438 |
| 38 | Ga0070667_100000075 | 3300005367 | Bacteria | 120953 |
| 39 | Ga0070667_100003168 | 3300005367 | Bacteria | 14101 |
| 40 | Ga0070667_100004972 | 3300005367 | Bacteria | 11138 |
| 41 | Ga0070667_100046698 | 3300005367 | Bacteria | 3644 |
| 42 | Ga0070709_10031089 | 3300005434 | Bacteria | 3209 |
| 43 | Ga0070709_10107613 | 3300005434 | Bacteria | 1869 |
| 44 | Ga0070709_10151708 | 3300005434 | Bacteria | 1602 |
| 45 | Ga0070710_10001392 | 3300005437 | Bacteria | 11417 |
| 46 | Ga0070710_10001944 | 3300005437 | Bacteria | 9779 |
| 47 | Ga0070710_10031660 | 3300005437 | Bacteria | 2858 |
| 48 | Ga0070701_10000435 | 3300005438 | Bacteria | 14256 |
| 49 | Ga0070701_10006493 | 3300005438 | Bacteria | 4927 |
| 50 | Ga0070701_10081819 | 3300005438 | Bacteria | 1750 |
| 51 | Ga0070711_100001721 | 3300005439 | Bacteria | 12138 |
| 52 | Ga0070711_100003570 | 3300005439 | Bacteria | 9070 |
| 53 | Ga0070711_100052850 | 3300005439 | Bacteria | 2797 |
| 54 | Ga0070705_100011946 | 3300005440 | Bacteria | 4398 |
| 55 | Ga0070705_100037296 | 3300005440 | Bacteria | 2740 |
| 56 | Ga0070700_100003106 | 3300005441 | Bacteria | 8516 |
| 57 | Ga0070700_100005245 | 3300005441 | Bacteria | 6853 |
| 58 | Ga0070700_100033608 | 3300005441 | Bacteria | 3090 |
| 59 | Ga0070694_100004880 | 3300005444 | Bacteria | 8078 |
| 60 | Ga0070694_100088743 | 3300005444 | Bacteria | 2165 |
| 61 | Ga0070694_100291737 | 3300005444 | Bacteria | 1247 |
| 62 | Ga0070663_100061262 | 3300005455 | Bacteria | 2709 |
| 63 | Ga0070663_100117785 | 3300005455 | Bacteria | 2003 |
| 64 | Ga0070663_100197247 | 3300005455 | Bacteria | 1569 |
| 65 | Ga0070663_100252258 | 3300005455 | Bacteria | 1397 |
| 66 | Ga0070678_100001428 | 3300005456 | Bacteria | 12730 |
| 67 | Ga0070678_100002759 | 3300005456 | Bacteria | 9710 |
| 68 | Ga0070678_100015071 | 3300005456 | Bacteria | 4900 |
| 69 | Ga0070678_100154238 | 3300005456 | Bacteria | 1854 |
| 70 | Ga0070678_100407146 | 3300005456 | Bacteria | 1183 |
| 71 | Ga0070662_100026108 | 3300005457 | Bacteria | 4042 |
| 72 | Ga0068867_100005802 | 3300005459 | Bacteria | 8761 |
| 73 | Ga0068867_100026418 | 3300005459 | Bacteria | 4169 |
| 74 | Ga0070685_10079849 | 3300005466 | Bacteria | 1958 |
| 75 | Ga0070685_10106165 | 3300005466 | Bacteria | 1723 |
| 76 | Ga0070685_10137050 | 3300005466 | Bacteria | 1537 |
| 77 | Ga0070679_100309127 | 3300005530 | Bacteria | 1531 |
| 78 | Ga0068853_100010078 | 3300005539 | Bacteria | 7635 |
| 79 | Ga0068853_100018982 | 3300005539 | Bacteria | 5696 |
| 80 | Ga0068853_100142578 | 3300005539 | Bacteria | 2152 |
| 81 | Ga0068853_100212282 | 3300005539 | Bacteria | 1764 |
| 82 | Ga0070672_100225660 | 3300005543 | Bacteria | 1572 |
| 83 | Ga0070686_100048494 | 3300005544 | Bacteria | 2691 |
| 84 | Ga0070695_100086844 | 3300005545 | Bacteria | 2080 |
| 85 | Ga0070696_100003298 | 3300005546 | Bacteria | 10774 |
| 86 | Ga0070696_100057020 | 3300005546 | Bacteria | 2726 |
| 87 | Ga0070696_100060580 | 3300005546 | Bacteria | 2647 |
| 88 | Ga0070696_100171427 | 3300005546 | Bacteria | 1604 |
| 89 | Ga0070693_100005306 | 3300005547 | Bacteria | 6177 |
| 90 | Ga0070693_100025397 | 3300005547 | Bacteria | 3188 |
| 91 | Ga0070693_100072408 | 3300005547 | Bacteria | 2033 |
| 92 | Ga0070693_100097755 | 3300005547 | Bacteria | 1782 |
| 93 | Ga0070665_100001679 | 3300005548 | Bacteria | 25511 |
| 94 | Ga0070665_100030874 | 3300005548 | Bacteria | 5393 |
| 95 | Ga0070665_100058267 | 3300005548 | Bacteria | 3872 |
| 96 | Ga0070665_100162347 | 3300005548 | Bacteria | 2236 |
| 97 | Ga0070704_100000313 | 3300005549 | Bacteria | 21721 |
| 98 | Ga0070704_100001436 | 3300005549 | Bacteria | 12730 |
| 99 | Ga0070704_100018644 | 3300005549 | Bacteria | 4443 |
| 100 | Ga0070704_100028516 | 3300005549 | Bacteria | 3715 |
| 101 | Ga0070704_100238338 | 3300005549 | Bacteria | 1487 |
| 102 | Ga0068855_100281144 | 3300005563 | Bacteria | 1848 |
| 103 | Ga0068854_100001484 | 3300005578 | Bacteria | 14214 |
| 104 | Ga0068854_100002812 | 3300005578 | Bacteria | 10820 |
| 105 | Ga0068854_100039896 | 3300005578 | Bacteria | 3310 |
| 106 | Ga0068854_100068024 | 3300005578 | Bacteria | 2597 |
| 107 | Ga0070702_100011985 | 3300005615 | Bacteria | 4329 |
| 108 | Ga0070702_100039656 | 3300005615 | Bacteria | 2629 |
| 109 | Ga0070702_100045685 | 3300005615 | Bacteria | 2479 |
| 110 | Ga0068859_100000077 | 3300005617 | Bacteria | 91522 |
| 111 | Ga0068859_100004026 | 3300005617 | Bacteria | 14985 |
| 112 | Ga0068859_100005680 | 3300005617 | Bacteria | 12697 |
| 113 | Ga0068859_100042188 | 3300005617 | Bacteria | 4582 |
| 114 | Ga0068866_10000564 | 3300005718 | Bacteria | 16839 |
| 115 | Ga0068866_10008170 | 3300005718 | Bacteria | 4399 |
| 116 | Ga0068866_10017449 | 3300005718 | Bacteria | 3228 |
| 117 | Ga0068866_10060364 | 3300005718 | Bacteria | 1965 |
| 118 | Ga0068861_100001049 | 3300005719 | Bacteria | 16983 |
| 119 | Ga0068861_100001894 | 3300005719 | Bacteria | 13478 |
| 120 | Ga0068861_100310440 | 3300005719 | Bacteria | 1370 |
| 121 | Ga0068851_10057998 | 3300005834 | Bacteria | 1978 |
| 122 | Ga0068863_100103073 | 3300005841 | Bacteria | 2713 |
| 123 | Ga0068863_100382190 | 3300005841 | Bacteria | 1375 |
| 124 | Ga0068858_100005232 | 3300005842 | Bacteria | 12714 |
| 125 | Ga0068858_100010804 | 3300005842 | Bacteria | 8631 |
| 126 | Ga0068858_100014269 | 3300005842 | Bacteria | 7491 |
| 127 | Ga0068858_100014801 | 3300005842 | Bacteria | 7339 |
| 128 | Ga0068858_100019169 | 3300005842 | Bacteria | 6400 |
| 129 | Ga0068860_100000025 | 3300005843 | Bacteria | 271553 |
| 130 | Ga0068860_100001896 | 3300005843 | Bacteria | 22196 |
| 131 | Ga0068860_100005582 | 3300005843 | Bacteria | 12714 |
| 132 | Ga0068860_100064628 | 3300005843 | Bacteria | 3475 |
| 133 | Ga0068860_100094031 | 3300005843 | Bacteria | 2857 |
| 134 | Ga0068860_100277587 | 3300005843 | Bacteria | 1637 |
| 135 | Ga0068860_100316990 | 3300005843 | Bacteria | 1530 |
| 136 | Ga0068862_100003302 | 3300005844 | Bacteria | 13953 |
| 137 | Ga0068862_100004339 | 3300005844 | Bacteria | 12004 |
| 138 | Ga0068862_100144824 | 3300005844 | Bacteria | 2111 |
| 139 | Ga0068862_100198958 | 3300005844 | Bacteria | 1806 |
| 140 | Ga0068862_100541180 | 3300005844 | Bacteria | 1111 |
| 141 | Ga0075365_10002099 | 3300006038 | Bacteria | 9537 |
| 142 | Ga0075365_10002870 | 3300006038 | Bacteria | 8667 |
| 143 | Ga0075365_10013149 | 3300006038 | Bacteria | 4937 |
| 144 | Ga0075365_10058194 | 3300006038 | Bacteria | 2573 |
| 145 | Ga0075365_10074319 | 3300006038 | Bacteria | 2292 |
| 146 | Ga0075365_10084118 | 3300006038 | Bacteria | 2159 |
| 147 | Ga0075368_10059354 | 3300006042 | Bacteria | 1530 |
| 148 | Ga0075363_100000682 | 3300006048 | Bacteria | 11425 |
| 149 | Ga0075363_100001854 | 3300006048 | Bacteria | 8325 |
| 150 | Ga0075364_10004603 | 3300006051 | Bacteria | 7947 |
| 151 | Ga0075364_10007585 | 3300006051 | Bacteria | 6451 |
| 152 | Ga0075364_10024577 | 3300006051 | Bacteria | 3827 |
| 153 | Ga0075364_10036246 | 3300006051 | Bacteria | 3188 |
| 154 | Ga0075364_10119395 | 3300006051 | Bacteria | 1764 |
| 155 | Ga0075364_10119522 | 3300006051 | Bacteria | 1763 |
| 156 | Ga0070715_10000197 | 3300006163 | Bacteria | 14144 |
| 157 | Ga0070715_10001550 | 3300006163 | Bacteria | 6734 |
| 158 | Ga0070715_10007835 | 3300006163 | Bacteria | 3693 |
| 159 | Ga0070716_100006523 | 3300006173 | Bacteria | 5704 |
| 160 | Ga0070716_100008515 | 3300006173 | Bacteria | 5091 |
| 161 | Ga0070716_100013650 | 3300006173 | Bacteria | 4144 |
| 162 | Ga0070716_100089491 | 3300006173 | Bacteria | 1859 |
| 163 | Ga0070712_100001623 | 3300006175 | Bacteria | 13768 |
| 164 | Ga0070712_100013747 | 3300006175 | Bacteria | 5178 |
| 165 | Ga0070712_100047760 | 3300006175 | Bacteria | 2964 |
| 166 | Ga0075362_10059104 | 3300006177 | Bacteria | 1731 |
| 167 | Ga0075367_10021404 | 3300006178 | Bacteria | 3613 |
| 168 | Ga0075367_10024781 | 3300006178 | Bacteria | 3385 |
| 169 | Ga0075369_10000432 | 3300006186 | Bacteria | 12737 |
| 170 | Ga0075369_10003792 | 3300006186 | Bacteria | 5534 |
| 171 | Ga0075369_10015734 | 3300006186 | Bacteria | 3041 |
| 172 | Ga0075369_10019582 | 3300006186 | Bacteria | 2764 |
| 173 | Ga0075369_10035586 | 3300006186 | Bacteria | 2117 |
| 174 | Ga0075369_10037824 | 3300006186 | Bacteria | 2057 |
| 175 | Ga0075369_10050367 | 3300006186 | Bacteria | 1801 |
| 176 | Ga0075366_10167653 | 3300006195 | Bacteria | 1332 |
| 177 | Ga0097621_100010926 | 3300006237 | Bacteria | 6666 |
| 178 | Ga0097621_100029904 | 3300006237 | Bacteria | 4306 |
| 179 | Ga0097621_100127190 | 3300006237 | Bacteria | 2165 |
| 180 | Ga0075370_10007035 | 3300006353 | Bacteria | 5707 |
| 181 | Ga0075370_10090503 | 3300006353 | Bacteria | 1765 |
| 182 | Ga0068871_100023271 | 3300006358 | Bacteria | 4789 |
| 183 | Ga0075428_100005018 | 3300006844 | Bacteria | 14711 |
| 184 | Ga0075430_100119671 | 3300006846 | Bacteria | 2195 |
| 185 | Ga0075431_100023608 | 3300006847 | Bacteria | 6294 |
| 186 | Ga0068865_100008905 | 3300006881 | Bacteria | 6207 |
| 187 | Ga0068865_100023845 | 3300006881 | Bacteria | 4011 |
| 188 | Ga0068865_100066157 | 3300006881 | Bacteria | 2549 |
| 189 | Ga0068865_100145574 | 3300006881 | Bacteria | 1792 |
| 190 | Ga0068865_100310225 | 3300006881 | Bacteria | 1266 |
| 191 | Ga0097620_100000077 | 3300006931 | Bacteria | 91522 |
| 192 | Ga0097620_100004026 | 3300006931 | Bacteria | 14985 |
| 193 | Ga0097620_100005680 | 3300006931 | Bacteria | 12697 |
| 194 | Ga0097620_100042189 | 3300006931 | Bacteria | 4582 |
| 195 | Ga0097620_100116593 | 3300006931 | Bacteria | 2735 |
| 196 | Ga0105245_10004227 | 3300009098 | Bacteria | 12746 |
| 197 | Ga0105245_10005751 | 3300009098 | Bacteria | 10883 |
| 198 | Ga0105245_10038255 | 3300009098 | Bacteria | 4269 |
| 199 | Ga0105247_10000010 | 3300009101 | Bacteria | 302475 |
| 200 | Ga0105247_10002429 | 3300009101 | Bacteria | 12681 |
| 201 | Ga0105247_10003309 | 3300009101 | Bacteria | 10558 |
| 202 | Ga0105247_10139251 | 3300009101 | Bacteria | 1588 |
| 203 | Ga0114129_10022999 | 3300009147 | Bacteria | 8843 |
| 204 | Ga0105243_10000779 | 3300009148 | Bacteria | 30542 |
| 205 | Ga0105243_10003474 | 3300009148 | Bacteria | 12719 |
| 206 | Ga0105243_10256443 | 3300009148 | Bacteria | 1564 |
| 207 | Ga0105241_10171423 | 3300009174 | Bacteria | 1793 |
| 208 | Ga0105242_10000066 | 3300009176 | Bacteria | 73865 |
| 209 | Ga0105242_10003222 | 3300009176 | Bacteria | 12720 |
| 210 | Ga0105242_10035466 | 3300009176 | Bacteria | 4000 |
| 211 | Ga0105248_10000078 | 3300009177 | Bacteria | 111935 |
| 212 | Ga0105248_10063430 | 3300009177 | Bacteria | 4148 |
| 213 | Ga0105248_10179124 | 3300009177 | Bacteria | 2389 |
| 214 | Ga0105248_10387577 | 3300009177 | Bacteria | 1573 |
| 215 | Ga0105237_10002051 | 3300009545 | Bacteria | 25601 |
| 216 | Ga0105237_10059499 | 3300009545 | Bacteria | 3822 |
| 217 | Ga0105238_10111992 | 3300009551 | Bacteria | 2709 |
| 218 | Ga0105249_10004495 | 3300009553 | Bacteria | 12059 |
| 219 | Ga0105249_10004766 | 3300009553 | Bacteria | 11701 |
| 220 | Ga0105249_10071738 | 3300009553 | Bacteria | 3201 |
| 221 | Ga0105249_10079289 | 3300009553 | Bacteria | 3048 |
| 222 | Ga0105249_10290935 | 3300009553 | Bacteria | 1635 |
| 223 | Ga0105239_10003039 | 3300010375 | Bacteria | 20851 |
| 224 | Ga0105239_10007335 | 3300010375 | Bacteria | 12660 |
| 225 | Ga0105239_10015683 | 3300010375 | Bacteria | 8386 |
| 226 | Ga0105246_10347497 | 3300011119 | Bacteria | 1214 |
| 227 | Ga0157373_10100696 | 3300013100 | Bacteria | 2033 |
| 228 | Ga0157371_10074596 | 3300013102 | Bacteria | 2402 |
| 229 | Ga0157369_10065414 | 3300013105 | Bacteria | 3913 |
| 230 | Ga0157374_10004568 | 3300013296 | Bacteria | 11613 |
| 231 | Ga0157374_10048997 | 3300013296 | Bacteria | 3922 |
| 232 | Ga0157378_10002159 | 3300013297 | Bacteria | 17478 |
| 233 | Ga0157378_10006119 | 3300013297 | Bacteria | 10536 |
| 234 | Ga0157378_10042343 | 3300013297 | Bacteria | 4042 |
| 235 | Ga0163162_10005045 | 3300013306 | Bacteria | 12720 |
| 236 | Ga0163162_10008900 | 3300013306 | Bacteria | 9764 |
| 237 | Ga0163162_10014890 | 3300013306 | Bacteria | 7594 |
| 238 | Ga0163162_10081460 | 3300013306 | Bacteria | 3307 |
| 239 | Ga0163162_10487077 | 3300013306 | Bacteria | 1364 |
| 240 | Ga0157372_10006232 | 3300013307 | Bacteria | 12680 |
| 241 | Ga0157375_10000268 | 3300013308 | Bacteria | 47381 |
| 242 | Ga0157375_10035308 | 3300013308 | Bacteria | 4771 |
| 243 | Ga0157375_10184167 | 3300013308 | Bacteria | 2241 |
| 244 | Ga0163163_10247774 | 3300014325 | Bacteria | 1832 |
| 245 | Ga0157380_10000036 | 3300014326 | Bacteria | 81892 |
| 246 | Ga0157380_10002701 | 3300014326 | Bacteria | 12032 |
| 247 | Ga0157380_10309548 | 3300014326 | Bacteria | 1459 |
| 248 | Ga0157377_10031203 | 3300014745 | Bacteria | 2894 |
| 249 | Ga0157379_10001562 | 3300014968 | Bacteria | 18866 |
| 250 | Ga0157379_10294840 | 3300014968 | Bacteria | 1477 |
| 251 | Ga0157376_10041038 | 3300014969 | Bacteria | 3786 |
| 252 | Ga0157376_10065953 | 3300014969 | Bacteria | 3059 |
| 253 | Ga0163161_10002645 | 3300017792 | Bacteria | 12723 |
| 254 | Ga0163161_10009914 | 3300017792 | Bacteria | 6598 |
| 255 | Ga0163161_10081226 | 3300017792 | Bacteria | 2387 |
| 256 | Ga0213876_10083340 | 3300021384 | Bacteria | 1691 |
| 257 | Ga0209673_1033192 | 3300025273 | Bacteria | 1578 |
| 258 | Ga0209051_1001387 | 3300025303 | Bacteria | 20871 |
| 259 | Ga0209051_1005756 | 3300025303 | Bacteria | 7150 |
| 260 | Ga0209051_1007639 | 3300025303 | Bacteria | 5880 |
| 261 | Ga0209051_1015869 | 3300025303 | Bacteria | 3447 |
| 262 | Ga0207653_10015342 | 3300025885 | Bacteria | 2404 |
| 263 | Ga0207692_10014881 | 3300025898 | Bacteria | 3410 |
| 264 | Ga0207692_10016015 | 3300025898 | Bacteria | 3310 |
| 265 | Ga0207692_10020015 | 3300025898 | Bacteria | 3036 |
| 266 | Ga0207692_10043306 | 3300025898 | Bacteria | 2239 |
| 267 | Ga0207642_10003363 | 3300025899 | Bacteria | 5040 |
| 268 | Ga0207642_10004003 | 3300025899 | Bacteria | 4706 |
| 269 | Ga0207642_10005782 | 3300025899 | Bacteria | 4065 |
| 270 | Ga0207642_10018491 | 3300025899 | Bacteria | 2676 |
| 271 | Ga0207642_10026627 | 3300025899 | Bacteria | 2356 |
| 272 | Ga0207642_10138945 | 3300025899 | Bacteria | 1278 |
| 273 | Ga0207710_10000028 | 3300025900 | Bacteria | 304525 |
| 274 | Ga0207710_10001082 | 3300025900 | Bacteria | 14018 |
| 275 | Ga0207710_10001277 | 3300025900 | Bacteria | 12708 |
| 276 | Ga0207688_10001014 | 3300025901 | Bacteria | 14331 |
| 277 | Ga0207688_10001235 | 3300025901 | Bacteria | 13248 |
| 278 | Ga0207688_10003983 | 3300025901 | Bacteria | 8049 |
| 279 | Ga0207688_10007147 | 3300025901 | Bacteria | 6072 |
| 280 | Ga0207647_10062841 | 3300025904 | Bacteria | 2261 |
| 281 | Ga0207685_10002868 | 3300025905 | Bacteria | 4062 |
| 282 | Ga0207685_10027666 | 3300025905 | Bacteria | 1987 |
| 283 | Ga0207685_10031040 | 3300025905 | Bacteria | 1909 |
| 284 | Ga0207699_10015436 | 3300025906 | Bacteria | 3967 |
| 285 | Ga0207699_10131111 | 3300025906 | Bacteria | 1635 |
| 286 | Ga0207645_10005002 | 3300025907 | Bacteria | 9711 |
| 287 | Ga0207645_10009109 | 3300025907 | Bacteria | 6885 |
| 288 | Ga0207643_10166322 | 3300025908 | Bacteria | 1329 |
| 289 | Ga0207654_10102439 | 3300025911 | Bacteria | 1766 |
| 290 | Ga0207707_10090440 | 3300025912 | Bacteria | 2675 |
| 291 | Ga0207695_10260924 | 3300025913 | Bacteria | 1630 |
| 292 | Ga0207671_10004398 | 3300025914 | Bacteria | 13507 |
| 293 | Ga0207693_10000224 | 3300025915 | Bacteria | 51559 |
| 294 | Ga0207693_10003919 | 3300025915 | Bacteria | 12672 |
| 295 | Ga0207693_10007684 | 3300025915 | Bacteria | 8853 |
| 296 | Ga0207693_10008115 | 3300025915 | Bacteria | 8609 |
| 297 | Ga0207693_10010959 | 3300025915 | Bacteria | 7346 |
| 298 | Ga0207693_10110336 | 3300025915 | Bacteria | 2157 |
| 299 | Ga0207663_10007980 | 3300025916 | Bacteria | 5521 |
| 300 | Ga0207663_10030182 | 3300025916 | Bacteria | 3194 |
| 301 | Ga0207663_10059942 | 3300025916 | Bacteria | 2410 |
| 302 | Ga0207663_10265891 | 3300025916 | Bacteria | 1268 |
| 303 | Ga0207660_10097492 | 3300025917 | Bacteria | 2191 |
| 304 | Ga0207662_10053195 | 3300025918 | Bacteria | 2411 |
| 305 | Ga0207662_10100205 | 3300025918 | Bacteria | 1794 |
| 306 | Ga0207657_10017934 | 3300025919 | Bacteria | 6773 |
| 307 | Ga0207657_10018386 | 3300025919 | Bacteria | 6673 |
| 308 | Ga0207681_10014692 | 3300025923 | Bacteria | 4874 |
| 309 | Ga0207681_10018021 | 3300025923 | Bacteria | 4442 |
| 310 | Ga0207659_10196607 | 3300025926 | Unclassified | 1608 |
| 311 | Ga0207659_10360117 | 3300025926 | Bacteria | 1209 |
| 312 | Ga0207687_10000594 | 3300025927 | Bacteria | 24499 |
| 313 | Ga0207687_10004640 | 3300025927 | Bacteria | 9143 |
| 314 | Ga0207687_10008487 | 3300025927 | Bacteria | 6716 |
| 315 | Ga0207664_10085978 | 3300025929 | Bacteria | 2568 |
| 316 | Ga0207644_10050528 | 3300025931 | Unclassified | 2981 |
| 317 | Ga0207644_10255527 | 3300025931 | Bacteria | 1399 |
| 318 | Ga0207690_10040310 | 3300025932 | Bacteria | 3052 |
| 319 | Ga0207706_10000288 | 3300025933 | Bacteria | 54869 |
| 320 | Ga0207706_10017373 | 3300025933 | Bacteria | 6480 |
| 321 | Ga0207706_10020804 | 3300025933 | Bacteria | 5893 |
| 322 | Ga0207706_10101089 | 3300025933 | Bacteria | 2536 |
| 323 | Ga0207686_10003068 | 3300025934 | Bacteria | 8987 |
| 324 | Ga0207686_10003183 | 3300025934 | Bacteria | 8831 |
| 325 | Ga0207686_10008741 | 3300025934 | Bacteria | 5470 |
| 326 | Ga0207686_10071015 | 3300025934 | Bacteria | 2239 |
| 327 | Ga0207686_10102079 | 3300025934 | Bacteria | 1917 |
| 328 | Ga0207709_10001097 | 3300025935 | Bacteria | 19856 |
| 329 | Ga0207709_10018729 | 3300025935 | Bacteria | 3882 |
| 330 | Ga0207709_10072913 | 3300025935 | Bacteria | 2186 |
| 331 | Ga0207670_10133717 | 3300025936 | Bacteria | 1821 |
| 332 | Ga0207670_10148498 | 3300025936 | Bacteria | 1736 |
| 333 | Ga0207669_10000196 | 3300025937 | Bacteria | 27615 |
| 334 | Ga0207669_10000449 | 3300025937 | Bacteria | 17919 |
| 335 | Ga0207669_10010158 | 3300025937 | Bacteria | 4520 |
| 336 | Ga0207669_10107688 | 3300025937 | Bacteria | 1859 |
| 337 | Ga0207704_10000682 | 3300025938 | Bacteria | 15052 |
| 338 | Ga0207704_10001017 | 3300025938 | Bacteria | 12443 |
| 339 | Ga0207704_10166759 | 3300025938 | Bacteria | 1574 |
| 340 | Ga0207704_10182330 | 3300025938 | Bacteria | 1518 |
| 341 | Ga0207665_10008988 | 3300025939 | Bacteria | 6557 |
| 342 | Ga0207665_10010565 | 3300025939 | Bacteria | 6064 |
| 343 | Ga0207665_10011685 | 3300025939 | Bacteria | 5770 |
| 344 | Ga0207665_10021889 | 3300025939 | Bacteria | 4204 |
| 345 | Ga0207665_10115987 | 3300025939 | Bacteria | 1887 |
| 346 | Ga0207691_10054663 | 3300025940 | Bacteria | 3642 |
| 347 | Ga0207691_10126096 | 3300025940 | Bacteria | 2265 |
| 348 | Ga0207711_10000069 | 3300025941 | Bacteria | 115038 |
| 349 | Ga0207711_10116782 | 3300025941 | Bacteria | 2379 |
| 350 | Ga0207711_10133170 | 3300025941 | Bacteria | 2230 |
| 351 | Ga0207689_10009333 | 3300025942 | Bacteria | 8477 |
| 352 | Ga0207689_10053029 | 3300025942 | Bacteria | 3341 |
| 353 | Ga0207689_10145791 | 3300025942 | Bacteria | 1950 |
| 354 | Ga0207667_10238478 | 3300025949 | Bacteria | 1861 |
| 355 | Ga0207712_10026058 | 3300025961 | Bacteria | 3892 |
| 356 | Ga0207712_10122198 | 3300025961 | Bacteria | 1972 |
| 357 | Ga0207668_10000708 | 3300025972 | Bacteria | 20382 |
| 358 | Ga0207668_10001896 | 3300025972 | Bacteria | 12250 |
| 359 | Ga0207668_10006210 | 3300025972 | Bacteria | 7054 |
| 360 | Ga0207668_10104147 | 3300025972 | Bacteria | 2114 |
| 361 | Ga0207668_10147467 | 3300025972 | Bacteria | 1817 |
| 362 | Ga0207640_10033664 | 3300025981 | Bacteria | 3191 |
| 363 | Ga0207640_10371038 | 3300025981 | Bacteria | 1156 |
| 364 | Ga0207658_10002764 | 3300025986 | Bacteria | 12638 |
| 365 | Ga0207658_10040590 | 3300025986 | Bacteria | 3365 |
| 366 | Ga0207658_10072092 | 3300025986 | Bacteria | 2617 |
| 367 | Ga0207658_10096480 | 3300025986 | Bacteria | 2306 |
| 368 | Ga0207658_10186301 | 3300025986 | Bacteria | 1722 |
| 369 | Ga0207658_10200802 | 3300025986 | Bacteria | 1664 |
| 370 | Ga0207677_10023893 | 3300026023 | Bacteria | 3785 |
| 371 | Ga0207677_10033108 | 3300026023 | Bacteria | 3330 |
| 372 | Ga0207677_10044193 | 3300026023 | Bacteria | 2966 |
| 373 | Ga0207677_10058521 | 3300026023 | Bacteria | 2654 |
| 374 | Ga0207677_10125461 | 3300026023 | Bacteria | 1939 |
| 375 | Ga0207703_10002614 | 3300026035 | Bacteria | 15533 |
| 376 | Ga0207703_10007155 | 3300026035 | Bacteria | 8876 |
| 377 | Ga0207703_10043847 | 3300026035 | Bacteria | 3592 |
| 378 | Ga0207639_10001979 | 3300026041 | Bacteria | 13781 |
| 379 | Ga0207639_10049175 | 3300026041 | Bacteria | 3196 |
| 380 | Ga0207639_10185604 | 3300026041 | Bacteria | 1773 |
| 381 | Ga0207678_10016962 | 3300026067 | Bacteria | 6395 |
| 382 | Ga0207678_10018104 | 3300026067 | Bacteria | 6187 |
| 383 | Ga0207678_10026917 | 3300026067 | Bacteria | 5016 |
| 384 | Ga0207678_10107147 | 3300026067 | Bacteria | 2384 |
| 385 | Ga0207678_10114233 | 3300026067 | Bacteria | 2304 |
| 386 | Ga0207678_10220010 | 3300026067 | Bacteria | 1625 |
| 387 | Ga0207708_10000667 | 3300026075 | Bacteria | 26347 |
| 388 | Ga0207708_10003048 | 3300026075 | Bacteria | 12338 |
| 389 | Ga0207708_10006709 | 3300026075 | Bacteria | 8514 |
| 390 | Ga0207708_10014636 | 3300026075 | Bacteria | 5871 |
| 391 | Ga0207708_10125334 | 3300026075 | Bacteria | 2004 |
| 392 | Ga0207702_10373177 | 3300026078 | Bacteria | 1370 |
| 393 | Ga0207641_10125919 | 3300026088 | Bacteria | 2294 |
| 394 | Ga0207641_10160588 | 3300026088 | Bacteria | 2043 |
| 395 | Ga0207648_10001622 | 3300026089 | Bacteria | 24662 |
| 396 | Ga0207648_10005568 | 3300026089 | Bacteria | 12672 |
| 397 | Ga0207648_10097826 | 3300026089 | Bacteria | 2569 |
| 398 | Ga0207676_10055890 | 3300026095 | Bacteria | 3101 |
| 399 | Ga0207675_100000324 | 3300026118 | Bacteria | 45435 |
| 400 | Ga0207675_100001148 | 3300026118 | Bacteria | 26257 |
| 401 | Ga0207675_100005071 | 3300026118 | Bacteria | 12672 |
| 402 | Ga0207675_100033465 | 3300026118 | Bacteria | 4788 |
| 403 | Ga0207675_100106243 | 3300026118 | Bacteria | 2647 |
| 404 | Ga0207675_100115440 | 3300026118 | Bacteria | 2537 |
| 405 | Ga0207683_10000077 | 3300026121 | Bacteria | 77710 |
| 406 | Ga0207683_10002279 | 3300026121 | Bacteria | 16818 |
| 407 | Ga0207683_10022293 | 3300026121 | Bacteria | 5434 |
| 408 | Ga0207683_10037711 | 3300026121 | Bacteria | 4210 |
| 409 | Ga0207683_10066532 | 3300026121 | Bacteria | 3178 |
| 410 | Ga0207683_10188693 | 3300026121 | Bacteria | 1871 |
| 411 | Ga0207683_10229171 | 3300026121 | Bacteria | 1694 |
| 412 | Ga0209813_10058967 | 3300027866 | Bacteria | 1221 |
| 413 | Ga0268266_10011847 | 3300028379 | Bacteria | 7556 |
| 414 | Ga0268266_10042481 | 3300028379 | Bacteria | 3883 |
| 415 | Ga0268266_10070058 | 3300028379 | Bacteria | 3039 |
| 416 | Ga0268266_10168142 | 3300028379 | Bacteria | 1988 |
| 417 | Ga0268266_10326929 | 3300028379 | Bacteria | 1436 |
| 418 | Ga0268265_10007934 | 3300028380 | Bacteria | 7165 |
| 419 | Ga0268265_10008953 | 3300028380 | Bacteria | 6769 |
| 420 | Ga0268265_10036678 | 3300028380 | Bacteria | 3592 |
| 421 | Ga0268265_10278662 | 3300028380 | Bacteria | 1495 |
| 422 | Ga0268264_10000053 | 3300028381 | Bacteria | 320368 |
| 423 | Ga0268264_10001281 | 3300028381 | Bacteria | 23793 |
| 424 | Ga0268264_10003529 | 3300028381 | Bacteria | 13472 |
| 425 | Ga0268264_10088693 | 3300028381 | Bacteria | 2662 |
| 426 | Ga0268264_10135316 | 3300028381 | Bacteria | 2190 |
| 427 | Ga0268264_10162542 | 3300028381 | Bacteria | 2013 |
| 428 | Ga0307413_10017608 | 3300031824 | Bacteria | 3726 |
| 429 | Ga0307406_10190871 | 3300031901 | Unclassified | 1500 |
| 430 | Ga0307409_100035556 | 3300031995 | Bacteria | 3652 |
| 431 | Ga0307415_100339902 | 3300032126 | Unclassified | 1259 |
| 432 | Ga0373958_0032216 | 3300034819 | Bacteria | 1035 |
| 433 | Ga0373928_0010922 | 3300035084 | Bacteria | 1790 |
| 434 | Ga0373940_0037173 | 3300035088 | Bacteria | 1325 |
| 435 | Ga0373939_0033116 | 3300035114 | Bacteria | 1507 |
| 436 | Ga0373939_0057979 | 3300035114 | Bacteria | 1223 |
| 437 | Ga0373962_0058624 | 3300035242 | Bacteria | 1126 |
| 438 | Ga0373931_0014257 | 3300035691 | Bacteria | 3882 |
| 439 | Ga0373931_0047926 | 3300035691 | Bacteria | 2263 |
| 440 | Ga0373947_0182509 | 3300035725 | Bacteria | 1367 |
| 441 | Ga0436365_0307188 | 3300039437 | Bacteria | 1775 |
| 442 | Ga0436361_0276372 | 3300039447 | Bacteria | 2678 |
| 443 | Ga0439461_0001671 | 3300041410 | Bacteria | 3455 |
| 444 | Ga0439466_0002159 | 3300041411 | Bacteria | 7706 |
| 445 | Ga0451793_0781259 | 3300041452 | Bacteria | 3261 |
| 446 | Ga0439431_0000447 | 3300041997 | Bacteria | 8689 |
| 447 | Ga0439442_011141 | 3300042002 | Bacteria | 1828 |
| 448 | Ga0439434_0012896 | 3300042435 | Bacteria | 2477 |
| 449 | Ga0466969_0019268 | 3300044656 | Bacteria | 3550 |
| 450 | Ga0466972_0026587 | 3300044658 | Bacteria | 2868 |
| 451 | Ga0466972_0033222 | 3300044658 | Bacteria | 2531 |
| 452 | Ga0466972_0078209 | 3300044658 | Bacteria | 1575 |
| 453 | Ga0466965_0006756 | 3300044683 | Bacteria | 5234 |
| 454 | Ga0466965_0181528 | 3300044683 | Bacteria | 1110 |
| 455 | Ga0466961_0018216 | 3300044693 | Bacteria | 4515 |
| 456 | Ga0466963_0040258 | 3300044694 | Bacteria | 3063 |
| 457 | Ga0466964_0035409 | 3300044706 | Bacteria | 1996 |
| 458 | Ga0466968_0007037 | 3300044735 | Bacteria | 4263 |
| 459 | Ga0466970_0189860 | 3300044765 | Bacteria | 1141 |
| 460 | Ga0466957_0011701 | 3300044842 | Bacteria | 5071 |
| 461 | Ga0466957_0013117 | 3300044842 | Bacteria | 4803 |
| 462 | Ga0466960_0000043 | 3300044901 | Bacteria | 40805 |
| 463 | Ga0466960_0009641 | 3300044901 | Bacteria | 3987 |
| 464 | Ga0466959_0032140 | 3300045049 | Bacteria | 3884 |
| 465 | Ga0466959_0041991 | 3300045049 | Bacteria | 3374 |
| 466 | Ga0466967_0044525 | 3300045976 | Bacteria | 3850 |
| 467 | Ga0466967_0051054 | 3300045976 | Bacteria | 3623 |
| 468 | Ga0466967_0078503 | 3300045976 | Bacteria | 2974 |
| 469 | Ga0495592_0162033 | 3300046454 | Bacteria | 1538 |
| 470 | Ga0495603_0052727 | 3300046455 | Bacteria | 2414 |
| 471 | Ga0495603_0067823 | 3300046455 | Bacteria | 2099 |
| 472 | Ga0495629_0000546 | 3300046459 | Bacteria | 31018 |
| 473 | Ga0495629_0013452 | 3300046459 | Bacteria | 5902 |
| 474 | Ga0495629_0022019 | 3300046459 | Bacteria | 4545 |
| 475 | Ga0495629_0186995 | 3300046459 | Bacteria | 1434 |
| 476 | Ga0495638_0000745 | 3300046460 | Bacteria | 34919 |
| 477 | Ga0495638_0007521 | 3300046460 | Bacteria | 7798 |
| 478 | Ga0495638_0096995 | 3300046460 | Bacteria | 1768 |
| 479 | Ga0495641_0017883 | 3300046461 | Bacteria | 3675 |
| 480 | Ga0495651_0007772 | 3300046462 | Bacteria | 8205 |
| 481 | Ga0495651_0038321 | 3300046462 | Bacteria | 3733 |
| 482 | Ga0495653_0015204 | 3300046463 | Bacteria | 6273 |
| 483 | Ga0495639_0031046 | 3300046475 | Bacteria | 2377 |
| 484 | Ga0495594_0000907 | 3300046499 | Bacteria | 15360 |
| 485 | Ga0495608_0021528 | 3300046511 | Bacteria | 4425 |
| 486 | Ga0495608_0096391 | 3300046511 | Bacteria | 1911 |
| 487 | Ga0495628_0013118 | 3300046516 | Bacteria | 6977 |
| 488 | Ga0495628_0434990 | 3300046516 | Bacteria | 954 |
| 489 | Ga0495630_0020357 | 3300046517 | Bacteria | 4891 |
| 490 | Ga0495630_0064839 | 3300046517 | Bacteria | 2745 |
| 491 | Ga0495648_0001220 | 3300046524 | Bacteria | 25766 |
| 492 | Ga0495652_0012110 | 3300046529 | Bacteria | 7792 |
| 493 | Ga0495652_0066076 | 3300046529 | Bacteria | 3037 |
| 494 | Ga0495665_0027228 | 3300046531 | Bacteria | 3069 |
| 495 | Ga0495640_0001256 | 3300046533 | Bacteria | 19903 |
| 496 | Ga0495640_0004019 | 3300046533 | Bacteria | 11767 |
| 497 | Ga0495640_0171835 | 3300046533 | Bacteria | 1384 |
| 498 | Ga0495587_0006340 | 3300046536 | Bacteria | 7713 |
| 499 | Ga0495645_0010749 | 3300046543 | Bacteria | 6432 |
| 500 | Ga0495667_0016349 | 3300046559 | Bacteria | 5014 |
| 501 | Ga0495668_0056732 | 3300046616 | Bacteria | 2161 |
| 502 | Ga0495634_0035550 | 3300046642 | Bacteria | 3410 |
| 503 | Ga0495611_0078433 | 3300046648 | Bacteria | 1516 |
| 504 | Ga0495635_0007371 | 3300046663 | Bacteria | 7675 |
| 505 | Ga0495588_0023666 | 3300046674 | Bacteria | 3043 |
| 506 | Ga0495657_0011542 | 3300046675 | Bacteria | 6602 |
| 507 | Ga0495599_0005251 | 3300046678 | Bacteria | 7728 |
| 508 | Ga0495623_0005019 | 3300046679 | Bacteria | 8678 |
| 509 | Ga0495658_0011413 | 3300046683 | Bacteria | 4468 |
| 510 | Ga0495613_0003801 | 3300046689 | Bacteria | 11318 |
| 511 | Ga0495613_0004495 | 3300046689 | Bacteria | 10453 |
| 512 | Ga0495624_0070933 | 3300046690 | Bacteria | 2168 |
| 513 | Ga0495600_0004749 | 3300046809 | Bacteria | 8152 |
| 514 | Ga0495604_0023894 | 3300047317 | Bacteria | 4878 |
| 515 | Ga0495674_0021560 | 3300047319 | Bacteria | 5957 |
| 516 | Ga0495674_0047098 | 3300047319 | Bacteria | 3825 |
| 517 | Ga0495674_0164092 | 3300047319 | Bacteria | 1857 |
| 518 | Ga0495672_0018774 | 3300047320 | Bacteria | 4579 |
| 519 | Ga0495672_0038799 | 3300047320 | Bacteria | 2902 |
| 520 | Ga0495676_0022256 | 3300047321 | Bacteria | 5518 |
| 521 | Ga0495676_0026456 | 3300047321 | Bacteria | 4993 |
| 522 | Ga0495676_0040198 | 3300047321 | Bacteria | 3863 |
| 523 | Ga0495675_0003362 | 3300047444 | Bacteria | 9635 |
| 524 | Ga0495675_0043633 | 3300047444 | Bacteria | 2857 |
| 525 | Ga0495684_0005393 | 3300047471 | Bacteria | 9956 |
| 526 | Ga0495686_0025392 | 3300047472 | Bacteria | 3884 |
| 527 | Ga0495593_0013924 | 3300047673 | Bacteria | 4582 |
| 528 | Ga0495593_0014462 | 3300047673 | Bacteria | 4486 |
| 529 | Ga0495593_0045883 | 3300047673 | Bacteria | 2330 |
| 530 | Ga0495602_0010713 | 3300048088 | Bacteria | 9507 |
| 531 | Ga0496100_0000142 | 3300048903 | Bacteria | 39816 |
| 532 | Ga0496100_0016873 | 3300048903 | Bacteria | 4296 |
| 533 | Ga0496100_0054467 | 3300048903 | Bacteria | 2609 |
| 534 | Ga0496101_0000011 | 3300048904 | Bacteria | 272153 |
| 535 | Ga0496101_0002609 | 3300048904 | Bacteria | 11072 |
| 536 | Ga0496101_0008063 | 3300048904 | Bacteria | 6867 |
| 537 | Ga0496101_0015182 | 3300048904 | Bacteria | 5185 |
| 538 | Ga0496101_0039249 | 3300048904 | Bacteria | 3366 |
| 539 | Ga0496101_0080061 | 3300048904 | Bacteria | 2413 |
| 540 | Ga0496102_0000012 | 3300048905 | Bacteria | 315470 |
| 541 | Ga0496102_0000070 | 3300048905 | Bacteria | 155087 |
| 542 | Ga0496102_0000915 | 3300048905 | Bacteria | 27833 |
| 543 | Ga0496102_0001632 | 3300048905 | Bacteria | 19764 |
| 544 | Ga0496102_0014909 | 3300048905 | Bacteria | 6762 |
| 545 | Ga0496102_0053984 | 3300048905 | Bacteria | 3663 |
| 546 | Ga0496102_0329400 | 3300048905 | Bacteria | 1438 |
| 547 | Ga0496102_0357196 | 3300048905 | Bacteria | 1375 |
| 548 | Ga0496103_0000005 | 3300048906 | Bacteria | 505416 |
| 549 | Ga0496103_0000342 | 3300048906 | Bacteria | 42444 |
| 550 | Ga0496103_0006721 | 3300048906 | Bacteria | 6862 |
| 551 | Ga0496103_0014620 | 3300048906 | Bacteria | 4664 |
| 552 | Ga0496103_0024888 | 3300048906 | Bacteria | 3613 |
| 553 | Ga0496103_0122412 | 3300048906 | Bacteria | 1658 |
| 554 | Ga0496104_0250402 | 3300048907 | Bacteria | 1684 |
| 555 | Ga0496105_0066575 | 3300048908 | Bacteria | 2974 |
| 556 | Ga0496106_0001251 | 3300048909 | Bacteria | 19027 |
| 557 | Ga0496106_0005715 | 3300048909 | Bacteria | 9200 |
| 558 | Ga0496106_0010211 | 3300048909 | Bacteria | 6938 |
| 559 | Ga0496106_0015675 | 3300048909 | Bacteria | 5606 |
| 560 | Ga0496107_0001038 | 3300048910 | Bacteria | 16617 |
| 561 | Ga0496107_0008820 | 3300048910 | Bacteria | 6987 |
| 562 | Ga0496107_0009361 | 3300048910 | Bacteria | 6790 |
| 563 | Ga0496107_0082594 | 3300048910 | Bacteria | 2343 |
| 564 | Ga0496107_0094223 | 3300048910 | Bacteria | 2191 |
| 565 | Ga0496108_0006199 | 3300048911 | Bacteria | 9683 |
| 566 | Ga0496108_0557954 | 3300048911 | Bacteria | 999 |
| 567 | Ga0496109_0031454 | 3300048912 | Bacteria | 4762 |
| 568 | Ga0496109_0164439 | 3300048912 | Bacteria | 2080 |
| 569 | Ga0496110_0033275 | 3300048913 | Bacteria | 4458 |
| 570 | Ga0496112_0021144 | 3300048915 | Bacteria | 6183 |
| 571 | Ga0496112_0031776 | 3300048915 | Bacteria | 5122 |
| 572 | Ga0496112_0077455 | 3300048915 | Bacteria | 3288 |
| 573 | Ga0496113_0143394 | 3300048916 | Bacteria | 1880 |
| 574 | Ga0496114_0000766 | 3300048917 | Bacteria | 24011 |
| 575 | Ga0496114_0009779 | 3300048917 | Bacteria | 7618 |
| 576 | Ga0496114_0035403 | 3300048917 | Bacteria | 4122 |
| 577 | Ga0496114_0218007 | 3300048917 | Bacteria | 1675 |
| 578 | Ga0496114_0250321 | 3300048917 | Bacteria | 1559 |
| 579 | Ga0496115_0001326 | 3300048918 | Bacteria | 17649 |
| 580 | Ga0496115_0002565 | 3300048918 | Bacteria | 13048 |
| 581 | Ga0496115_0005192 | 3300048918 | Bacteria | 9467 |
| 582 | Ga0496115_0113667 | 3300048918 | Bacteria | 2225 |
| 583 | Ga0496116_0000050 | 3300048919 | Bacteria | 311670 |
| 584 | Ga0496117_0000042 | 3300048920 | Bacteria | 315470 |
| 585 | Ga0496117_0000233 | 3300048920 | Bacteria | 105282 |
| 586 | Ga0496118_0000037 | 3300048921 | Bacteria | 315470 |
| 587 | Ga0496118_0001816 | 3300048921 | Bacteria | 30722 |
| 588 | Ga0496119_0000486 | 3300048922 | Bacteria | 54401 |
| 589 | Ga0496119_0004931 | 3300048922 | Bacteria | 13047 |
| 590 | Ga0496119_0122295 | 3300048922 | Bacteria | 1429 |
| 591 | Ga0496120_0000121 | 3300048923 | Bacteria | 131612 |
| 592 | Ga0496120_0006473 | 3300048923 | Bacteria | 8984 |
| 593 | Ga0496121_0001091 | 3300048924 | Bacteria | 47947 |
| 594 | Ga0496122_0027610 | 3300048925 | Bacteria | 4845 |
| 595 | Ga0496125_0042820 | 3300048928 | Bacteria | 3850 |
| 596 | Ga0496126_0000236 | 3300048929 | Bacteria | 119350 |
| 597 | Ga0496126_0029046 | 3300048929 | Bacteria | 5257 |
| 598 | Ga0496126_0073036 | 3300048929 | Bacteria | 3050 |
| 599 | Ga0501031_0003559 | 3300049568 | Bacteria | 10007 |
| 600 | Ga0501031_0039482 | 3300049568 | Bacteria | 3080 |
| 601 | Ga0501032_0004950 | 3300049569 | Bacteria | 9963 |
| 602 | Ga0501032_0031377 | 3300049569 | Bacteria | 3643 |
| 603 | Ga0501032_0031446 | 3300049569 | Bacteria | 3639 |
| 604 | Ga0501034_0009889 | 3300049571 | Bacteria | 9969 |
| 605 | Ga0501034_0178912 | 3300049571 | Bacteria | 2086 |
| 606 | Ga0501037_0013608 | 3300049573 | Bacteria | 5993 |
| 607 | Ga0501037_0040445 | 3300049573 | Bacteria | 3431 |
| 608 | Ga0501039_0000835 | 3300049575 | Bacteria | 22275 |
| 609 | Ga0501039_0020591 | 3300049575 | Bacteria | 5054 |
| 610 | Ga0501040_0139122 | 3300049576 | Bacteria | 1709 |
| 611 | Ga0501043_0016855 | 3300049579 | Bacteria | 5726 |
| 612 | Ga0501043_0042133 | 3300049579 | Bacteria | 3586 |
| 613 | Ga0501046_0024825 | 3300049580 | Bacteria | 4911 |
| 614 | Ga0501047_0021818 | 3300049581 | Bacteria | 6148 |
| 615 | Ga0501047_0031179 | 3300049581 | Bacteria | 5142 |
| 616 | Ga0501067_0015476 | 3300049583 | Bacteria | 4222 |
| 617 | Ga0501069_0004427 | 3300049585 | Bacteria | 7255 |
| 618 | Ga0501070_0008673 | 3300049586 | Bacteria | 8595 |
| 619 | Ga0501071_0010148 | 3300049587 | Bacteria | 6301 |
| 620 | Ga0501072_0004542 | 3300049588 | Bacteria | 10550 |
| 621 | Ga0501073_0018809 | 3300049589 | Bacteria | 4992 |
| 622 | Ga0501074_0135914 | 3300049590 | Bacteria | 1758 |
| 623 | Ga0501076_0201494 | 3300049592 | Bacteria | 1625 |
| 624 | Ga0501077_0026031 | 3300049593 | Bacteria | 3712 |
| 625 | Ga0501079_0190485 | 3300049741 | Bacteria | 1600 |
| 626 | Ga0501080_0131573 | 3300049742 | Bacteria | 2316 |
| 627 | Ga0501083_0008871 | 3300049744 | Bacteria | 7100 |
| 628 | Ga0501035_0001861 | 3300049822 | Bacteria | 21258 |
| 629 | Ga0501035_0176509 | 3300049822 | Bacteria | 1842 |
| 630 | Ga0501035_0198366 | 3300049822 | Bacteria | 1722 |
| 631 | Ga0501044_0000150 | 3300049823 | Bacteria | 85886 |
| 632 | Ga0501044_0005313 | 3300049823 | Bacteria | 14326 |
| 633 | Ga0501044_0012714 | 3300049823 | Bacteria | 9117 |
| 634 | Ga0501044_0225994 | 3300049823 | Bacteria | 1821 |
| 635 | nmdc:mga03683_72169_c1 | 3300050489 | Bacteria | 1478 |
| 636 | nmdc:mga03n38_1769_c1 | 3300050490 | Bacteria | 6039 |
| 637 | nmdc:mga03n38_84891_c1 | 3300050490 | Bacteria | 1496 |
| 638 | nmdc:mga00v17_24553_c1 | 3300050491 | Bacteria | 3498 |
| 639 | nmdc:mga00v17_44291_c1 | 3300050491 | Bacteria | 2683 |
| 640 | nmdc:mga00v17_9564_c1 | 3300050491 | Bacteria | 5252 |
| 641 | nmdc:mga0yw44_14128_c2 | 3300050492 | Bacteria | 3658 |
| 642 | nmdc:mga0yw44_180369_c1 | 3300050492 | Bacteria | 1390 |
| 643 | nmdc:mga0yw44_3548_c1 | 3300050492 | Bacteria | 6952 |
| 644 | nmdc:mga0k408_103548_c2 | 3300050493 | Bacteria | 1225 |
| 645 | nmdc:mga06z11_115445_c1 | 3300050494 | Bacteria | 1492 |
| 646 | nmdc:mga06z11_155511_c1 | 3300050494 | Bacteria | 1303 |
| 647 | nmdc:mga04h51_59170_c1 | 3300050495 | Bacteria | 1308 |
| 648 | nmdc:mga04h51_66581_c1 | 3300050495 | Bacteria | 1248 |
| 649 | nmdc:mga07m45_23217_c1 | 3300050496 | Bacteria | 3389 |
| 650 | nmdc:mga07m45_89246_c1 | 3300050496 | Bacteria | 1765 |
| 651 | nmdc:mga05p37_22120_c2 | 3300050507 | Bacteria | 7163 |
| 652 | nmdc:mga0qj67_6776_c1 | 3300050509 | Bacteria | 8421 |
| 653 | nmdc:mga06r32_9568_c1 | 3300050510 | Bacteria | 8753 |
| 654 | nmdc:mga0sz30_1591_c2 | 3300050516 | Bacteria | 6325 |
| 655 | nmdc:mga0sz30_29044_c1 | 3300050516 | Bacteria | 2277 |
| 656 | nmdc:mga0sz30_37734_c1 | 3300050516 | Bacteria | 2023 |
| 657 | nmdc:mga0sz30_48225_c1 | 3300050516 | Bacteria | 1801 |
| 658 | nmdc:mga0sz30_52691_c1 | 3300050516 | Bacteria | 1728 |
| 659 | Ga0500635_0020872 | 3300053080 | Bacteria | 2012 |
| 660 | Ga0495619_0023894 | 3300053085 | Bacteria | 3919 |
| 661 | Ga0500578_0192137 | 3300053086 | Bacteria | 1253 |
| 662 | Ga0500643_000213 | 3300053087 | Bacteria | 54707 |
| 663 | Ga0500643_002806 | 3300053087 | Bacteria | 8707 |
| 664 | Ga0500643_008952 | 3300053087 | Bacteria | 3874 |
| 665 | Ga0500556_0006057 | 3300053104 | Bacteria | 3427 |
| 666 | Ga0500652_013657 | 3300053131 | Bacteria | 2883 |
| 667 | Ga0500658_0037654 | 3300053134 | Bacteria | 1925 |
| 668 | Ga0500577_0051227 | 3300053142 | Bacteria | 1552 |
| 669 | Ga0500627_0052924 | 3300053158 | Bacteria | 1773 |
| 670 | Ga0500645_000017 | 3300053730 | Bacteria | 146045 |
| 671 | Ga0500645_000188 | 3300053730 | Bacteria | 48061 |
| 672 | Ga0500645_001793 | 3300053730 | Bacteria | 10316 |
| 673 | Ga0500645_025452 | 3300053730 | Bacteria | 1806 |
| 674 | Ga0501084_0039067 | 3300054114 | Bacteria | 3969 |
| 675 | Ga0501082_0024895 | 3300060353 | Bacteria | 5157 |
| 676 | Ga0530510_0162905 | 3300061734 | Bacteria | 1650 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002244 | JGI24742J22300_10007280 | JGI24742J22300_100072803 | 287 |
| 2 | 3300005366 | Ga0070659_100260570 | Ga0070659_1002605701 | 287 |
| 3 | 3300046516 | Ga0495628_0434990 | Ga0495628_0434990_34_915 | 292 |
| 4 | 3300025981 | Ga0207640_10371038 | Ga0207640_103710381 | 293 |
| 5 | 3300048911 | Ga0496108_0557954 | Ga0496108_0557954_76_957 | 293 |
| 6 | 3300050490 | nmdc:mga03n38_84891_c1 | nmdc:mga03n38_84891_c1_17_901 | 294 |
| 7 | 3300053086 | Ga0500578_0192137 | Ga0500578_0192137_350_1234 | 294 |
| 8 | 3300005546 | Ga0070696_100057020 | Ga0070696_1000570201 | 300 |
| 9 | 3300005844 | Ga0068862_100541180 | Ga0068862_1005411802 | 300 |
| 10 | 3300028380 | Ga0268265_10278662 | Ga0268265_102786622 | 300 |
| 11 | 3300044765 | Ga0466970_0189860 | Ga0466970_0189860_185_1093 | 302 |
| 12 | 3300048915 | Ga0496112_0021144 | Ga0496112_0021144_1650_2666 | 302 |
| 13 | 3300048916 | Ga0496113_0143394 | Ga0496113_0143394_300_1316 | 302 |
| 14 | 3300048925 | Ga0496122_0027610 | Ga0496122_0027610_2950_3966 | 302 |
| 15 | 3300035242 | Ga0373962_0058624 | Ga0373962_0058624_67_1083 | 303 |
| 16 | 3300048904 | Ga0496101_0039249 | Ga0496101_0039249_390_1406 | 304 |
| 17 | 3300005330 | Ga0070690_100009368 | Ga0070690_1000093684 | 308 |
| 18 | 3300005335 | Ga0070666_10050045 | Ga0070666_100500453 | 308 |
| 19 | 3300005337 | Ga0070682_100018767 | Ga0070682_1000187672 | 308 |
| 20 | 3300005338 | Ga0068868_100001534 | Ga0068868_1000015348 | 308 |
| 21 | 3300005341 | Ga0070691_10024492 | Ga0070691_100244922 | 308 |
| 22 | 3300005347 | Ga0070668_100003591 | Ga0070668_1000035914 | 308 |
| 23 | 3300005354 | Ga0070675_100082654 | Ga0070675_1000826542 | 308 |
| 24 | 3300005356 | Ga0070674_100005222 | Ga0070674_1000052222 | 308 |
| 25 | 3300005365 | Ga0070688_100006042 | Ga0070688_1000060423 | 308 |
| 26 | 3300005367 | Ga0070667_100003168 | Ga0070667_1000031682 | 308 |
| 27 | 3300005437 | Ga0070710_10001392 | Ga0070710_100013925 | 308 |
| 28 | 3300005438 | Ga0070701_10006493 | Ga0070701_100064932 | 308 |
| 29 | 3300005441 | Ga0070700_100005245 | Ga0070700_1000052454 | 308 |
| 30 | 3300005444 | Ga0070694_100004880 | Ga0070694_1000048805 | 308 |
| 31 | 3300005456 | Ga0070678_100002759 | Ga0070678_1000027598 | 308 |
| 32 | 3300005457 | Ga0070662_100026108 | Ga0070662_1000261084 | 308 |
| 33 | 3300005459 | Ga0068867_100005802 | Ga0068867_1000058027 | 308 |
| 34 | 3300005539 | Ga0068853_100010078 | Ga0068853_1000100785 | 308 |
| 35 | 3300005546 | Ga0070696_100060580 | Ga0070696_1000605802 | 308 |
| 36 | 3300005548 | Ga0070665_100030874 | Ga0070665_1000308743 | 308 |
| 37 | 3300005549 | Ga0070704_100000313 | Ga0070704_1000003132 | 308 |
| 38 | 3300005563 | Ga0068855_100281144 | Ga0068855_1002811442 | 308 |
| 39 | 3300005578 | Ga0068854_100001484 | Ga0068854_10000148412 | 308 |
| 40 | 3300005615 | Ga0070702_100039656 | Ga0070702_1000396562 | 308 |
| 41 | 3300005617 | Ga0068859_100004026 | Ga0068859_10000402614 | 308 |
| 42 | 3300005718 | Ga0068866_10060364 | Ga0068866_100603642 | 308 |
| 43 | 3300005719 | Ga0068861_100001049 | Ga0068861_1000010499 | 308 |
| 44 | 3300005842 | Ga0068858_100014801 | Ga0068858_1000148011 | 308 |
| 45 | 3300005843 | Ga0068860_100094031 | Ga0068860_1000940312 | 308 |
| 46 | 3300005844 | Ga0068862_100003302 | Ga0068862_1000033023 | 308 |
| 47 | 3300006163 | Ga0070715_10000197 | Ga0070715_100001972 | 308 |
| 48 | 3300006237 | Ga0097621_100010926 | Ga0097621_1000109262 | 308 |
| 49 | 3300006881 | Ga0068865_100008905 | Ga0068865_1000089053 | 308 |
| 50 | 3300006931 | Ga0097620_100004026 | Ga0097620_10000402614 | 308 |
| 51 | 3300009098 | Ga0105245_10005751 | Ga0105245_100057513 | 308 |
| 52 | 3300009101 | Ga0105247_10003309 | Ga0105247_100033094 | 308 |
| 53 | 3300009148 | Ga0105243_10000779 | Ga0105243_1000077914 | 308 |
| 54 | 3300009176 | Ga0105242_10000066 | Ga0105242_100000663 | 308 |
| 55 | 3300009551 | Ga0105238_10111992 | Ga0105238_101119922 | 308 |
| 56 | 3300009553 | Ga0105249_10004766 | Ga0105249_100047665 | 308 |
| 57 | 3300010375 | Ga0105239_10015683 | Ga0105239_100156837 | 308 |
| 58 | 3300013297 | Ga0157378_10002159 | Ga0157378_100021595 | 308 |
| 59 | 3300013306 | Ga0163162_10014890 | Ga0163162_100148905 | 308 |
| 60 | 3300013308 | Ga0157375_10000268 | Ga0157375_100002686 | 308 |
| 61 | 3300014326 | Ga0157380_10000036 | Ga0157380_1000003664 | 308 |
| 62 | 3300014745 | Ga0157377_10031203 | Ga0157377_100312033 | 308 |
| 63 | 3300014968 | Ga0157379_10001562 | Ga0157379_100015626 | 308 |
| 64 | 3300014969 | Ga0157376_10065953 | Ga0157376_100659532 | 308 |
| 65 | 3300017792 | Ga0163161_10009914 | Ga0163161_100099145 | 308 |
| 66 | 3300025898 | Ga0207692_10043306 | Ga0207692_100433063 | 308 |
| 67 | 3300025899 | Ga0207642_10004003 | Ga0207642_100040034 | 308 |
| 68 | 3300025901 | Ga0207688_10001014 | Ga0207688_100010144 | 308 |
| 69 | 3300025907 | Ga0207645_10005002 | Ga0207645_100050023 | 308 |
| 70 | 3300025915 | Ga0207693_10000224 | Ga0207693_1000022443 | 308 |
| 71 | 3300025927 | Ga0207687_10008487 | Ga0207687_100084874 | 308 |
| 72 | 3300025929 | Ga0207664_10085978 | Ga0207664_100859783 | 308 |
| 73 | 3300025933 | Ga0207706_10000288 | Ga0207706_1000028836 | 308 |
| 74 | 3300025934 | Ga0207686_10008741 | Ga0207686_100087414 | 308 |
| 75 | 3300025935 | Ga0207709_10018729 | Ga0207709_100187292 | 308 |
| 76 | 3300025937 | Ga0207669_10010158 | Ga0207669_100101583 | 308 |
| 77 | 3300025938 | Ga0207704_10166759 | Ga0207704_101667592 | 308 |
| 78 | 3300025939 | Ga0207665_10008988 | Ga0207665_100089884 | 308 |
| 79 | 3300025940 | Ga0207691_10126096 | Ga0207691_101260963 | 308 |
| 80 | 3300025949 | Ga0207667_10238478 | Ga0207667_102384782 | 308 |
| 81 | 3300025961 | Ga0207712_10026058 | Ga0207712_100260583 | 308 |
| 82 | 3300025972 | Ga0207668_10104147 | Ga0207668_101041472 | 308 |
| 83 | 3300025986 | Ga0207658_10200802 | Ga0207658_102008022 | 308 |
| 84 | 3300026023 | Ga0207677_10125461 | Ga0207677_101254612 | 308 |
| 85 | 3300026035 | Ga0207703_10007155 | Ga0207703_100071556 | 308 |
| 86 | 3300026041 | Ga0207639_10049175 | Ga0207639_100491753 | 308 |
| 87 | 3300026075 | Ga0207708_10003048 | Ga0207708_100030489 | 308 |
| 88 | 3300026089 | Ga0207648_10001622 | Ga0207648_100016224 | 308 |
| 89 | 3300026118 | Ga0207675_100000324 | Ga0207675_10000032413 | 308 |
| 90 | 3300026121 | Ga0207683_10000077 | Ga0207683_1000007772 | 308 |
| 91 | 3300028379 | Ga0268266_10011847 | Ga0268266_100118473 | 308 |
| 92 | 3300028380 | Ga0268265_10008953 | Ga0268265_100089535 | 308 |
| 93 | 3300035114 | Ga0373939_0057979 | Ga0373939_0057979_132_1145 | 308 |
| 94 | 3300035691 | Ga0373931_0047926 | Ga0373931_0047926_643_1656 | 308 |
| 95 | 3300048904 | Ga0496101_0015182 | Ga0496101_0015182_3463_4476 | 308 |
| 96 | 3300048905 | Ga0496102_0000915 | Ga0496102_0000915_3402_4415 | 308 |
| 97 | 3300048906 | Ga0496103_0024888 | Ga0496103_0024888_1224_2237 | 308 |
| 98 | 3300048909 | Ga0496106_0010211 | Ga0496106_0010211_1123_2136 | 308 |
| 99 | 3300048918 | Ga0496115_0005192 | Ga0496115_0005192_3790_4803 | 308 |
| 100 | 3300034819 | Ga0373958_0032216 | Ga0373958_0032216_85_1017 | 310 |
| 101 | 3300041410 | Ga0439461_0001671 | Ga0439461_0001671_1913_2938 | 313 |
| 102 | 3300041411 | Ga0439466_0002159 | Ga0439466_0002159_1821_2846 | 313 |
| 103 | 3300050492 | nmdc:mga0yw44_14128_c2 | nmdc:mga0yw44_14128_c2_2601_3545 | 314 |
| 104 | 3300006186 | Ga0075369_10035586 | Ga0075369_100355863 | 315 |
| 105 | 3300048908 | Ga0496105_0066575 | Ga0496105_0066575_1985_2941 | 318 |
| 106 | 3300049568 | Ga0501031_0003559 | Ga0501031_0003559_6961_7974 | 319 |
| 107 | 3300049569 | Ga0501032_0004950 | Ga0501032_0004950_2036_3049 | 319 |
| 108 | 3300049571 | Ga0501034_0009889 | Ga0501034_0009889_6961_7974 | 319 |
| 109 | 3300049573 | Ga0501037_0013608 | Ga0501037_0013608_533_1546 | 319 |
| 110 | 3300049575 | Ga0501039_0020591 | Ga0501039_0020591_326_1339 | 319 |
| 111 | 3300049576 | Ga0501040_0139122 | Ga0501040_0139122_389_1402 | 319 |
| 112 | 3300049579 | Ga0501043_0042133 | Ga0501043_0042133_2394_3407 | 319 |
| 113 | 3300049580 | Ga0501046_0024825 | Ga0501046_0024825_2036_3049 | 319 |
| 114 | 3300049581 | Ga0501047_0021818 | Ga0501047_0021818_1493_2506 | 319 |
| 115 | 3300049583 | Ga0501067_0015476 | Ga0501067_0015476_805_1818 | 319 |
| 116 | 3300049585 | Ga0501069_0004427 | Ga0501069_0004427_4935_5948 | 319 |
| 117 | 3300049587 | Ga0501071_0010148 | Ga0501071_0010148_769_1782 | 319 |
| 118 | 3300049588 | Ga0501072_0004542 | Ga0501072_0004542_4546_5559 | 319 |
| 119 | 3300049589 | Ga0501073_0018809 | Ga0501073_0018809_2052_3065 | 319 |
| 120 | 3300049590 | Ga0501074_0135914 | Ga0501074_0135914_261_1274 | 319 |
| 121 | 3300049592 | Ga0501076_0201494 | Ga0501076_0201494_36_1049 | 319 |
| 122 | 3300049593 | Ga0501077_0026031 | Ga0501077_0026031_2140_3153 | 319 |
| 123 | 3300049741 | Ga0501079_0190485 | Ga0501079_0190485_327_1340 | 319 |
| 124 | 3300049742 | Ga0501080_0131573 | Ga0501080_0131573_1043_2056 | 319 |
| 125 | 3300049744 | Ga0501083_0008871 | Ga0501083_0008871_4868_5881 | 319 |
| 126 | 3300049822 | Ga0501035_0176509 | Ga0501035_0176509_219_1232 | 319 |
| 127 | 3300049823 | Ga0501044_0012714 | Ga0501044_0012714_6961_7974 | 319 |
| 128 | 3300054114 | Ga0501084_0039067 | Ga0501084_0039067_105_1118 | 319 |
| 129 | 3300060353 | Ga0501082_0024895 | Ga0501082_0024895_424_1437 | 319 |
| 130 | 3300061734 | Ga0530510_0162905 | Ga0530510_0162905_603_1616 | 319 |
| 131 | 3300026075 | Ga0207708_10125334 | Ga0207708_101253342 | 321 |
| 132 | 3300041997 | Ga0439431_0000447 | Ga0439431_0000447_7529_8554 | 322 |
| 133 | 3300042435 | Ga0439434_0012896 | Ga0439434_0012896_133_1158 | 322 |
| 134 | 3300006186 | Ga0075369_10050367 | Ga0075369_100503672 | 323 |
| 135 | 3300031824 | Ga0307413_10017608 | Ga0307413_100176084 | 323 |
| 136 | 3300050516 | nmdc:mga0sz30_48225_c1 | nmdc:mga0sz30_48225_c1_37_1053 | 323 |
| 137 | 3300050491 | nmdc:mga00v17_24553_c1 | nmdc:mga00v17_24553_c1_98_1114 | 324 |
| 138 | 3300006038 | Ga0075365_10002099 | Ga0075365_100020995 | 325 |
| 139 | 3300006048 | Ga0075363_100000682 | Ga0075363_1000006824 | 325 |
| 140 | 3300006195 | Ga0075366_10167653 | Ga0075366_101676532 | 325 |
| 141 | 3300050490 | nmdc:mga03n38_1769_c1 | nmdc:mga03n38_1769_c1_4292_5308 | 325 |
| 142 | 3300050492 | nmdc:mga0yw44_3548_c1 | nmdc:mga0yw44_3548_c1_2478_3494 | 325 |
| 143 | 3300050493 | nmdc:mga0k408_103548_c2 | nmdc:mga0k408_103548_c2_62_1078 | 325 |
| 144 | 3300050495 | nmdc:mga04h51_66581_c1 | nmdc:mga04h51_66581_c1_83_1099 | 325 |
| 145 | 3300044658 | Ga0466972_0033222 | Ga0466972_0033222_66_1076 | 326 |
| 146 | 3300005844 | Ga0068862_100144824 | Ga0068862_1001448242 | 327 |
| 147 | 3300042002 | Ga0439442_011141 | Ga0439442_011141_783_1799 | 327 |
| 148 | 3300048905 | Ga0496102_0014909 | Ga0496102_0014909_3165_4175 | 327 |
| 149 | 3300006042 | Ga0075368_10059354 | Ga0075368_100593542 | 328 |
| 150 | 3300027866 | Ga0209813_10058967 | Ga0209813_100589672 | 328 |
| 151 | 3300050495 | nmdc:mga04h51_59170_c1 | nmdc:mga04h51_59170_c1_154_1170 | 328 |
| 152 | 3300005434 | Ga0070709_10151708 | Ga0070709_101517081 | 329 |
| 153 | 3300005438 | Ga0070701_10081819 | Ga0070701_100818191 | 329 |
| 154 | 3300005439 | Ga0070711_100052850 | Ga0070711_1000528502 | 329 |
| 155 | 3300005444 | Ga0070694_100291737 | Ga0070694_1002917371 | 329 |
| 156 | 3300005549 | Ga0070704_100028516 | Ga0070704_1000285162 | 329 |
| 157 | 3300005718 | Ga0068866_10008170 | Ga0068866_100081704 | 329 |
| 158 | 3300005843 | Ga0068860_100316990 | Ga0068860_1003169902 | 329 |
| 159 | 3300006038 | Ga0075365_10058194 | Ga0075365_100581942 | 329 |
| 160 | 3300006051 | Ga0075364_10004603 | Ga0075364_100046034 | 329 |
| 161 | 3300006051 | Ga0075364_10119395 | Ga0075364_101193952 | 329 |
| 162 | 3300006051 | Ga0075364_10119522 | Ga0075364_101195222 | 329 |
| 163 | 3300006173 | Ga0070716_100013650 | Ga0070716_1000136503 | 329 |
| 164 | 3300006175 | Ga0070712_100013747 | Ga0070712_1000137472 | 329 |
| 165 | 3300006177 | Ga0075362_10059104 | Ga0075362_100591042 | 329 |
| 166 | 3300006178 | Ga0075367_10024781 | Ga0075367_100247813 | 329 |
| 167 | 3300006186 | Ga0075369_10019582 | Ga0075369_100195821 | 329 |
| 168 | 3300006353 | Ga0075370_10090503 | Ga0075370_100905032 | 329 |
| 169 | 3300006844 | Ga0075428_100005018 | Ga0075428_10000501813 | 329 |
| 170 | 3300006846 | Ga0075430_100119671 | Ga0075430_1001196712 | 329 |
| 171 | 3300006847 | Ga0075431_100023608 | Ga0075431_1000236082 | 329 |
| 172 | 3300006881 | Ga0068865_100145574 | Ga0068865_1001455742 | 329 |
| 173 | 3300009147 | Ga0114129_10022999 | Ga0114129_100229994 | 329 |
| 174 | 3300025899 | Ga0207642_10138945 | Ga0207642_101389452 | 329 |
| 175 | 3300025915 | Ga0207693_10007684 | Ga0207693_100076844 | 329 |
| 176 | 3300025916 | Ga0207663_10059942 | Ga0207663_100599422 | 329 |
| 177 | 3300025935 | Ga0207709_10072913 | Ga0207709_100729132 | 329 |
| 178 | 3300026067 | Ga0207678_10114233 | Ga0207678_101142333 | 329 |
| 179 | 3300026118 | Ga0207675_100106243 | Ga0207675_1001062433 | 329 |
| 180 | 3300035691 | Ga0373931_0014257 | Ga0373931_0014257_459_1475 | 329 |
| 181 | 3300048905 | Ga0496102_0053984 | Ga0496102_0053984_1143_2159 | 329 |
| 182 | 3300050494 | nmdc:mga06z11_155511_c1 | nmdc:mga06z11_155511_c1_258_1274 | 329 |
| 183 | 3300050496 | nmdc:mga07m45_89246_c1 | nmdc:mga07m45_89246_c1_173_1189 | 329 |
| 184 | 3300050507 | nmdc:mga05p37_22120_c2 | nmdc:mga05p37_22120_c2_5361_6377 | 329 |
| 185 | 3300050509 | nmdc:mga0qj67_6776_c1 | nmdc:mga0qj67_6776_c1_6756_7772 | 329 |
| 186 | 3300050510 | nmdc:mga06r32_9568_c1 | nmdc:mga06r32_9568_c1_4708_5724 | 329 |
| 187 | 3300050516 | nmdc:mga0sz30_52691_c1 | nmdc:mga0sz30_52691_c1_393_1409 | 329 |
| 188 | 3300049569 | Ga0501032_0031377 | Ga0501032_0031377_87_1103 | 330 |
| 189 | 3300049571 | Ga0501034_0178912 | Ga0501034_0178912_867_1883 | 330 |
| 190 | 3300049581 | Ga0501047_0031179 | Ga0501047_0031179_2080_3096 | 330 |
| 191 | 3300049822 | Ga0501035_0001861 | Ga0501035_0001861_15936_16952 | 330 |
| 192 | 3300049823 | Ga0501044_0000150 | Ga0501044_0000150_32959_33975 | 330 |
| 193 | 3300046455 | Ga0495603_0067823 | Ga0495603_0067823_809_1804 | 331 |
| 194 | iso_pu_bacteria | 2816332119 | 2816424827 | 332 |
| 195 | 3300035725 | Ga0373947_0182509 | Ga0373947_0182509_75_1091 | 333 |
| 196 | 3300047321 | Ga0495676_0040198 | Ga0495676_0040198_1203_2219 | 333 |
| 197 | iso_pu_bacteria | 2995463766 | 2995466439 | 333 |
| 198 | iso_pu_bacteria | 2643221687 | 2644485591 | 334 |
| 199 | iso_pu_bacteria | 2643221715 | 2644639001 | 334 |
| 200 | iso_pu_bacteria | 2738541264 | 2738664200 | 334 |
| 201 | iso_pu_bacteria | 2738541274 | 2738703000 | 334 |
| 202 | iso_pu_bacteria | 2738541274 | 2738706980 | 334 |
| 203 | iso_pu_bacteria | 2738541356 | 2739143335 | 334 |
| 204 | iso_pu_bacteria | 2738543028 | 2739333684 | 334 |
| 205 | iso_pu_bacteria | 2738543028 | 2739333821 | 334 |
| 206 | iso_pu_bacteria | 2842134933 | 2842136808 | 334 |
| 207 | iso_pu_bacteria | 2902792274 | 2902796088 | 334 |
| 208 | iso_pu_bacteria | 2902799365 | 2902800536 | 334 |
| 209 | iso_pu_bacteria | 2902810491 | 2902814122 | 334 |
| 210 | iso_pu_bacteria | 2902837492 | 2902843389 | 334 |
| 211 | iso_pu_bacteria | 2939582691 | 2939586705 | 334 |
| 212 | 3300053087 | Ga0500643_000213 | Ga0500643_000213_319_1329 | 336 |
| 213 | 3300005440 | Ga0070705_100011946 | Ga0070705_1000119462 | 337 |
| 214 | 3300044656 | Ga0466969_0019268 | Ga0466969_0019268_1039_2052 | 337 |
| 215 | 3300044693 | Ga0466961_0018216 | Ga0466961_0018216_2895_3908 | 337 |
| 216 | 3300045049 | Ga0466959_0032140 | Ga0466959_0032140_194_1207 | 337 |
| 217 | 3300045976 | Ga0466967_0078503 | Ga0466967_0078503_153_1166 | 337 |
| 218 | 3300046459 | Ga0495629_0000546 | Ga0495629_0000546_7619_8632 | 337 |
| 219 | 3300046462 | Ga0495651_0007772 | Ga0495651_0007772_534_1547 | 337 |
| 220 | 3300046462 | Ga0495651_0038321 | Ga0495651_0038321_1782_2798 | 337 |
| 221 | 3300046463 | Ga0495653_0015204 | Ga0495653_0015204_52_1065 | 337 |
| 222 | 3300046499 | Ga0495594_0000907 | Ga0495594_0000907_7570_8583 | 337 |
| 223 | 3300046511 | Ga0495608_0021528 | Ga0495608_0021528_2249_3262 | 337 |
| 224 | 3300046516 | Ga0495628_0013118 | Ga0495628_0013118_5104_6117 | 337 |
| 225 | 3300046517 | Ga0495630_0020357 | Ga0495630_0020357_3820_4833 | 337 |
| 226 | 3300046529 | Ga0495652_0012110 | Ga0495652_0012110_6659_7672 | 337 |
| 227 | 3300046529 | Ga0495652_0066076 | Ga0495652_0066076_974_1990 | 337 |
| 228 | 3300046531 | Ga0495665_0027228 | Ga0495665_0027228_587_1600 | 337 |
| 229 | 3300046533 | Ga0495640_0001256 | Ga0495640_0001256_4742_5758 | 337 |
| 230 | 3300046533 | Ga0495640_0004019 | Ga0495640_0004019_6383_7396 | 337 |
| 231 | 3300046536 | Ga0495587_0006340 | Ga0495587_0006340_6653_7666 | 337 |
| 232 | 3300046543 | Ga0495645_0010749 | Ga0495645_0010749_3204_4217 | 337 |
| 233 | 3300046559 | Ga0495667_0016349 | Ga0495667_0016349_666_1679 | 337 |
| 234 | 3300046642 | Ga0495634_0035550 | Ga0495634_0035550_2277_3290 | 337 |
| 235 | 3300046648 | Ga0495611_0078433 | Ga0495611_0078433_96_1109 | 337 |
| 236 | 3300046663 | Ga0495635_0007371 | Ga0495635_0007371_57_1070 | 337 |
| 237 | 3300046674 | Ga0495588_0023666 | Ga0495588_0023666_1864_2880 | 337 |
| 238 | 3300046675 | Ga0495657_0011542 | Ga0495657_0011542_59_1072 | 337 |
| 239 | 3300046678 | Ga0495599_0005251 | Ga0495599_0005251_6659_7672 | 337 |
| 240 | 3300046679 | Ga0495623_0005019 | Ga0495623_0005019_534_1547 | 337 |
| 241 | 3300046689 | Ga0495613_0003801 | Ga0495613_0003801_10185_11198 | 337 |
| 242 | 3300046689 | Ga0495613_0004495 | Ga0495613_0004495_1209_2225 | 337 |
| 243 | 3300046809 | Ga0495600_0004749 | Ga0495600_0004749_534_1547 | 337 |
| 244 | 3300047317 | Ga0495604_0023894 | Ga0495604_0023894_534_1547 | 337 |
| 245 | 3300047319 | Ga0495674_0164092 | Ga0495674_0164092_48_1061 | 337 |
| 246 | 3300047321 | Ga0495676_0022256 | Ga0495676_0022256_1916_2929 | 337 |
| 247 | 3300047321 | Ga0495676_0026456 | Ga0495676_0026456_3490_4503 | 337 |
| 248 | 3300047444 | Ga0495675_0003362 | Ga0495675_0003362_1964_2977 | 337 |
| 249 | 3300047444 | Ga0495675_0043633 | Ga0495675_0043633_563_1579 | 337 |
| 250 | 3300047471 | Ga0495684_0005393 | Ga0495684_0005393_8410_9423 | 337 |
| 251 | 3300048088 | Ga0495602_0010713 | Ga0495602_0010713_1836_2849 | 337 |
| 252 | 3300048915 | Ga0496112_0077455 | Ga0496112_0077455_235_1248 | 337 |
| 253 | 3300049568 | Ga0501031_0039482 | Ga0501031_0039482_214_1230 | 337 |
| 254 | 3300049822 | Ga0501035_0198366 | Ga0501035_0198366_118_1131 | 337 |
| 255 | 3300002074 | JGI24748J21848_1002207 | JGI24748J21848_10022071 | 338 |
| 256 | 3300002077 | JGI24744J21845_10006091 | JGI24744J21845_100060911 | 338 |
| 257 | 3300003792 | Ga0055540_1003459 | Ga0055540_10034596 | 338 |
| 258 | 3300003792 | Ga0055540_1004892 | Ga0055540_10048925 | 338 |
| 259 | 3300003792 | Ga0055540_1007819 | Ga0055540_10078194 | 338 |
| 260 | 3300005330 | Ga0070690_100067610 | Ga0070690_1000676101 | 338 |
| 261 | 3300005333 | Ga0070677_10045961 | Ga0070677_100459613 | 338 |
| 262 | 3300005334 | Ga0068869_100014804 | Ga0068869_1000148044 | 338 |
| 263 | 3300005335 | Ga0070666_10038481 | Ga0070666_100384812 | 338 |
| 264 | 3300005336 | Ga0070680_100196710 | Ga0070680_1001967103 | 338 |
| 265 | 3300005337 | Ga0070682_100103958 | Ga0070682_1001039583 | 338 |
| 266 | 3300005338 | Ga0068868_100080455 | Ga0068868_1000804553 | 338 |
| 267 | 3300005340 | Ga0070689_100021792 | Ga0070689_1000217923 | 338 |
| 268 | 3300005341 | Ga0070691_10008853 | Ga0070691_100088531 | 338 |
| 269 | 3300005341 | Ga0070691_10105690 | Ga0070691_101056901 | 338 |
| 270 | 3300005345 | Ga0070692_10035561 | Ga0070692_100355613 | 338 |
| 271 | 3300005347 | Ga0070668_100002331 | Ga0070668_10000233112 | 338 |
| 272 | 3300005347 | Ga0070668_100047349 | Ga0070668_1000473494 | 338 |
| 273 | 3300005354 | Ga0070675_100038759 | Ga0070675_1000387594 | 338 |
| 274 | 3300005355 | Ga0070671_100229625 | Ga0070671_1002296252 | 338 |
| 275 | 3300005355 | Ga0070671_100280683 | Ga0070671_1002806832 | 338 |
| 276 | 3300005356 | Ga0070674_100001422 | Ga0070674_10000142213 | 338 |
| 277 | 3300005356 | Ga0070674_100026065 | Ga0070674_1000260653 | 338 |
| 278 | 3300005365 | Ga0070688_100006500 | Ga0070688_1000065004 | 338 |
| 279 | 3300005365 | Ga0070688_100070618 | Ga0070688_1000706182 | 338 |
| 280 | 3300005366 | Ga0070659_100033533 | Ga0070659_1000335331 | 338 |
| 281 | 3300005367 | Ga0070667_100000075 | Ga0070667_100000075119 | 338 |
| 282 | 3300005367 | Ga0070667_100004972 | Ga0070667_1000049722 | 338 |
| 283 | 3300005367 | Ga0070667_100046698 | Ga0070667_1000466981 | 338 |
| 284 | 3300005434 | Ga0070709_10031089 | Ga0070709_100310891 | 338 |
| 285 | 3300005434 | Ga0070709_10107613 | Ga0070709_101076132 | 338 |
| 286 | 3300005437 | Ga0070710_10001944 | Ga0070710_100019448 | 338 |
| 287 | 3300005437 | Ga0070710_10031660 | Ga0070710_100316601 | 338 |
| 288 | 3300005438 | Ga0070701_10000435 | Ga0070701_1000043510 | 338 |
| 289 | 3300005439 | Ga0070711_100001721 | Ga0070711_10000172111 | 338 |
| 290 | 3300005439 | Ga0070711_100003570 | Ga0070711_1000035707 | 338 |
| 291 | 3300005440 | Ga0070705_100037296 | Ga0070705_1000372963 | 338 |
| 292 | 3300005441 | Ga0070700_100003106 | Ga0070700_1000031061 | 338 |
| 293 | 3300005441 | Ga0070700_100033608 | Ga0070700_1000336081 | 338 |
| 294 | 3300005444 | Ga0070694_100088743 | Ga0070694_1000887433 | 338 |
| 295 | 3300005455 | Ga0070663_100061262 | Ga0070663_1000612621 | 338 |
| 296 | 3300005455 | Ga0070663_100117785 | Ga0070663_1001177852 | 338 |
| 297 | 3300005455 | Ga0070663_100197247 | Ga0070663_1001972471 | 338 |
| 298 | 3300005455 | Ga0070663_100252258 | Ga0070663_1002522581 | 338 |
| 299 | 3300005456 | Ga0070678_100001428 | Ga0070678_1000014281 | 338 |
| 300 | 3300005456 | Ga0070678_100015071 | Ga0070678_1000150714 | 338 |
| 301 | 3300005456 | Ga0070678_100154238 | Ga0070678_1001542382 | 338 |
| 302 | 3300005456 | Ga0070678_100407146 | Ga0070678_1004071461 | 338 |
| 303 | 3300005459 | Ga0068867_100026418 | Ga0068867_1000264184 | 338 |
| 304 | 3300005466 | Ga0070685_10079849 | Ga0070685_100798492 | 338 |
| 305 | 3300005466 | Ga0070685_10106165 | Ga0070685_101061652 | 338 |
| 306 | 3300005466 | Ga0070685_10137050 | Ga0070685_101370502 | 338 |
| 307 | 3300005530 | Ga0070679_100309127 | Ga0070679_1003091272 | 338 |
| 308 | 3300005539 | Ga0068853_100018982 | Ga0068853_1000189821 | 338 |
| 309 | 3300005539 | Ga0068853_100142578 | Ga0068853_1001425782 | 338 |
| 310 | 3300005539 | Ga0068853_100212282 | Ga0068853_1002122823 | 338 |
| 311 | 3300005543 | Ga0070672_100225660 | Ga0070672_1002256602 | 338 |
| 312 | 3300005544 | Ga0070686_100048494 | Ga0070686_1000484943 | 338 |
| 313 | 3300005545 | Ga0070695_100086844 | Ga0070695_1000868441 | 338 |
| 314 | 3300005546 | Ga0070696_100003298 | Ga0070696_10000329810 | 338 |
| 315 | 3300005546 | Ga0070696_100171427 | Ga0070696_1001714272 | 338 |
| 316 | 3300005547 | Ga0070693_100005306 | Ga0070693_1000053061 | 338 |
| 317 | 3300005547 | Ga0070693_100025397 | Ga0070693_1000253974 | 338 |
| 318 | 3300005547 | Ga0070693_100072408 | Ga0070693_1000724081 | 338 |
| 319 | 3300005547 | Ga0070693_100097755 | Ga0070693_1000977552 | 338 |
| 320 | 3300005548 | Ga0070665_100001679 | Ga0070665_1000016792 | 338 |
| 321 | 3300005548 | Ga0070665_100058267 | Ga0070665_1000582672 | 338 |
| 322 | 3300005548 | Ga0070665_100162347 | Ga0070665_1001623471 | 338 |
| 323 | 3300005549 | Ga0070704_100001436 | Ga0070704_1000014361 | 338 |
| 324 | 3300005549 | Ga0070704_100018644 | Ga0070704_1000186442 | 338 |
| 325 | 3300005549 | Ga0070704_100238338 | Ga0070704_1002383382 | 338 |
| 326 | 3300005578 | Ga0068854_100002812 | Ga0068854_10000281210 | 338 |
| 327 | 3300005578 | Ga0068854_100039896 | Ga0068854_1000398962 | 338 |
| 328 | 3300005578 | Ga0068854_100068024 | Ga0068854_1000680243 | 338 |
| 329 | 3300005615 | Ga0070702_100011985 | Ga0070702_1000119854 | 338 |
| 330 | 3300005615 | Ga0070702_100045685 | Ga0070702_1000456852 | 338 |
| 331 | 3300005617 | Ga0068859_100000077 | Ga0068859_10000007768 | 338 |
| 332 | 3300005617 | Ga0068859_100005680 | Ga0068859_1000056801 | 338 |
| 333 | 3300005617 | Ga0068859_100042188 | Ga0068859_1000421884 | 338 |
| 334 | 3300005718 | Ga0068866_10000564 | Ga0068866_100005648 | 338 |
| 335 | 3300005718 | Ga0068866_10017449 | Ga0068866_100174493 | 338 |
| 336 | 3300005719 | Ga0068861_100001894 | Ga0068861_1000018941 | 338 |
| 337 | 3300005719 | Ga0068861_100310440 | Ga0068861_1003104401 | 338 |
| 338 | 3300005834 | Ga0068851_10057998 | Ga0068851_100579981 | 338 |
| 339 | 3300005841 | Ga0068863_100103073 | Ga0068863_1001030733 | 338 |
| 340 | 3300005841 | Ga0068863_100382190 | Ga0068863_1003821901 | 338 |
| 341 | 3300005842 | Ga0068858_100005232 | Ga0068858_10000523213 | 338 |
| 342 | 3300005842 | Ga0068858_100010804 | Ga0068858_1000108048 | 338 |
| 343 | 3300005842 | Ga0068858_100014269 | Ga0068858_1000142694 | 338 |
| 344 | 3300005842 | Ga0068858_100019169 | Ga0068858_1000191693 | 338 |
| 345 | 3300005843 | Ga0068860_100000025 | Ga0068860_100000025234 | 338 |
| 346 | 3300005843 | Ga0068860_100001896 | Ga0068860_1000018962 | 338 |
| 347 | 3300005843 | Ga0068860_100005582 | Ga0068860_10000558213 | 338 |
| 348 | 3300005843 | Ga0068860_100064628 | Ga0068860_1000646283 | 338 |
| 349 | 3300005843 | Ga0068860_100277587 | Ga0068860_1002775872 | 338 |
| 350 | 3300005844 | Ga0068862_100004339 | Ga0068862_10000433911 | 338 |
| 351 | 3300005844 | Ga0068862_100198958 | Ga0068862_1001989582 | 338 |
| 352 | 3300006038 | Ga0075365_10002870 | Ga0075365_100028706 | 338 |
| 353 | 3300006038 | Ga0075365_10013149 | Ga0075365_100131492 | 338 |
| 354 | 3300006038 | Ga0075365_10074319 | Ga0075365_100743192 | 338 |
| 355 | 3300006038 | Ga0075365_10084118 | Ga0075365_100841183 | 338 |
| 356 | 3300006048 | Ga0075363_100001854 | Ga0075363_1000018544 | 338 |
| 357 | 3300006051 | Ga0075364_10007585 | Ga0075364_100075854 | 338 |
| 358 | 3300006051 | Ga0075364_10024577 | Ga0075364_100245773 | 338 |
| 359 | 3300006051 | Ga0075364_10036246 | Ga0075364_100362463 | 338 |
| 360 | 3300006163 | Ga0070715_10001550 | Ga0070715_100015501 | 338 |
| 361 | 3300006163 | Ga0070715_10007835 | Ga0070715_100078353 | 338 |
| 362 | 3300006173 | Ga0070716_100006523 | Ga0070716_1000065233 | 338 |
| 363 | 3300006173 | Ga0070716_100008515 | Ga0070716_1000085155 | 338 |
| 364 | 3300006173 | Ga0070716_100089491 | Ga0070716_1000894911 | 338 |
| 365 | 3300006175 | Ga0070712_100001623 | Ga0070712_10000162314 | 338 |
| 366 | 3300006175 | Ga0070712_100047760 | Ga0070712_1000477603 | 338 |
| 367 | 3300006178 | Ga0075367_10021404 | Ga0075367_100214043 | 338 |
| 368 | 3300006186 | Ga0075369_10000432 | Ga0075369_1000043210 | 338 |
| 369 | 3300006186 | Ga0075369_10003792 | Ga0075369_100037924 | 338 |
| 370 | 3300006186 | Ga0075369_10015734 | Ga0075369_100157343 | 338 |
| 371 | 3300006186 | Ga0075369_10037824 | Ga0075369_100378243 | 338 |
| 372 | 3300006237 | Ga0097621_100029904 | Ga0097621_1000299044 | 338 |
| 373 | 3300006237 | Ga0097621_100127190 | Ga0097621_1001271901 | 338 |
| 374 | 3300006353 | Ga0075370_10007035 | Ga0075370_100070353 | 338 |
| 375 | 3300006358 | Ga0068871_100023271 | Ga0068871_1000232714 | 338 |
| 376 | 3300006881 | Ga0068865_100023845 | Ga0068865_1000238451 | 338 |
| 377 | 3300006881 | Ga0068865_100066157 | Ga0068865_1000661572 | 338 |
| 378 | 3300006881 | Ga0068865_100310225 | Ga0068865_1003102252 | 338 |
| 379 | 3300006931 | Ga0097620_100000077 | Ga0097620_10000007745 | 338 |
| 380 | 3300006931 | Ga0097620_100005680 | Ga0097620_1000056801 | 338 |
| 381 | 3300006931 | Ga0097620_100042189 | Ga0097620_1000421893 | 338 |
| 382 | 3300006931 | Ga0097620_100116593 | Ga0097620_1001165933 | 338 |
| 383 | 3300009098 | Ga0105245_10004227 | Ga0105245_100042271 | 338 |
| 384 | 3300009098 | Ga0105245_10038255 | Ga0105245_100382554 | 338 |
| 385 | 3300009101 | Ga0105247_10000010 | Ga0105247_10000010101 | 338 |
| 386 | 3300009101 | Ga0105247_10002429 | Ga0105247_1000242913 | 338 |
| 387 | 3300009101 | Ga0105247_10139251 | Ga0105247_101392512 | 338 |
| 388 | 3300009148 | Ga0105243_10003474 | Ga0105243_1000347413 | 338 |
| 389 | 3300009148 | Ga0105243_10256443 | Ga0105243_102564431 | 338 |
| 390 | 3300009174 | Ga0105241_10171423 | Ga0105241_101714231 | 338 |
| 391 | 3300009176 | Ga0105242_10003222 | Ga0105242_1000322213 | 338 |
| 392 | 3300009176 | Ga0105242_10035466 | Ga0105242_100354663 | 338 |
| 393 | 3300009177 | Ga0105248_10000078 | Ga0105248_1000007846 | 338 |
| 394 | 3300009177 | Ga0105248_10063430 | Ga0105248_100634304 | 338 |
| 395 | 3300009177 | Ga0105248_10179124 | Ga0105248_101791241 | 338 |
| 396 | 3300009177 | Ga0105248_10387577 | Ga0105248_103875772 | 338 |
| 397 | 3300009545 | Ga0105237_10002051 | Ga0105237_100020518 | 338 |
| 398 | 3300009545 | Ga0105237_10059499 | Ga0105237_100594994 | 338 |
| 399 | 3300009553 | Ga0105249_10004495 | Ga0105249_1000449511 | 338 |
| 400 | 3300009553 | Ga0105249_10071738 | Ga0105249_100717383 | 338 |
| 401 | 3300009553 | Ga0105249_10079289 | Ga0105249_100792893 | 338 |
| 402 | 3300009553 | Ga0105249_10290935 | Ga0105249_102909352 | 338 |
| 403 | 3300010375 | Ga0105239_10003039 | Ga0105239_1000303913 | 338 |
| 404 | 3300010375 | Ga0105239_10007335 | Ga0105239_1000733513 | 338 |
| 405 | 3300011119 | Ga0105246_10347497 | Ga0105246_103474971 | 338 |
| 406 | 3300013100 | Ga0157373_10100696 | Ga0157373_101006961 | 338 |
| 407 | 3300013102 | Ga0157371_10074596 | Ga0157371_100745961 | 338 |
| 408 | 3300013105 | Ga0157369_10065414 | Ga0157369_100654141 | 338 |
| 409 | 3300013296 | Ga0157374_10004568 | Ga0157374_100045686 | 338 |
| 410 | 3300013296 | Ga0157374_10048997 | Ga0157374_100489971 | 338 |
| 411 | 3300013297 | Ga0157378_10006119 | Ga0157378_1000611910 | 338 |
| 412 | 3300013297 | Ga0157378_10042343 | Ga0157378_100423433 | 338 |
| 413 | 3300013306 | Ga0163162_10005045 | Ga0163162_1000504513 | 338 |
| 414 | 3300013306 | Ga0163162_10008900 | Ga0163162_100089008 | 338 |
| 415 | 3300013306 | Ga0163162_10081460 | Ga0163162_100814602 | 338 |
| 416 | 3300013306 | Ga0163162_10487077 | Ga0163162_104870771 | 338 |
| 417 | 3300013307 | Ga0157372_10006232 | Ga0157372_100062321 | 338 |
| 418 | 3300013308 | Ga0157375_10035308 | Ga0157375_100353081 | 338 |
| 419 | 3300013308 | Ga0157375_10184167 | Ga0157375_101841672 | 338 |
| 420 | 3300014325 | Ga0163163_10247774 | Ga0163163_102477742 | 338 |
| 421 | 3300014326 | Ga0157380_10002701 | Ga0157380_1000270111 | 338 |
| 422 | 3300014326 | Ga0157380_10309548 | Ga0157380_103095481 | 338 |
| 423 | 3300014968 | Ga0157379_10294840 | Ga0157379_102948402 | 338 |
| 424 | 3300014969 | Ga0157376_10041038 | Ga0157376_100410384 | 338 |
| 425 | 3300017792 | Ga0163161_10002645 | Ga0163161_1000264513 | 338 |
| 426 | 3300017792 | Ga0163161_10081226 | Ga0163161_100812262 | 338 |
| 427 | 3300021384 | Ga0213876_10083340 | Ga0213876_100833402 | 338 |
| 428 | 3300025273 | Ga0209673_1033192 | Ga0209673_10331922 | 338 |
| 429 | 3300025303 | Ga0209051_1001387 | Ga0209051_100138714 | 338 |
| 430 | 3300025303 | Ga0209051_1005756 | Ga0209051_10057564 | 338 |
| 431 | 3300025303 | Ga0209051_1007639 | Ga0209051_10076393 | 338 |
| 432 | 3300025303 | Ga0209051_1015869 | Ga0209051_10158694 | 338 |
| 433 | 3300025885 | Ga0207653_10015342 | Ga0207653_100153423 | 338 |
| 434 | 3300025898 | Ga0207692_10014881 | Ga0207692_100148813 | 338 |
| 435 | 3300025898 | Ga0207692_10016015 | Ga0207692_100160154 | 338 |
| 436 | 3300025898 | Ga0207692_10020015 | Ga0207692_100200153 | 338 |
| 437 | 3300025899 | Ga0207642_10003363 | Ga0207642_100033633 | 338 |
| 438 | 3300025899 | Ga0207642_10005782 | Ga0207642_100057824 | 338 |
| 439 | 3300025899 | Ga0207642_10018491 | Ga0207642_100184912 | 338 |
| 440 | 3300025899 | Ga0207642_10026627 | Ga0207642_100266274 | 338 |
| 441 | 3300025900 | Ga0207710_10000028 | Ga0207710_10000028103 | 338 |
| 442 | 3300025900 | Ga0207710_10001082 | Ga0207710_1000108212 | 338 |
| 443 | 3300025900 | Ga0207710_10001277 | Ga0207710_1000127713 | 338 |
| 444 | 3300025901 | Ga0207688_10001235 | Ga0207688_1000123513 | 338 |
| 445 | 3300025901 | Ga0207688_10003983 | Ga0207688_100039835 | 338 |
| 446 | 3300025901 | Ga0207688_10007147 | Ga0207688_100071476 | 338 |
| 447 | 3300025904 | Ga0207647_10062841 | Ga0207647_100628413 | 338 |
| 448 | 3300025905 | Ga0207685_10002868 | Ga0207685_100028681 | 338 |
| 449 | 3300025905 | Ga0207685_10027666 | Ga0207685_100276661 | 338 |
| 450 | 3300025905 | Ga0207685_10031040 | Ga0207685_100310402 | 338 |
| 451 | 3300025906 | Ga0207699_10015436 | Ga0207699_100154364 | 338 |
| 452 | 3300025906 | Ga0207699_10131111 | Ga0207699_101311112 | 338 |
| 453 | 3300025907 | Ga0207645_10009109 | Ga0207645_100091092 | 338 |
| 454 | 3300025908 | Ga0207643_10166322 | Ga0207643_101663222 | 338 |
| 455 | 3300025911 | Ga0207654_10102439 | Ga0207654_101024391 | 338 |
| 456 | 3300025912 | Ga0207707_10090440 | Ga0207707_100904403 | 338 |
| 457 | 3300025913 | Ga0207695_10260924 | Ga0207695_102609241 | 338 |
| 458 | 3300025914 | Ga0207671_10004398 | Ga0207671_100043989 | 338 |
| 459 | 3300025915 | Ga0207693_10003919 | Ga0207693_1000391913 | 338 |
| 460 | 3300025915 | Ga0207693_10008115 | Ga0207693_100081153 | 338 |
| 461 | 3300025915 | Ga0207693_10010959 | Ga0207693_100109594 | 338 |
| 462 | 3300025915 | Ga0207693_10110336 | Ga0207693_101103362 | 338 |
| 463 | 3300025916 | Ga0207663_10007980 | Ga0207663_100079804 | 338 |
| 464 | 3300025916 | Ga0207663_10030182 | Ga0207663_100301823 | 338 |
| 465 | 3300025916 | Ga0207663_10265891 | Ga0207663_102658912 | 338 |
| 466 | 3300025917 | Ga0207660_10097492 | Ga0207660_100974923 | 338 |
| 467 | 3300025918 | Ga0207662_10053195 | Ga0207662_100531953 | 338 |
| 468 | 3300025918 | Ga0207662_10100205 | Ga0207662_101002051 | 338 |
| 469 | 3300025919 | Ga0207657_10017934 | Ga0207657_100179346 | 338 |
| 470 | 3300025919 | Ga0207657_10018386 | Ga0207657_100183864 | 338 |
| 471 | 3300025923 | Ga0207681_10014692 | Ga0207681_100146921 | 338 |
| 472 | 3300025923 | Ga0207681_10018021 | Ga0207681_100180214 | 338 |
| 473 | 3300025926 | Ga0207659_10196607 | Ga0207659_101966072 | 338 |
| 474 | 3300025926 | Ga0207659_10360117 | Ga0207659_103601172 | 338 |
| 475 | 3300025927 | Ga0207687_10000594 | Ga0207687_100005945 | 338 |
| 476 | 3300025927 | Ga0207687_10004640 | Ga0207687_100046405 | 338 |
| 477 | 3300025931 | Ga0207644_10050528 | Ga0207644_100505282 | 338 |
| 478 | 3300025931 | Ga0207644_10255527 | Ga0207644_102555271 | 338 |
| 479 | 3300025932 | Ga0207690_10040310 | Ga0207690_100403104 | 338 |
| 480 | 3300025933 | Ga0207706_10017373 | Ga0207706_100173734 | 338 |
| 481 | 3300025933 | Ga0207706_10020804 | Ga0207706_100208045 | 338 |
| 482 | 3300025933 | Ga0207706_10101089 | Ga0207706_101010893 | 338 |
| 483 | 3300025934 | Ga0207686_10003068 | Ga0207686_100030689 | 338 |
| 484 | 3300025934 | Ga0207686_10003183 | Ga0207686_100031837 | 338 |
| 485 | 3300025934 | Ga0207686_10071015 | Ga0207686_100710153 | 338 |
| 486 | 3300025934 | Ga0207686_10102079 | Ga0207686_101020793 | 338 |
| 487 | 3300025935 | Ga0207709_10001097 | Ga0207709_100010971 | 338 |
| 488 | 3300025936 | Ga0207670_10133717 | Ga0207670_101337172 | 338 |
| 489 | 3300025936 | Ga0207670_10148498 | Ga0207670_101484981 | 338 |
| 490 | 3300025937 | Ga0207669_10000196 | Ga0207669_1000019613 | 338 |
| 491 | 3300025937 | Ga0207669_10000449 | Ga0207669_100004493 | 338 |
| 492 | 3300025937 | Ga0207669_10107688 | Ga0207669_101076883 | 338 |
| 493 | 3300025938 | Ga0207704_10000682 | Ga0207704_1000068215 | 338 |
| 494 | 3300025938 | Ga0207704_10001017 | Ga0207704_1000101712 | 338 |
| 495 | 3300025938 | Ga0207704_10182330 | Ga0207704_101823302 | 338 |
| 496 | 3300025939 | Ga0207665_10010565 | Ga0207665_100105654 | 338 |
| 497 | 3300025939 | Ga0207665_10011685 | Ga0207665_100116853 | 338 |
| 498 | 3300025939 | Ga0207665_10021889 | Ga0207665_100218894 | 338 |
| 499 | 3300025939 | Ga0207665_10115987 | Ga0207665_101159871 | 338 |
| 500 | 3300025940 | Ga0207691_10054663 | Ga0207691_100546634 | 338 |
| 501 | 3300025941 | Ga0207711_10000069 | Ga0207711_10000069103 | 338 |
| 502 | 3300025941 | Ga0207711_10116782 | Ga0207711_101167821 | 338 |
| 503 | 3300025941 | Ga0207711_10133170 | Ga0207711_101331702 | 338 |
| 504 | 3300025942 | Ga0207689_10009333 | Ga0207689_100093337 | 338 |
| 505 | 3300025942 | Ga0207689_10053029 | Ga0207689_100530293 | 338 |
| 506 | 3300025942 | Ga0207689_10145791 | Ga0207689_101457913 | 338 |
| 507 | 3300025961 | Ga0207712_10122198 | Ga0207712_101221982 | 338 |
| 508 | 3300025972 | Ga0207668_10000708 | Ga0207668_100007083 | 338 |
| 509 | 3300025972 | Ga0207668_10001896 | Ga0207668_100018963 | 338 |
| 510 | 3300025972 | Ga0207668_10006210 | Ga0207668_100062101 | 338 |
| 511 | 3300025972 | Ga0207668_10147467 | Ga0207668_101474672 | 338 |
| 512 | 3300025981 | Ga0207640_10033664 | Ga0207640_100336644 | 338 |
| 513 | 3300025986 | Ga0207658_10002764 | Ga0207658_1000276412 | 338 |
| 514 | 3300025986 | Ga0207658_10040590 | Ga0207658_100405902 | 338 |
| 515 | 3300025986 | Ga0207658_10072092 | Ga0207658_100720921 | 338 |
| 516 | 3300025986 | Ga0207658_10096480 | Ga0207658_100964803 | 338 |
| 517 | 3300025986 | Ga0207658_10186301 | Ga0207658_101863012 | 338 |
| 518 | 3300026023 | Ga0207677_10023893 | Ga0207677_100238932 | 338 |
| 519 | 3300026023 | Ga0207677_10033108 | Ga0207677_100331082 | 338 |
| 520 | 3300026023 | Ga0207677_10044193 | Ga0207677_100441932 | 338 |
| 521 | 3300026023 | Ga0207677_10058521 | Ga0207677_100585213 | 338 |
| 522 | 3300026035 | Ga0207703_10002614 | Ga0207703_100026145 | 338 |
| 523 | 3300026035 | Ga0207703_10043847 | Ga0207703_100438473 | 338 |
| 524 | 3300026041 | Ga0207639_10001979 | Ga0207639_100019791 | 338 |
| 525 | 3300026041 | Ga0207639_10185604 | Ga0207639_101856043 | 338 |
| 526 | 3300026067 | Ga0207678_10016962 | Ga0207678_100169625 | 338 |
| 527 | 3300026067 | Ga0207678_10018104 | Ga0207678_100181044 | 338 |
| 528 | 3300026067 | Ga0207678_10026917 | Ga0207678_100269171 | 338 |
| 529 | 3300026067 | Ga0207678_10107147 | Ga0207678_101071472 | 338 |
| 530 | 3300026067 | Ga0207678_10220010 | Ga0207678_102200102 | 338 |
| 531 | 3300026075 | Ga0207708_10000667 | Ga0207708_1000066710 | 338 |
| 532 | 3300026075 | Ga0207708_10006709 | Ga0207708_100067091 | 338 |
| 533 | 3300026075 | Ga0207708_10014636 | Ga0207708_100146364 | 338 |
| 534 | 3300026078 | Ga0207702_10373177 | Ga0207702_103731772 | 338 |
| 535 | 3300026088 | Ga0207641_10125919 | Ga0207641_101259193 | 338 |
| 536 | 3300026088 | Ga0207641_10160588 | Ga0207641_101605882 | 338 |
| 537 | 3300026089 | Ga0207648_10005568 | Ga0207648_100055681 | 338 |
| 538 | 3300026089 | Ga0207648_10097826 | Ga0207648_100978263 | 338 |
| 539 | 3300026095 | Ga0207676_10055890 | Ga0207676_100558903 | 338 |
| 540 | 3300026118 | Ga0207675_100001148 | Ga0207675_1000011484 | 338 |
| 541 | 3300026118 | Ga0207675_100005071 | Ga0207675_1000050711 | 338 |
| 542 | 3300026118 | Ga0207675_100033465 | Ga0207675_1000334654 | 338 |
| 543 | 3300026118 | Ga0207675_100115440 | Ga0207675_1001154402 | 338 |
| 544 | 3300026121 | Ga0207683_10002279 | Ga0207683_100022797 | 338 |
| 545 | 3300026121 | Ga0207683_10022293 | Ga0207683_100222935 | 338 |
| 546 | 3300026121 | Ga0207683_10037711 | Ga0207683_100377113 | 338 |
| 547 | 3300026121 | Ga0207683_10066532 | Ga0207683_100665322 | 338 |
| 548 | 3300026121 | Ga0207683_10188693 | Ga0207683_101886932 | 338 |
| 549 | 3300026121 | Ga0207683_10229171 | Ga0207683_102291712 | 338 |
| 550 | 3300028379 | Ga0268266_10042481 | Ga0268266_100424814 | 338 |
| 551 | 3300028379 | Ga0268266_10070058 | Ga0268266_100700583 | 338 |
| 552 | 3300028379 | Ga0268266_10168142 | Ga0268266_101681423 | 338 |
| 553 | 3300028379 | Ga0268266_10326929 | Ga0268266_103269292 | 338 |
| 554 | 3300028380 | Ga0268265_10007934 | Ga0268265_100079342 | 338 |
| 555 | 3300028380 | Ga0268265_10036678 | Ga0268265_100366783 | 338 |
| 556 | 3300028381 | Ga0268264_10000053 | Ga0268264_10000053257 | 338 |
| 557 | 3300028381 | Ga0268264_10001281 | Ga0268264_100012814 | 338 |
| 558 | 3300028381 | Ga0268264_10003529 | Ga0268264_1000352913 | 338 |
| 559 | 3300028381 | Ga0268264_10088693 | Ga0268264_100886933 | 338 |
| 560 | 3300028381 | Ga0268264_10135316 | Ga0268264_101353162 | 338 |
| 561 | 3300028381 | Ga0268264_10162542 | Ga0268264_101625422 | 338 |
| 562 | 3300031901 | Ga0307406_10190871 | Ga0307406_101908711 | 338 |
| 563 | 3300031995 | Ga0307409_100035556 | Ga0307409_1000355563 | 338 |
| 564 | 3300032126 | Ga0307415_100339902 | Ga0307415_1003399022 | 338 |
| 565 | 3300035084 | Ga0373928_0010922 | Ga0373928_0010922_369_1385 | 338 |
| 566 | 3300035088 | Ga0373940_0037173 | Ga0373940_0037173_12_1028 | 338 |
| 567 | 3300035114 | Ga0373939_0033116 | Ga0373939_0033116_171_1187 | 338 |
| 568 | 3300039437 | Ga0436365_0307188 | Ga0436365_0307188_103_1119 | 338 |
| 569 | 3300039447 | Ga0436361_0276372 | Ga0436361_0276372_117_1133 | 338 |
| 570 | 3300041452 | Ga0451793_0781259 | Ga0451793_0781259_1808_2824 | 338 |
| 571 | 3300044658 | Ga0466972_0026587 | Ga0466972_0026587_907_1938 | 338 |
| 572 | 3300044658 | Ga0466972_0078209 | Ga0466972_0078209_386_1411 | 338 |
| 573 | 3300044683 | Ga0466965_0006756 | Ga0466965_0006756_3165_4190 | 338 |
| 574 | 3300044683 | Ga0466965_0181528 | Ga0466965_0181528_60_1076 | 338 |
| 575 | 3300044694 | Ga0466963_0040258 | Ga0466963_0040258_1423_2445 | 338 |
| 576 | 3300044706 | Ga0466964_0035409 | Ga0466964_0035409_658_1674 | 338 |
| 577 | 3300044735 | Ga0466968_0007037 | Ga0466968_0007037_1630_2655 | 338 |
| 578 | 3300044842 | Ga0466957_0011701 | Ga0466957_0011701_1938_2963 | 338 |
| 579 | 3300044842 | Ga0466957_0013117 | Ga0466957_0013117_17_1033 | 338 |
| 580 | 3300044901 | Ga0466960_0000043 | Ga0466960_0000043_4233_5264 | 338 |
| 581 | 3300044901 | Ga0466960_0009641 | Ga0466960_0009641_778_1803 | 338 |
| 582 | 3300045049 | Ga0466959_0041991 | Ga0466959_0041991_83_1108 | 338 |
| 583 | 3300045976 | Ga0466967_0044525 | Ga0466967_0044525_401_1426 | 338 |
| 584 | 3300045976 | Ga0466967_0051054 | Ga0466967_0051054_717_1739 | 338 |
| 585 | 3300046454 | Ga0495592_0162033 | Ga0495592_0162033_430_1446 | 338 |
| 586 | 3300046455 | Ga0495603_0052727 | Ga0495603_0052727_1236_2252 | 338 |
| 587 | 3300046459 | Ga0495629_0013452 | Ga0495629_0013452_3360_4376 | 338 |
| 588 | 3300046459 | Ga0495629_0022019 | Ga0495629_0022019_104_1120 | 338 |
| 589 | 3300046459 | Ga0495629_0186995 | Ga0495629_0186995_271_1287 | 338 |
| 590 | 3300046460 | Ga0495638_0000745 | Ga0495638_0000745_14081_15097 | 338 |
| 591 | 3300046460 | Ga0495638_0007521 | Ga0495638_0007521_965_1981 | 338 |
| 592 | 3300046460 | Ga0495638_0096995 | Ga0495638_0096995_81_1097 | 338 |
| 593 | 3300046461 | Ga0495641_0017883 | Ga0495641_0017883_2077_3093 | 338 |
| 594 | 3300046475 | Ga0495639_0031046 | Ga0495639_0031046_275_1291 | 338 |
| 595 | 3300046511 | Ga0495608_0096391 | Ga0495608_0096391_311_1327 | 338 |
| 596 | 3300046517 | Ga0495630_0064839 | Ga0495630_0064839_174_1190 | 338 |
| 597 | 3300046524 | Ga0495648_0001220 | Ga0495648_0001220_21256_22272 | 338 |
| 598 | 3300046533 | Ga0495640_0171835 | Ga0495640_0171835_220_1236 | 338 |
| 599 | 3300046616 | Ga0495668_0056732 | Ga0495668_0056732_496_1512 | 338 |
| 600 | 3300046683 | Ga0495658_0011413 | Ga0495658_0011413_1424_2440 | 338 |
| 601 | 3300046690 | Ga0495624_0070933 | Ga0495624_0070933_452_1468 | 338 |
| 602 | 3300047319 | Ga0495674_0021560 | Ga0495674_0021560_1812_2828 | 338 |
| 603 | 3300047319 | Ga0495674_0047098 | Ga0495674_0047098_284_1300 | 338 |
| 604 | 3300047320 | Ga0495672_0018774 | Ga0495672_0018774_1706_2722 | 338 |
| 605 | 3300047320 | Ga0495672_0038799 | Ga0495672_0038799_525_1541 | 338 |
| 606 | 3300047472 | Ga0495686_0025392 | Ga0495686_0025392_2616_3632 | 338 |
| 607 | 3300047673 | Ga0495593_0013924 | Ga0495593_0013924_106_1122 | 338 |
| 608 | 3300047673 | Ga0495593_0014462 | Ga0495593_0014462_312_1328 | 338 |
| 609 | 3300047673 | Ga0495593_0045883 | Ga0495593_0045883_351_1367 | 338 |
| 610 | 3300048903 | Ga0496100_0000142 | Ga0496100_0000142_38557_39573 | 338 |
| 611 | 3300048903 | Ga0496100_0016873 | Ga0496100_0016873_3061_4077 | 338 |
| 612 | 3300048903 | Ga0496100_0054467 | Ga0496100_0054467_495_1511 | 338 |
| 613 | 3300048904 | Ga0496101_0000011 | Ga0496101_0000011_139075_140091 | 338 |
| 614 | 3300048904 | Ga0496101_0002609 | Ga0496101_0002609_1516_2532 | 338 |
| 615 | 3300048904 | Ga0496101_0008063 | Ga0496101_0008063_5650_6666 | 338 |
| 616 | 3300048904 | Ga0496101_0080061 | Ga0496101_0080061_11_1027 | 338 |
| 617 | 3300048905 | Ga0496102_0000012 | Ga0496102_0000012_163404_164420 | 338 |
| 618 | 3300048905 | Ga0496102_0000070 | Ga0496102_0000070_11423_12439 | 338 |
| 619 | 3300048905 | Ga0496102_0001632 | Ga0496102_0001632_9347_10363 | 338 |
| 620 | 3300048905 | Ga0496102_0329400 | Ga0496102_0329400_313_1329 | 338 |
| 621 | 3300048905 | Ga0496102_0357196 | Ga0496102_0357196_289_1305 | 338 |
| 622 | 3300048906 | Ga0496103_0000005 | Ga0496103_0000005_151043_152059 | 338 |
| 623 | 3300048906 | Ga0496103_0000342 | Ga0496103_0000342_33497_34513 | 338 |
| 624 | 3300048906 | Ga0496103_0006721 | Ga0496103_0006721_5650_6666 | 338 |
| 625 | 3300048906 | Ga0496103_0014620 | Ga0496103_0014620_744_1760 | 338 |
| 626 | 3300048906 | Ga0496103_0122412 | Ga0496103_0122412_586_1602 | 338 |
| 627 | 3300048907 | Ga0496104_0250402 | Ga0496104_0250402_310_1326 | 338 |
| 628 | 3300048909 | Ga0496106_0001251 | Ga0496106_0001251_4628_5644 | 338 |
| 629 | 3300048909 | Ga0496106_0005715 | Ga0496106_0005715_7480_8496 | 338 |
| 630 | 3300048909 | Ga0496106_0015675 | Ga0496106_0015675_4294_5310 | 338 |
| 631 | 3300048910 | Ga0496107_0001038 | Ga0496107_0001038_9007_10023 | 338 |
| 632 | 3300048910 | Ga0496107_0008820 | Ga0496107_0008820_5239_6255 | 338 |
| 633 | 3300048910 | Ga0496107_0009361 | Ga0496107_0009361_354_1370 | 338 |
| 634 | 3300048910 | Ga0496107_0082594 | Ga0496107_0082594_54_1070 | 338 |
| 635 | 3300048910 | Ga0496107_0094223 | Ga0496107_0094223_660_1676 | 338 |
| 636 | 3300048911 | Ga0496108_0006199 | Ga0496108_0006199_6222_7238 | 338 |
| 637 | 3300048912 | Ga0496109_0031454 | Ga0496109_0031454_3149_4165 | 338 |
| 638 | 3300048912 | Ga0496109_0164439 | Ga0496109_0164439_69_1085 | 338 |
| 639 | 3300048913 | Ga0496110_0033275 | Ga0496110_0033275_598_1614 | 338 |
| 640 | 3300048915 | Ga0496112_0031776 | Ga0496112_0031776_3940_4956 | 338 |
| 641 | 3300048917 | Ga0496114_0000766 | Ga0496114_0000766_21265_22281 | 338 |
| 642 | 3300048917 | Ga0496114_0009779 | Ga0496114_0009779_5510_6526 | 338 |
| 643 | 3300048917 | Ga0496114_0035403 | Ga0496114_0035403_222_1238 | 338 |
| 644 | 3300048917 | Ga0496114_0218007 | Ga0496114_0218007_464_1480 | 338 |
| 645 | 3300048917 | Ga0496114_0250321 | Ga0496114_0250321_142_1158 | 338 |
| 646 | 3300048918 | Ga0496115_0001326 | Ga0496115_0001326_16230_17246 | 338 |
| 647 | 3300048918 | Ga0496115_0002565 | Ga0496115_0002565_533_1549 | 338 |
| 648 | 3300048918 | Ga0496115_0113667 | Ga0496115_0113667_300_1316 | 338 |
| 649 | 3300048919 | Ga0496116_0000050 | Ga0496116_0000050_159625_160641 | 338 |
| 650 | 3300048920 | Ga0496117_0000042 | Ga0496117_0000042_151051_152067 | 338 |
| 651 | 3300048920 | Ga0496117_0000233 | Ga0496117_0000233_70690_71706 | 338 |
| 652 | 3300048921 | Ga0496118_0000037 | Ga0496118_0000037_151051_152067 | 338 |
| 653 | 3300048921 | Ga0496118_0001816 | Ga0496118_0001816_12103_13119 | 338 |
| 654 | 3300048922 | Ga0496119_0000486 | Ga0496119_0000486_1786_2802 | 338 |
| 655 | 3300048922 | Ga0496119_0004931 | Ga0496119_0004931_10742_11758 | 338 |
| 656 | 3300048922 | Ga0496119_0122295 | Ga0496119_0122295_262_1278 | 338 |
| 657 | 3300048923 | Ga0496120_0000121 | Ga0496120_0000121_128811_129827 | 338 |
| 658 | 3300048923 | Ga0496120_0006473 | Ga0496120_0006473_4306_5322 | 338 |
| 659 | 3300048924 | Ga0496121_0001091 | Ga0496121_0001091_21826_22842 | 338 |
| 660 | 3300048928 | Ga0496125_0042820 | Ga0496125_0042820_2458_3474 | 338 |
| 661 | 3300048929 | Ga0496126_0000236 | Ga0496126_0000236_115058_116074 | 338 |
| 662 | 3300048929 | Ga0496126_0029046 | Ga0496126_0029046_3919_4935 | 338 |
| 663 | 3300048929 | Ga0496126_0073036 | Ga0496126_0073036_676_1692 | 338 |
| 664 | 3300049569 | Ga0501032_0031446 | Ga0501032_0031446_1585_2610 | 338 |
| 665 | 3300049573 | Ga0501037_0040445 | Ga0501037_0040445_822_1847 | 338 |
| 666 | 3300049575 | Ga0501039_0000835 | Ga0501039_0000835_1419_2444 | 338 |
| 667 | 3300049579 | Ga0501043_0016855 | Ga0501043_0016855_1598_2623 | 338 |
| 668 | 3300049586 | Ga0501070_0008673 | Ga0501070_0008673_1424_2449 | 338 |
| 669 | 3300049823 | Ga0501044_0005313 | Ga0501044_0005313_11704_12729 | 338 |
| 670 | 3300049823 | Ga0501044_0225994 | Ga0501044_0225994_311_1327 | 338 |
| 671 | 3300050489 | nmdc:mga03683_72169_c1 | nmdc:mga03683_72169_c1_31_1047 | 338 |
| 672 | 3300050491 | nmdc:mga00v17_44291_c1 | nmdc:mga00v17_44291_c1_59_1075 | 338 |
| 673 | 3300050491 | nmdc:mga00v17_9564_c1 | nmdc:mga00v17_9564_c1_3416_4432 | 338 |
| 674 | 3300050492 | nmdc:mga0yw44_180369_c1 | nmdc:mga0yw44_180369_c1_50_1066 | 338 |
| 675 | 3300050494 | nmdc:mga06z11_115445_c1 | nmdc:mga06z11_115445_c1_436_1452 | 338 |
| 676 | 3300050496 | nmdc:mga07m45_23217_c1 | nmdc:mga07m45_23217_c1_405_1421 | 338 |
| 677 | 3300050516 | nmdc:mga0sz30_1591_c2 | nmdc:mga0sz30_1591_c2_3790_4806 | 338 |
| 678 | 3300050516 | nmdc:mga0sz30_29044_c1 | nmdc:mga0sz30_29044_c1_341_1357 | 338 |
| 679 | 3300050516 | nmdc:mga0sz30_37734_c1 | nmdc:mga0sz30_37734_c1_471_1487 | 338 |
| 680 | 3300053080 | Ga0500635_0020872 | Ga0500635_0020872_337_1353 | 338 |
| 681 | 3300053085 | Ga0495619_0023894 | Ga0495619_0023894_98_1114 | 338 |
| 682 | 3300053087 | Ga0500643_002806 | Ga0500643_002806_7369_8385 | 338 |
| 683 | 3300053087 | Ga0500643_008952 | Ga0500643_008952_2349_3365 | 338 |
| 684 | 3300053104 | Ga0500556_0006057 | Ga0500556_0006057_354_1370 | 338 |
| 685 | 3300053131 | Ga0500652_013657 | Ga0500652_013657_249_1265 | 338 |
| 686 | 3300053134 | Ga0500658_0037654 | Ga0500658_0037654_116_1132 | 338 |
| 687 | 3300053142 | Ga0500577_0051227 | Ga0500577_0051227_273_1289 | 338 |
| 688 | 3300053158 | Ga0500627_0052924 | Ga0500627_0052924_666_1682 | 338 |
| 689 | 3300053730 | Ga0500645_000017 | Ga0500645_000017_85477_86493 | 338 |
| 690 | 3300053730 | Ga0500645_000188 | Ga0500645_000188_12998_14014 | 338 |
| 691 | 3300053730 | Ga0500645_001793 | Ga0500645_001793_203_1219 | 338 |
| 692 | 3300053730 | Ga0500645_025452 | Ga0500645_025452_530_1546 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o4t-assembly1.cif.gz_A | structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) | 0.994 | 3 | 32 |
| 4j0f-assembly1.cif.gz_A | crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p212121 space group | 0.9767 | 3 | 33 |
| 3ado-assembly1.cif.gz_A | crystal structure of the rabbit l-gulonate 3-dehydrogenase | 0.9556 | 3 | 33 |
| 4oqy-assembly1.cif.gz_A | streptomyces sp. gf3546 imine reductase | 0.9552 | 3 | 32 |
| 8jyt-assembly1.cif.gz_A | ancestral imine reducatase n560 | 0.9519 | 3 | 32 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4CWB6_396_583_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9813 | 3 | 33 | 3.40.50.720 |
| af_K8F7V7_1826_1944_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9732 | 3 | 33 | 3.50.50.60 |
| af_O06538_2_320_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9683 | 2 | 320 | 3.50.50.60 |
| af_Q4DB76_342_532_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9546 | 3 | 33 | 3.40.50.720 |
| 2vq3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9545 | 3 | 32 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B1KY07-F1-model_v4 | deleted | 0.981 | 1 | 101 |
|
| AF-A0A1T3VRY1-F1-model_v4 | Monooxygenase | 0.9797 | 24 | 338 |
GO:0004497
GO:0071949 |
| AF-A0A4R2HY09-F1-model_v4 | Flavin-dependent dehydrogenase | 0.9767 | 1 | 336 |
|
| AF-A0A7I7KVW0-F1-model_v4 | Oxidoreductase | 0.9762 | 2 | 338 |
GO:0071949
|
| AF-A0A1A2TMA6-F1-model_v4 | Monooxygenase | 0.9741 | 2 | 338 |
GO:0004497
GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar