F475583

General Info

Members Datasets Scaffolds Average Seq Length
692 313 676 332

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10229171|Ga0207683_102291712
Length 360
Sequence VIDLLVGGGGPAGLATALYAAQAGLEVVVVERRPGVLDKACGEGMMPHTIAHLDRLGVAVTGRPLRGITYLDADRRVDAPFRAGVGRGVRRTVLHAAMSDAVRSAGVKFVQGDVGELTQDAESVRAGQFRARYLAAADGLHSPIRKAMGLAKPHSGPRRWGIRRHIQVAPWTDSVEVHWASGAEAYVTPVADDCVGIAILSSGRGGFDCHLDEFPELRDRASGHAHGQDRAAGPLWQGARGRAAGRVLLVGDAAGYIDALTGEGMGLAFGAAEALVNCVIRERPGDYDRQWRRLTRRYRALTAGLVRAAAHPAIRSHIVPAAAALPRVFGVAAQAIRIAEVDIDRFDGRHFCGGRRVEAH

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
8 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
9 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
10 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
11 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
12 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
13 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
14 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
186 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
295 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
304 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
305 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
308 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
309 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.4
Nodule 0.14
Rhizoplane 7.66
Rhizosphere 77.31
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1002207 3300002074 Bacteria 2182
2 JGI24744J21845_10006091 3300002077 Bacteria 2501
3 JGI24742J22300_10007280 3300002244 Bacteria 1825
4 Ga0055540_1003459 3300003792 Bacteria 7627
5 Ga0055540_1004892 3300003792 Bacteria 5855
6 Ga0055540_1007819 3300003792 Bacteria 3959
7 Ga0070690_100009368 3300005330 Bacteria 5671
8 Ga0070690_100067610 3300005330 Bacteria 2315
9 Ga0070677_10045961 3300005333 Bacteria 1744
10 Ga0068869_100014804 3300005334 Bacteria 5217
11 Ga0070666_10038481 3300005335 Bacteria 3183
12 Ga0070666_10050045 3300005335 Bacteria 2810
13 Ga0070680_100196710 3300005336 Bacteria 1700
14 Ga0070682_100018767 3300005337 Bacteria 4049
15 Ga0070682_100103958 3300005337 Bacteria 1880
16 Ga0068868_100001534 3300005338 Bacteria 15815
17 Ga0068868_100080455 3300005338 Bacteria 2611
18 Ga0070689_100021792 3300005340 Bacteria 4775
19 Ga0070691_10008853 3300005341 Bacteria 4608
20 Ga0070691_10024492 3300005341 Bacteria 2805
21 Ga0070691_10105690 3300005341 Bacteria 1403
22 Ga0070692_10035561 3300005345 Bacteria 2523
23 Ga0070668_100002331 3300005347 Bacteria 13963
24 Ga0070668_100003591 3300005347 Bacteria 11440
25 Ga0070668_100047349 3300005347 Bacteria 3306
26 Ga0070675_100038759 3300005354 Bacteria 3886
27 Ga0070675_100082654 3300005354 Bacteria 2680
28 Ga0070671_100229625 3300005355 Bacteria 1575
29 Ga0070671_100280683 3300005355 Bacteria 1417
30 Ga0070674_100001422 3300005356 Bacteria 12714
31 Ga0070674_100005222 3300005356 Bacteria 7472
32 Ga0070674_100026065 3300005356 Bacteria 3814
33 Ga0070688_100006042 3300005365 Bacteria 6428
34 Ga0070688_100006500 3300005365 Bacteria 6250
35 Ga0070688_100070618 3300005365 Bacteria 2233
36 Ga0070659_100033533 3300005366 Bacteria 3988
37 Ga0070659_100260570 3300005366 Bacteria 1438
38 Ga0070667_100000075 3300005367 Bacteria 120953
39 Ga0070667_100003168 3300005367 Bacteria 14101
40 Ga0070667_100004972 3300005367 Bacteria 11138
41 Ga0070667_100046698 3300005367 Bacteria 3644
42 Ga0070709_10031089 3300005434 Bacteria 3209
43 Ga0070709_10107613 3300005434 Bacteria 1869
44 Ga0070709_10151708 3300005434 Bacteria 1602
45 Ga0070710_10001392 3300005437 Bacteria 11417
46 Ga0070710_10001944 3300005437 Bacteria 9779
47 Ga0070710_10031660 3300005437 Bacteria 2858
48 Ga0070701_10000435 3300005438 Bacteria 14256
49 Ga0070701_10006493 3300005438 Bacteria 4927
50 Ga0070701_10081819 3300005438 Bacteria 1750
51 Ga0070711_100001721 3300005439 Bacteria 12138
52 Ga0070711_100003570 3300005439 Bacteria 9070
53 Ga0070711_100052850 3300005439 Bacteria 2797
54 Ga0070705_100011946 3300005440 Bacteria 4398
55 Ga0070705_100037296 3300005440 Bacteria 2740
56 Ga0070700_100003106 3300005441 Bacteria 8516
57 Ga0070700_100005245 3300005441 Bacteria 6853
58 Ga0070700_100033608 3300005441 Bacteria 3090
59 Ga0070694_100004880 3300005444 Bacteria 8078
60 Ga0070694_100088743 3300005444 Bacteria 2165
61 Ga0070694_100291737 3300005444 Bacteria 1247
62 Ga0070663_100061262 3300005455 Bacteria 2709
63 Ga0070663_100117785 3300005455 Bacteria 2003
64 Ga0070663_100197247 3300005455 Bacteria 1569
65 Ga0070663_100252258 3300005455 Bacteria 1397
66 Ga0070678_100001428 3300005456 Bacteria 12730
67 Ga0070678_100002759 3300005456 Bacteria 9710
68 Ga0070678_100015071 3300005456 Bacteria 4900
69 Ga0070678_100154238 3300005456 Bacteria 1854
70 Ga0070678_100407146 3300005456 Bacteria 1183
71 Ga0070662_100026108 3300005457 Bacteria 4042
72 Ga0068867_100005802 3300005459 Bacteria 8761
73 Ga0068867_100026418 3300005459 Bacteria 4169
74 Ga0070685_10079849 3300005466 Bacteria 1958
75 Ga0070685_10106165 3300005466 Bacteria 1723
76 Ga0070685_10137050 3300005466 Bacteria 1537
77 Ga0070679_100309127 3300005530 Bacteria 1531
78 Ga0068853_100010078 3300005539 Bacteria 7635
79 Ga0068853_100018982 3300005539 Bacteria 5696
80 Ga0068853_100142578 3300005539 Bacteria 2152
81 Ga0068853_100212282 3300005539 Bacteria 1764
82 Ga0070672_100225660 3300005543 Bacteria 1572
83 Ga0070686_100048494 3300005544 Bacteria 2691
84 Ga0070695_100086844 3300005545 Bacteria 2080
85 Ga0070696_100003298 3300005546 Bacteria 10774
86 Ga0070696_100057020 3300005546 Bacteria 2726
87 Ga0070696_100060580 3300005546 Bacteria 2647
88 Ga0070696_100171427 3300005546 Bacteria 1604
89 Ga0070693_100005306 3300005547 Bacteria 6177
90 Ga0070693_100025397 3300005547 Bacteria 3188
91 Ga0070693_100072408 3300005547 Bacteria 2033
92 Ga0070693_100097755 3300005547 Bacteria 1782
93 Ga0070665_100001679 3300005548 Bacteria 25511
94 Ga0070665_100030874 3300005548 Bacteria 5393
95 Ga0070665_100058267 3300005548 Bacteria 3872
96 Ga0070665_100162347 3300005548 Bacteria 2236
97 Ga0070704_100000313 3300005549 Bacteria 21721
98 Ga0070704_100001436 3300005549 Bacteria 12730
99 Ga0070704_100018644 3300005549 Bacteria 4443
100 Ga0070704_100028516 3300005549 Bacteria 3715
101 Ga0070704_100238338 3300005549 Bacteria 1487
102 Ga0068855_100281144 3300005563 Bacteria 1848
103 Ga0068854_100001484 3300005578 Bacteria 14214
104 Ga0068854_100002812 3300005578 Bacteria 10820
105 Ga0068854_100039896 3300005578 Bacteria 3310
106 Ga0068854_100068024 3300005578 Bacteria 2597
107 Ga0070702_100011985 3300005615 Bacteria 4329
108 Ga0070702_100039656 3300005615 Bacteria 2629
109 Ga0070702_100045685 3300005615 Bacteria 2479
110 Ga0068859_100000077 3300005617 Bacteria 91522
111 Ga0068859_100004026 3300005617 Bacteria 14985
112 Ga0068859_100005680 3300005617 Bacteria 12697
113 Ga0068859_100042188 3300005617 Bacteria 4582
114 Ga0068866_10000564 3300005718 Bacteria 16839
115 Ga0068866_10008170 3300005718 Bacteria 4399
116 Ga0068866_10017449 3300005718 Bacteria 3228
117 Ga0068866_10060364 3300005718 Bacteria 1965
118 Ga0068861_100001049 3300005719 Bacteria 16983
119 Ga0068861_100001894 3300005719 Bacteria 13478
120 Ga0068861_100310440 3300005719 Bacteria 1370
121 Ga0068851_10057998 3300005834 Bacteria 1978
122 Ga0068863_100103073 3300005841 Bacteria 2713
123 Ga0068863_100382190 3300005841 Bacteria 1375
124 Ga0068858_100005232 3300005842 Bacteria 12714
125 Ga0068858_100010804 3300005842 Bacteria 8631
126 Ga0068858_100014269 3300005842 Bacteria 7491
127 Ga0068858_100014801 3300005842 Bacteria 7339
128 Ga0068858_100019169 3300005842 Bacteria 6400
129 Ga0068860_100000025 3300005843 Bacteria 271553
130 Ga0068860_100001896 3300005843 Bacteria 22196
131 Ga0068860_100005582 3300005843 Bacteria 12714
132 Ga0068860_100064628 3300005843 Bacteria 3475
133 Ga0068860_100094031 3300005843 Bacteria 2857
134 Ga0068860_100277587 3300005843 Bacteria 1637
135 Ga0068860_100316990 3300005843 Bacteria 1530
136 Ga0068862_100003302 3300005844 Bacteria 13953
137 Ga0068862_100004339 3300005844 Bacteria 12004
138 Ga0068862_100144824 3300005844 Bacteria 2111
139 Ga0068862_100198958 3300005844 Bacteria 1806
140 Ga0068862_100541180 3300005844 Bacteria 1111
141 Ga0075365_10002099 3300006038 Bacteria 9537
142 Ga0075365_10002870 3300006038 Bacteria 8667
143 Ga0075365_10013149 3300006038 Bacteria 4937
144 Ga0075365_10058194 3300006038 Bacteria 2573
145 Ga0075365_10074319 3300006038 Bacteria 2292
146 Ga0075365_10084118 3300006038 Bacteria 2159
147 Ga0075368_10059354 3300006042 Bacteria 1530
148 Ga0075363_100000682 3300006048 Bacteria 11425
149 Ga0075363_100001854 3300006048 Bacteria 8325
150 Ga0075364_10004603 3300006051 Bacteria 7947
151 Ga0075364_10007585 3300006051 Bacteria 6451
152 Ga0075364_10024577 3300006051 Bacteria 3827
153 Ga0075364_10036246 3300006051 Bacteria 3188
154 Ga0075364_10119395 3300006051 Bacteria 1764
155 Ga0075364_10119522 3300006051 Bacteria 1763
156 Ga0070715_10000197 3300006163 Bacteria 14144
157 Ga0070715_10001550 3300006163 Bacteria 6734
158 Ga0070715_10007835 3300006163 Bacteria 3693
159 Ga0070716_100006523 3300006173 Bacteria 5704
160 Ga0070716_100008515 3300006173 Bacteria 5091
161 Ga0070716_100013650 3300006173 Bacteria 4144
162 Ga0070716_100089491 3300006173 Bacteria 1859
163 Ga0070712_100001623 3300006175 Bacteria 13768
164 Ga0070712_100013747 3300006175 Bacteria 5178
165 Ga0070712_100047760 3300006175 Bacteria 2964
166 Ga0075362_10059104 3300006177 Bacteria 1731
167 Ga0075367_10021404 3300006178 Bacteria 3613
168 Ga0075367_10024781 3300006178 Bacteria 3385
169 Ga0075369_10000432 3300006186 Bacteria 12737
170 Ga0075369_10003792 3300006186 Bacteria 5534
171 Ga0075369_10015734 3300006186 Bacteria 3041
172 Ga0075369_10019582 3300006186 Bacteria 2764
173 Ga0075369_10035586 3300006186 Bacteria 2117
174 Ga0075369_10037824 3300006186 Bacteria 2057
175 Ga0075369_10050367 3300006186 Bacteria 1801
176 Ga0075366_10167653 3300006195 Bacteria 1332
177 Ga0097621_100010926 3300006237 Bacteria 6666
178 Ga0097621_100029904 3300006237 Bacteria 4306
179 Ga0097621_100127190 3300006237 Bacteria 2165
180 Ga0075370_10007035 3300006353 Bacteria 5707
181 Ga0075370_10090503 3300006353 Bacteria 1765
182 Ga0068871_100023271 3300006358 Bacteria 4789
183 Ga0075428_100005018 3300006844 Bacteria 14711
184 Ga0075430_100119671 3300006846 Bacteria 2195
185 Ga0075431_100023608 3300006847 Bacteria 6294
186 Ga0068865_100008905 3300006881 Bacteria 6207
187 Ga0068865_100023845 3300006881 Bacteria 4011
188 Ga0068865_100066157 3300006881 Bacteria 2549
189 Ga0068865_100145574 3300006881 Bacteria 1792
190 Ga0068865_100310225 3300006881 Bacteria 1266
191 Ga0097620_100000077 3300006931 Bacteria 91522
192 Ga0097620_100004026 3300006931 Bacteria 14985
193 Ga0097620_100005680 3300006931 Bacteria 12697
194 Ga0097620_100042189 3300006931 Bacteria 4582
195 Ga0097620_100116593 3300006931 Bacteria 2735
196 Ga0105245_10004227 3300009098 Bacteria 12746
197 Ga0105245_10005751 3300009098 Bacteria 10883
198 Ga0105245_10038255 3300009098 Bacteria 4269
199 Ga0105247_10000010 3300009101 Bacteria 302475
200 Ga0105247_10002429 3300009101 Bacteria 12681
201 Ga0105247_10003309 3300009101 Bacteria 10558
202 Ga0105247_10139251 3300009101 Bacteria 1588
203 Ga0114129_10022999 3300009147 Bacteria 8843
204 Ga0105243_10000779 3300009148 Bacteria 30542
205 Ga0105243_10003474 3300009148 Bacteria 12719
206 Ga0105243_10256443 3300009148 Bacteria 1564
207 Ga0105241_10171423 3300009174 Bacteria 1793
208 Ga0105242_10000066 3300009176 Bacteria 73865
209 Ga0105242_10003222 3300009176 Bacteria 12720
210 Ga0105242_10035466 3300009176 Bacteria 4000
211 Ga0105248_10000078 3300009177 Bacteria 111935
212 Ga0105248_10063430 3300009177 Bacteria 4148
213 Ga0105248_10179124 3300009177 Bacteria 2389
214 Ga0105248_10387577 3300009177 Bacteria 1573
215 Ga0105237_10002051 3300009545 Bacteria 25601
216 Ga0105237_10059499 3300009545 Bacteria 3822
217 Ga0105238_10111992 3300009551 Bacteria 2709
218 Ga0105249_10004495 3300009553 Bacteria 12059
219 Ga0105249_10004766 3300009553 Bacteria 11701
220 Ga0105249_10071738 3300009553 Bacteria 3201
221 Ga0105249_10079289 3300009553 Bacteria 3048
222 Ga0105249_10290935 3300009553 Bacteria 1635
223 Ga0105239_10003039 3300010375 Bacteria 20851
224 Ga0105239_10007335 3300010375 Bacteria 12660
225 Ga0105239_10015683 3300010375 Bacteria 8386
226 Ga0105246_10347497 3300011119 Bacteria 1214
227 Ga0157373_10100696 3300013100 Bacteria 2033
228 Ga0157371_10074596 3300013102 Bacteria 2402
229 Ga0157369_10065414 3300013105 Bacteria 3913
230 Ga0157374_10004568 3300013296 Bacteria 11613
231 Ga0157374_10048997 3300013296 Bacteria 3922
232 Ga0157378_10002159 3300013297 Bacteria 17478
233 Ga0157378_10006119 3300013297 Bacteria 10536
234 Ga0157378_10042343 3300013297 Bacteria 4042
235 Ga0163162_10005045 3300013306 Bacteria 12720
236 Ga0163162_10008900 3300013306 Bacteria 9764
237 Ga0163162_10014890 3300013306 Bacteria 7594
238 Ga0163162_10081460 3300013306 Bacteria 3307
239 Ga0163162_10487077 3300013306 Bacteria 1364
240 Ga0157372_10006232 3300013307 Bacteria 12680
241 Ga0157375_10000268 3300013308 Bacteria 47381
242 Ga0157375_10035308 3300013308 Bacteria 4771
243 Ga0157375_10184167 3300013308 Bacteria 2241
244 Ga0163163_10247774 3300014325 Bacteria 1832
245 Ga0157380_10000036 3300014326 Bacteria 81892
246 Ga0157380_10002701 3300014326 Bacteria 12032
247 Ga0157380_10309548 3300014326 Bacteria 1459
248 Ga0157377_10031203 3300014745 Bacteria 2894
249 Ga0157379_10001562 3300014968 Bacteria 18866
250 Ga0157379_10294840 3300014968 Bacteria 1477
251 Ga0157376_10041038 3300014969 Bacteria 3786
252 Ga0157376_10065953 3300014969 Bacteria 3059
253 Ga0163161_10002645 3300017792 Bacteria 12723
254 Ga0163161_10009914 3300017792 Bacteria 6598
255 Ga0163161_10081226 3300017792 Bacteria 2387
256 Ga0213876_10083340 3300021384 Bacteria 1691
257 Ga0209673_1033192 3300025273 Bacteria 1578
258 Ga0209051_1001387 3300025303 Bacteria 20871
259 Ga0209051_1005756 3300025303 Bacteria 7150
260 Ga0209051_1007639 3300025303 Bacteria 5880
261 Ga0209051_1015869 3300025303 Bacteria 3447
262 Ga0207653_10015342 3300025885 Bacteria 2404
263 Ga0207692_10014881 3300025898 Bacteria 3410
264 Ga0207692_10016015 3300025898 Bacteria 3310
265 Ga0207692_10020015 3300025898 Bacteria 3036
266 Ga0207692_10043306 3300025898 Bacteria 2239
267 Ga0207642_10003363 3300025899 Bacteria 5040
268 Ga0207642_10004003 3300025899 Bacteria 4706
269 Ga0207642_10005782 3300025899 Bacteria 4065
270 Ga0207642_10018491 3300025899 Bacteria 2676
271 Ga0207642_10026627 3300025899 Bacteria 2356
272 Ga0207642_10138945 3300025899 Bacteria 1278
273 Ga0207710_10000028 3300025900 Bacteria 304525
274 Ga0207710_10001082 3300025900 Bacteria 14018
275 Ga0207710_10001277 3300025900 Bacteria 12708
276 Ga0207688_10001014 3300025901 Bacteria 14331
277 Ga0207688_10001235 3300025901 Bacteria 13248
278 Ga0207688_10003983 3300025901 Bacteria 8049
279 Ga0207688_10007147 3300025901 Bacteria 6072
280 Ga0207647_10062841 3300025904 Bacteria 2261
281 Ga0207685_10002868 3300025905 Bacteria 4062
282 Ga0207685_10027666 3300025905 Bacteria 1987
283 Ga0207685_10031040 3300025905 Bacteria 1909
284 Ga0207699_10015436 3300025906 Bacteria 3967
285 Ga0207699_10131111 3300025906 Bacteria 1635
286 Ga0207645_10005002 3300025907 Bacteria 9711
287 Ga0207645_10009109 3300025907 Bacteria 6885
288 Ga0207643_10166322 3300025908 Bacteria 1329
289 Ga0207654_10102439 3300025911 Bacteria 1766
290 Ga0207707_10090440 3300025912 Bacteria 2675
291 Ga0207695_10260924 3300025913 Bacteria 1630
292 Ga0207671_10004398 3300025914 Bacteria 13507
293 Ga0207693_10000224 3300025915 Bacteria 51559
294 Ga0207693_10003919 3300025915 Bacteria 12672
295 Ga0207693_10007684 3300025915 Bacteria 8853
296 Ga0207693_10008115 3300025915 Bacteria 8609
297 Ga0207693_10010959 3300025915 Bacteria 7346
298 Ga0207693_10110336 3300025915 Bacteria 2157
299 Ga0207663_10007980 3300025916 Bacteria 5521
300 Ga0207663_10030182 3300025916 Bacteria 3194
301 Ga0207663_10059942 3300025916 Bacteria 2410
302 Ga0207663_10265891 3300025916 Bacteria 1268
303 Ga0207660_10097492 3300025917 Bacteria 2191
304 Ga0207662_10053195 3300025918 Bacteria 2411
305 Ga0207662_10100205 3300025918 Bacteria 1794
306 Ga0207657_10017934 3300025919 Bacteria 6773
307 Ga0207657_10018386 3300025919 Bacteria 6673
308 Ga0207681_10014692 3300025923 Bacteria 4874
309 Ga0207681_10018021 3300025923 Bacteria 4442
310 Ga0207659_10196607 3300025926 Unclassified 1608
311 Ga0207659_10360117 3300025926 Bacteria 1209
312 Ga0207687_10000594 3300025927 Bacteria 24499
313 Ga0207687_10004640 3300025927 Bacteria 9143
314 Ga0207687_10008487 3300025927 Bacteria 6716
315 Ga0207664_10085978 3300025929 Bacteria 2568
316 Ga0207644_10050528 3300025931 Unclassified 2981
317 Ga0207644_10255527 3300025931 Bacteria 1399
318 Ga0207690_10040310 3300025932 Bacteria 3052
319 Ga0207706_10000288 3300025933 Bacteria 54869
320 Ga0207706_10017373 3300025933 Bacteria 6480
321 Ga0207706_10020804 3300025933 Bacteria 5893
322 Ga0207706_10101089 3300025933 Bacteria 2536
323 Ga0207686_10003068 3300025934 Bacteria 8987
324 Ga0207686_10003183 3300025934 Bacteria 8831
325 Ga0207686_10008741 3300025934 Bacteria 5470
326 Ga0207686_10071015 3300025934 Bacteria 2239
327 Ga0207686_10102079 3300025934 Bacteria 1917
328 Ga0207709_10001097 3300025935 Bacteria 19856
329 Ga0207709_10018729 3300025935 Bacteria 3882
330 Ga0207709_10072913 3300025935 Bacteria 2186
331 Ga0207670_10133717 3300025936 Bacteria 1821
332 Ga0207670_10148498 3300025936 Bacteria 1736
333 Ga0207669_10000196 3300025937 Bacteria 27615
334 Ga0207669_10000449 3300025937 Bacteria 17919
335 Ga0207669_10010158 3300025937 Bacteria 4520
336 Ga0207669_10107688 3300025937 Bacteria 1859
337 Ga0207704_10000682 3300025938 Bacteria 15052
338 Ga0207704_10001017 3300025938 Bacteria 12443
339 Ga0207704_10166759 3300025938 Bacteria 1574
340 Ga0207704_10182330 3300025938 Bacteria 1518
341 Ga0207665_10008988 3300025939 Bacteria 6557
342 Ga0207665_10010565 3300025939 Bacteria 6064
343 Ga0207665_10011685 3300025939 Bacteria 5770
344 Ga0207665_10021889 3300025939 Bacteria 4204
345 Ga0207665_10115987 3300025939 Bacteria 1887
346 Ga0207691_10054663 3300025940 Bacteria 3642
347 Ga0207691_10126096 3300025940 Bacteria 2265
348 Ga0207711_10000069 3300025941 Bacteria 115038
349 Ga0207711_10116782 3300025941 Bacteria 2379
350 Ga0207711_10133170 3300025941 Bacteria 2230
351 Ga0207689_10009333 3300025942 Bacteria 8477
352 Ga0207689_10053029 3300025942 Bacteria 3341
353 Ga0207689_10145791 3300025942 Bacteria 1950
354 Ga0207667_10238478 3300025949 Bacteria 1861
355 Ga0207712_10026058 3300025961 Bacteria 3892
356 Ga0207712_10122198 3300025961 Bacteria 1972
357 Ga0207668_10000708 3300025972 Bacteria 20382
358 Ga0207668_10001896 3300025972 Bacteria 12250
359 Ga0207668_10006210 3300025972 Bacteria 7054
360 Ga0207668_10104147 3300025972 Bacteria 2114
361 Ga0207668_10147467 3300025972 Bacteria 1817
362 Ga0207640_10033664 3300025981 Bacteria 3191
363 Ga0207640_10371038 3300025981 Bacteria 1156
364 Ga0207658_10002764 3300025986 Bacteria 12638
365 Ga0207658_10040590 3300025986 Bacteria 3365
366 Ga0207658_10072092 3300025986 Bacteria 2617
367 Ga0207658_10096480 3300025986 Bacteria 2306
368 Ga0207658_10186301 3300025986 Bacteria 1722
369 Ga0207658_10200802 3300025986 Bacteria 1664
370 Ga0207677_10023893 3300026023 Bacteria 3785
371 Ga0207677_10033108 3300026023 Bacteria 3330
372 Ga0207677_10044193 3300026023 Bacteria 2966
373 Ga0207677_10058521 3300026023 Bacteria 2654
374 Ga0207677_10125461 3300026023 Bacteria 1939
375 Ga0207703_10002614 3300026035 Bacteria 15533
376 Ga0207703_10007155 3300026035 Bacteria 8876
377 Ga0207703_10043847 3300026035 Bacteria 3592
378 Ga0207639_10001979 3300026041 Bacteria 13781
379 Ga0207639_10049175 3300026041 Bacteria 3196
380 Ga0207639_10185604 3300026041 Bacteria 1773
381 Ga0207678_10016962 3300026067 Bacteria 6395
382 Ga0207678_10018104 3300026067 Bacteria 6187
383 Ga0207678_10026917 3300026067 Bacteria 5016
384 Ga0207678_10107147 3300026067 Bacteria 2384
385 Ga0207678_10114233 3300026067 Bacteria 2304
386 Ga0207678_10220010 3300026067 Bacteria 1625
387 Ga0207708_10000667 3300026075 Bacteria 26347
388 Ga0207708_10003048 3300026075 Bacteria 12338
389 Ga0207708_10006709 3300026075 Bacteria 8514
390 Ga0207708_10014636 3300026075 Bacteria 5871
391 Ga0207708_10125334 3300026075 Bacteria 2004
392 Ga0207702_10373177 3300026078 Bacteria 1370
393 Ga0207641_10125919 3300026088 Bacteria 2294
394 Ga0207641_10160588 3300026088 Bacteria 2043
395 Ga0207648_10001622 3300026089 Bacteria 24662
396 Ga0207648_10005568 3300026089 Bacteria 12672
397 Ga0207648_10097826 3300026089 Bacteria 2569
398 Ga0207676_10055890 3300026095 Bacteria 3101
399 Ga0207675_100000324 3300026118 Bacteria 45435
400 Ga0207675_100001148 3300026118 Bacteria 26257
401 Ga0207675_100005071 3300026118 Bacteria 12672
402 Ga0207675_100033465 3300026118 Bacteria 4788
403 Ga0207675_100106243 3300026118 Bacteria 2647
404 Ga0207675_100115440 3300026118 Bacteria 2537
405 Ga0207683_10000077 3300026121 Bacteria 77710
406 Ga0207683_10002279 3300026121 Bacteria 16818
407 Ga0207683_10022293 3300026121 Bacteria 5434
408 Ga0207683_10037711 3300026121 Bacteria 4210
409 Ga0207683_10066532 3300026121 Bacteria 3178
410 Ga0207683_10188693 3300026121 Bacteria 1871
411 Ga0207683_10229171 3300026121 Bacteria 1694
412 Ga0209813_10058967 3300027866 Bacteria 1221
413 Ga0268266_10011847 3300028379 Bacteria 7556
414 Ga0268266_10042481 3300028379 Bacteria 3883
415 Ga0268266_10070058 3300028379 Bacteria 3039
416 Ga0268266_10168142 3300028379 Bacteria 1988
417 Ga0268266_10326929 3300028379 Bacteria 1436
418 Ga0268265_10007934 3300028380 Bacteria 7165
419 Ga0268265_10008953 3300028380 Bacteria 6769
420 Ga0268265_10036678 3300028380 Bacteria 3592
421 Ga0268265_10278662 3300028380 Bacteria 1495
422 Ga0268264_10000053 3300028381 Bacteria 320368
423 Ga0268264_10001281 3300028381 Bacteria 23793
424 Ga0268264_10003529 3300028381 Bacteria 13472
425 Ga0268264_10088693 3300028381 Bacteria 2662
426 Ga0268264_10135316 3300028381 Bacteria 2190
427 Ga0268264_10162542 3300028381 Bacteria 2013
428 Ga0307413_10017608 3300031824 Bacteria 3726
429 Ga0307406_10190871 3300031901 Unclassified 1500
430 Ga0307409_100035556 3300031995 Bacteria 3652
431 Ga0307415_100339902 3300032126 Unclassified 1259
432 Ga0373958_0032216 3300034819 Bacteria 1035
433 Ga0373928_0010922 3300035084 Bacteria 1790
434 Ga0373940_0037173 3300035088 Bacteria 1325
435 Ga0373939_0033116 3300035114 Bacteria 1507
436 Ga0373939_0057979 3300035114 Bacteria 1223
437 Ga0373962_0058624 3300035242 Bacteria 1126
438 Ga0373931_0014257 3300035691 Bacteria 3882
439 Ga0373931_0047926 3300035691 Bacteria 2263
440 Ga0373947_0182509 3300035725 Bacteria 1367
441 Ga0436365_0307188 3300039437 Bacteria 1775
442 Ga0436361_0276372 3300039447 Bacteria 2678
443 Ga0439461_0001671 3300041410 Bacteria 3455
444 Ga0439466_0002159 3300041411 Bacteria 7706
445 Ga0451793_0781259 3300041452 Bacteria 3261
446 Ga0439431_0000447 3300041997 Bacteria 8689
447 Ga0439442_011141 3300042002 Bacteria 1828
448 Ga0439434_0012896 3300042435 Bacteria 2477
449 Ga0466969_0019268 3300044656 Bacteria 3550
450 Ga0466972_0026587 3300044658 Bacteria 2868
451 Ga0466972_0033222 3300044658 Bacteria 2531
452 Ga0466972_0078209 3300044658 Bacteria 1575
453 Ga0466965_0006756 3300044683 Bacteria 5234
454 Ga0466965_0181528 3300044683 Bacteria 1110
455 Ga0466961_0018216 3300044693 Bacteria 4515
456 Ga0466963_0040258 3300044694 Bacteria 3063
457 Ga0466964_0035409 3300044706 Bacteria 1996
458 Ga0466968_0007037 3300044735 Bacteria 4263
459 Ga0466970_0189860 3300044765 Bacteria 1141
460 Ga0466957_0011701 3300044842 Bacteria 5071
461 Ga0466957_0013117 3300044842 Bacteria 4803
462 Ga0466960_0000043 3300044901 Bacteria 40805
463 Ga0466960_0009641 3300044901 Bacteria 3987
464 Ga0466959_0032140 3300045049 Bacteria 3884
465 Ga0466959_0041991 3300045049 Bacteria 3374
466 Ga0466967_0044525 3300045976 Bacteria 3850
467 Ga0466967_0051054 3300045976 Bacteria 3623
468 Ga0466967_0078503 3300045976 Bacteria 2974
469 Ga0495592_0162033 3300046454 Bacteria 1538
470 Ga0495603_0052727 3300046455 Bacteria 2414
471 Ga0495603_0067823 3300046455 Bacteria 2099
472 Ga0495629_0000546 3300046459 Bacteria 31018
473 Ga0495629_0013452 3300046459 Bacteria 5902
474 Ga0495629_0022019 3300046459 Bacteria 4545
475 Ga0495629_0186995 3300046459 Bacteria 1434
476 Ga0495638_0000745 3300046460 Bacteria 34919
477 Ga0495638_0007521 3300046460 Bacteria 7798
478 Ga0495638_0096995 3300046460 Bacteria 1768
479 Ga0495641_0017883 3300046461 Bacteria 3675
480 Ga0495651_0007772 3300046462 Bacteria 8205
481 Ga0495651_0038321 3300046462 Bacteria 3733
482 Ga0495653_0015204 3300046463 Bacteria 6273
483 Ga0495639_0031046 3300046475 Bacteria 2377
484 Ga0495594_0000907 3300046499 Bacteria 15360
485 Ga0495608_0021528 3300046511 Bacteria 4425
486 Ga0495608_0096391 3300046511 Bacteria 1911
487 Ga0495628_0013118 3300046516 Bacteria 6977
488 Ga0495628_0434990 3300046516 Bacteria 954
489 Ga0495630_0020357 3300046517 Bacteria 4891
490 Ga0495630_0064839 3300046517 Bacteria 2745
491 Ga0495648_0001220 3300046524 Bacteria 25766
492 Ga0495652_0012110 3300046529 Bacteria 7792
493 Ga0495652_0066076 3300046529 Bacteria 3037
494 Ga0495665_0027228 3300046531 Bacteria 3069
495 Ga0495640_0001256 3300046533 Bacteria 19903
496 Ga0495640_0004019 3300046533 Bacteria 11767
497 Ga0495640_0171835 3300046533 Bacteria 1384
498 Ga0495587_0006340 3300046536 Bacteria 7713
499 Ga0495645_0010749 3300046543 Bacteria 6432
500 Ga0495667_0016349 3300046559 Bacteria 5014
501 Ga0495668_0056732 3300046616 Bacteria 2161
502 Ga0495634_0035550 3300046642 Bacteria 3410
503 Ga0495611_0078433 3300046648 Bacteria 1516
504 Ga0495635_0007371 3300046663 Bacteria 7675
505 Ga0495588_0023666 3300046674 Bacteria 3043
506 Ga0495657_0011542 3300046675 Bacteria 6602
507 Ga0495599_0005251 3300046678 Bacteria 7728
508 Ga0495623_0005019 3300046679 Bacteria 8678
509 Ga0495658_0011413 3300046683 Bacteria 4468
510 Ga0495613_0003801 3300046689 Bacteria 11318
511 Ga0495613_0004495 3300046689 Bacteria 10453
512 Ga0495624_0070933 3300046690 Bacteria 2168
513 Ga0495600_0004749 3300046809 Bacteria 8152
514 Ga0495604_0023894 3300047317 Bacteria 4878
515 Ga0495674_0021560 3300047319 Bacteria 5957
516 Ga0495674_0047098 3300047319 Bacteria 3825
517 Ga0495674_0164092 3300047319 Bacteria 1857
518 Ga0495672_0018774 3300047320 Bacteria 4579
519 Ga0495672_0038799 3300047320 Bacteria 2902
520 Ga0495676_0022256 3300047321 Bacteria 5518
521 Ga0495676_0026456 3300047321 Bacteria 4993
522 Ga0495676_0040198 3300047321 Bacteria 3863
523 Ga0495675_0003362 3300047444 Bacteria 9635
524 Ga0495675_0043633 3300047444 Bacteria 2857
525 Ga0495684_0005393 3300047471 Bacteria 9956
526 Ga0495686_0025392 3300047472 Bacteria 3884
527 Ga0495593_0013924 3300047673 Bacteria 4582
528 Ga0495593_0014462 3300047673 Bacteria 4486
529 Ga0495593_0045883 3300047673 Bacteria 2330
530 Ga0495602_0010713 3300048088 Bacteria 9507
531 Ga0496100_0000142 3300048903 Bacteria 39816
532 Ga0496100_0016873 3300048903 Bacteria 4296
533 Ga0496100_0054467 3300048903 Bacteria 2609
534 Ga0496101_0000011 3300048904 Bacteria 272153
535 Ga0496101_0002609 3300048904 Bacteria 11072
536 Ga0496101_0008063 3300048904 Bacteria 6867
537 Ga0496101_0015182 3300048904 Bacteria 5185
538 Ga0496101_0039249 3300048904 Bacteria 3366
539 Ga0496101_0080061 3300048904 Bacteria 2413
540 Ga0496102_0000012 3300048905 Bacteria 315470
541 Ga0496102_0000070 3300048905 Bacteria 155087
542 Ga0496102_0000915 3300048905 Bacteria 27833
543 Ga0496102_0001632 3300048905 Bacteria 19764
544 Ga0496102_0014909 3300048905 Bacteria 6762
545 Ga0496102_0053984 3300048905 Bacteria 3663
546 Ga0496102_0329400 3300048905 Bacteria 1438
547 Ga0496102_0357196 3300048905 Bacteria 1375
548 Ga0496103_0000005 3300048906 Bacteria 505416
549 Ga0496103_0000342 3300048906 Bacteria 42444
550 Ga0496103_0006721 3300048906 Bacteria 6862
551 Ga0496103_0014620 3300048906 Bacteria 4664
552 Ga0496103_0024888 3300048906 Bacteria 3613
553 Ga0496103_0122412 3300048906 Bacteria 1658
554 Ga0496104_0250402 3300048907 Bacteria 1684
555 Ga0496105_0066575 3300048908 Bacteria 2974
556 Ga0496106_0001251 3300048909 Bacteria 19027
557 Ga0496106_0005715 3300048909 Bacteria 9200
558 Ga0496106_0010211 3300048909 Bacteria 6938
559 Ga0496106_0015675 3300048909 Bacteria 5606
560 Ga0496107_0001038 3300048910 Bacteria 16617
561 Ga0496107_0008820 3300048910 Bacteria 6987
562 Ga0496107_0009361 3300048910 Bacteria 6790
563 Ga0496107_0082594 3300048910 Bacteria 2343
564 Ga0496107_0094223 3300048910 Bacteria 2191
565 Ga0496108_0006199 3300048911 Bacteria 9683
566 Ga0496108_0557954 3300048911 Bacteria 999
567 Ga0496109_0031454 3300048912 Bacteria 4762
568 Ga0496109_0164439 3300048912 Bacteria 2080
569 Ga0496110_0033275 3300048913 Bacteria 4458
570 Ga0496112_0021144 3300048915 Bacteria 6183
571 Ga0496112_0031776 3300048915 Bacteria 5122
572 Ga0496112_0077455 3300048915 Bacteria 3288
573 Ga0496113_0143394 3300048916 Bacteria 1880
574 Ga0496114_0000766 3300048917 Bacteria 24011
575 Ga0496114_0009779 3300048917 Bacteria 7618
576 Ga0496114_0035403 3300048917 Bacteria 4122
577 Ga0496114_0218007 3300048917 Bacteria 1675
578 Ga0496114_0250321 3300048917 Bacteria 1559
579 Ga0496115_0001326 3300048918 Bacteria 17649
580 Ga0496115_0002565 3300048918 Bacteria 13048
581 Ga0496115_0005192 3300048918 Bacteria 9467
582 Ga0496115_0113667 3300048918 Bacteria 2225
583 Ga0496116_0000050 3300048919 Bacteria 311670
584 Ga0496117_0000042 3300048920 Bacteria 315470
585 Ga0496117_0000233 3300048920 Bacteria 105282
586 Ga0496118_0000037 3300048921 Bacteria 315470
587 Ga0496118_0001816 3300048921 Bacteria 30722
588 Ga0496119_0000486 3300048922 Bacteria 54401
589 Ga0496119_0004931 3300048922 Bacteria 13047
590 Ga0496119_0122295 3300048922 Bacteria 1429
591 Ga0496120_0000121 3300048923 Bacteria 131612
592 Ga0496120_0006473 3300048923 Bacteria 8984
593 Ga0496121_0001091 3300048924 Bacteria 47947
594 Ga0496122_0027610 3300048925 Bacteria 4845
595 Ga0496125_0042820 3300048928 Bacteria 3850
596 Ga0496126_0000236 3300048929 Bacteria 119350
597 Ga0496126_0029046 3300048929 Bacteria 5257
598 Ga0496126_0073036 3300048929 Bacteria 3050
599 Ga0501031_0003559 3300049568 Bacteria 10007
600 Ga0501031_0039482 3300049568 Bacteria 3080
601 Ga0501032_0004950 3300049569 Bacteria 9963
602 Ga0501032_0031377 3300049569 Bacteria 3643
603 Ga0501032_0031446 3300049569 Bacteria 3639
604 Ga0501034_0009889 3300049571 Bacteria 9969
605 Ga0501034_0178912 3300049571 Bacteria 2086
606 Ga0501037_0013608 3300049573 Bacteria 5993
607 Ga0501037_0040445 3300049573 Bacteria 3431
608 Ga0501039_0000835 3300049575 Bacteria 22275
609 Ga0501039_0020591 3300049575 Bacteria 5054
610 Ga0501040_0139122 3300049576 Bacteria 1709
611 Ga0501043_0016855 3300049579 Bacteria 5726
612 Ga0501043_0042133 3300049579 Bacteria 3586
613 Ga0501046_0024825 3300049580 Bacteria 4911
614 Ga0501047_0021818 3300049581 Bacteria 6148
615 Ga0501047_0031179 3300049581 Bacteria 5142
616 Ga0501067_0015476 3300049583 Bacteria 4222
617 Ga0501069_0004427 3300049585 Bacteria 7255
618 Ga0501070_0008673 3300049586 Bacteria 8595
619 Ga0501071_0010148 3300049587 Bacteria 6301
620 Ga0501072_0004542 3300049588 Bacteria 10550
621 Ga0501073_0018809 3300049589 Bacteria 4992
622 Ga0501074_0135914 3300049590 Bacteria 1758
623 Ga0501076_0201494 3300049592 Bacteria 1625
624 Ga0501077_0026031 3300049593 Bacteria 3712
625 Ga0501079_0190485 3300049741 Bacteria 1600
626 Ga0501080_0131573 3300049742 Bacteria 2316
627 Ga0501083_0008871 3300049744 Bacteria 7100
628 Ga0501035_0001861 3300049822 Bacteria 21258
629 Ga0501035_0176509 3300049822 Bacteria 1842
630 Ga0501035_0198366 3300049822 Bacteria 1722
631 Ga0501044_0000150 3300049823 Bacteria 85886
632 Ga0501044_0005313 3300049823 Bacteria 14326
633 Ga0501044_0012714 3300049823 Bacteria 9117
634 Ga0501044_0225994 3300049823 Bacteria 1821
635 nmdc:mga03683_72169_c1 3300050489 Bacteria 1478
636 nmdc:mga03n38_1769_c1 3300050490 Bacteria 6039
637 nmdc:mga03n38_84891_c1 3300050490 Bacteria 1496
638 nmdc:mga00v17_24553_c1 3300050491 Bacteria 3498
639 nmdc:mga00v17_44291_c1 3300050491 Bacteria 2683
640 nmdc:mga00v17_9564_c1 3300050491 Bacteria 5252
641 nmdc:mga0yw44_14128_c2 3300050492 Bacteria 3658
642 nmdc:mga0yw44_180369_c1 3300050492 Bacteria 1390
643 nmdc:mga0yw44_3548_c1 3300050492 Bacteria 6952
644 nmdc:mga0k408_103548_c2 3300050493 Bacteria 1225
645 nmdc:mga06z11_115445_c1 3300050494 Bacteria 1492
646 nmdc:mga06z11_155511_c1 3300050494 Bacteria 1303
647 nmdc:mga04h51_59170_c1 3300050495 Bacteria 1308
648 nmdc:mga04h51_66581_c1 3300050495 Bacteria 1248
649 nmdc:mga07m45_23217_c1 3300050496 Bacteria 3389
650 nmdc:mga07m45_89246_c1 3300050496 Bacteria 1765
651 nmdc:mga05p37_22120_c2 3300050507 Bacteria 7163
652 nmdc:mga0qj67_6776_c1 3300050509 Bacteria 8421
653 nmdc:mga06r32_9568_c1 3300050510 Bacteria 8753
654 nmdc:mga0sz30_1591_c2 3300050516 Bacteria 6325
655 nmdc:mga0sz30_29044_c1 3300050516 Bacteria 2277
656 nmdc:mga0sz30_37734_c1 3300050516 Bacteria 2023
657 nmdc:mga0sz30_48225_c1 3300050516 Bacteria 1801
658 nmdc:mga0sz30_52691_c1 3300050516 Bacteria 1728
659 Ga0500635_0020872 3300053080 Bacteria 2012
660 Ga0495619_0023894 3300053085 Bacteria 3919
661 Ga0500578_0192137 3300053086 Bacteria 1253
662 Ga0500643_000213 3300053087 Bacteria 54707
663 Ga0500643_002806 3300053087 Bacteria 8707
664 Ga0500643_008952 3300053087 Bacteria 3874
665 Ga0500556_0006057 3300053104 Bacteria 3427
666 Ga0500652_013657 3300053131 Bacteria 2883
667 Ga0500658_0037654 3300053134 Bacteria 1925
668 Ga0500577_0051227 3300053142 Bacteria 1552
669 Ga0500627_0052924 3300053158 Bacteria 1773
670 Ga0500645_000017 3300053730 Bacteria 146045
671 Ga0500645_000188 3300053730 Bacteria 48061
672 Ga0500645_001793 3300053730 Bacteria 10316
673 Ga0500645_025452 3300053730 Bacteria 1806
674 Ga0501084_0039067 3300054114 Bacteria 3969
675 Ga0501082_0024895 3300060353 Bacteria 5157
676 Ga0530510_0162905 3300061734 Bacteria 1650

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002244 JGI24742J22300_10007280 JGI24742J22300_100072803 287
2 3300005366 Ga0070659_100260570 Ga0070659_1002605701 287
3 3300046516 Ga0495628_0434990 Ga0495628_0434990_34_915 292
4 3300025981 Ga0207640_10371038 Ga0207640_103710381 293
5 3300048911 Ga0496108_0557954 Ga0496108_0557954_76_957 293
6 3300050490 nmdc:mga03n38_84891_c1 nmdc:mga03n38_84891_c1_17_901 294
7 3300053086 Ga0500578_0192137 Ga0500578_0192137_350_1234 294
8 3300005546 Ga0070696_100057020 Ga0070696_1000570201 300
9 3300005844 Ga0068862_100541180 Ga0068862_1005411802 300
10 3300028380 Ga0268265_10278662 Ga0268265_102786622 300
11 3300044765 Ga0466970_0189860 Ga0466970_0189860_185_1093 302
12 3300048915 Ga0496112_0021144 Ga0496112_0021144_1650_2666 302
13 3300048916 Ga0496113_0143394 Ga0496113_0143394_300_1316 302
14 3300048925 Ga0496122_0027610 Ga0496122_0027610_2950_3966 302
15 3300035242 Ga0373962_0058624 Ga0373962_0058624_67_1083 303
16 3300048904 Ga0496101_0039249 Ga0496101_0039249_390_1406 304
17 3300005330 Ga0070690_100009368 Ga0070690_1000093684 308
18 3300005335 Ga0070666_10050045 Ga0070666_100500453 308
19 3300005337 Ga0070682_100018767 Ga0070682_1000187672 308
20 3300005338 Ga0068868_100001534 Ga0068868_1000015348 308
21 3300005341 Ga0070691_10024492 Ga0070691_100244922 308
22 3300005347 Ga0070668_100003591 Ga0070668_1000035914 308
23 3300005354 Ga0070675_100082654 Ga0070675_1000826542 308
24 3300005356 Ga0070674_100005222 Ga0070674_1000052222 308
25 3300005365 Ga0070688_100006042 Ga0070688_1000060423 308
26 3300005367 Ga0070667_100003168 Ga0070667_1000031682 308
27 3300005437 Ga0070710_10001392 Ga0070710_100013925 308
28 3300005438 Ga0070701_10006493 Ga0070701_100064932 308
29 3300005441 Ga0070700_100005245 Ga0070700_1000052454 308
30 3300005444 Ga0070694_100004880 Ga0070694_1000048805 308
31 3300005456 Ga0070678_100002759 Ga0070678_1000027598 308
32 3300005457 Ga0070662_100026108 Ga0070662_1000261084 308
33 3300005459 Ga0068867_100005802 Ga0068867_1000058027 308
34 3300005539 Ga0068853_100010078 Ga0068853_1000100785 308
35 3300005546 Ga0070696_100060580 Ga0070696_1000605802 308
36 3300005548 Ga0070665_100030874 Ga0070665_1000308743 308
37 3300005549 Ga0070704_100000313 Ga0070704_1000003132 308
38 3300005563 Ga0068855_100281144 Ga0068855_1002811442 308
39 3300005578 Ga0068854_100001484 Ga0068854_10000148412 308
40 3300005615 Ga0070702_100039656 Ga0070702_1000396562 308
41 3300005617 Ga0068859_100004026 Ga0068859_10000402614 308
42 3300005718 Ga0068866_10060364 Ga0068866_100603642 308
43 3300005719 Ga0068861_100001049 Ga0068861_1000010499 308
44 3300005842 Ga0068858_100014801 Ga0068858_1000148011 308
45 3300005843 Ga0068860_100094031 Ga0068860_1000940312 308
46 3300005844 Ga0068862_100003302 Ga0068862_1000033023 308
47 3300006163 Ga0070715_10000197 Ga0070715_100001972 308
48 3300006237 Ga0097621_100010926 Ga0097621_1000109262 308
49 3300006881 Ga0068865_100008905 Ga0068865_1000089053 308
50 3300006931 Ga0097620_100004026 Ga0097620_10000402614 308
51 3300009098 Ga0105245_10005751 Ga0105245_100057513 308
52 3300009101 Ga0105247_10003309 Ga0105247_100033094 308
53 3300009148 Ga0105243_10000779 Ga0105243_1000077914 308
54 3300009176 Ga0105242_10000066 Ga0105242_100000663 308
55 3300009551 Ga0105238_10111992 Ga0105238_101119922 308
56 3300009553 Ga0105249_10004766 Ga0105249_100047665 308
57 3300010375 Ga0105239_10015683 Ga0105239_100156837 308
58 3300013297 Ga0157378_10002159 Ga0157378_100021595 308
59 3300013306 Ga0163162_10014890 Ga0163162_100148905 308
60 3300013308 Ga0157375_10000268 Ga0157375_100002686 308
61 3300014326 Ga0157380_10000036 Ga0157380_1000003664 308
62 3300014745 Ga0157377_10031203 Ga0157377_100312033 308
63 3300014968 Ga0157379_10001562 Ga0157379_100015626 308
64 3300014969 Ga0157376_10065953 Ga0157376_100659532 308
65 3300017792 Ga0163161_10009914 Ga0163161_100099145 308
66 3300025898 Ga0207692_10043306 Ga0207692_100433063 308
67 3300025899 Ga0207642_10004003 Ga0207642_100040034 308
68 3300025901 Ga0207688_10001014 Ga0207688_100010144 308
69 3300025907 Ga0207645_10005002 Ga0207645_100050023 308
70 3300025915 Ga0207693_10000224 Ga0207693_1000022443 308
71 3300025927 Ga0207687_10008487 Ga0207687_100084874 308
72 3300025929 Ga0207664_10085978 Ga0207664_100859783 308
73 3300025933 Ga0207706_10000288 Ga0207706_1000028836 308
74 3300025934 Ga0207686_10008741 Ga0207686_100087414 308
75 3300025935 Ga0207709_10018729 Ga0207709_100187292 308
76 3300025937 Ga0207669_10010158 Ga0207669_100101583 308
77 3300025938 Ga0207704_10166759 Ga0207704_101667592 308
78 3300025939 Ga0207665_10008988 Ga0207665_100089884 308
79 3300025940 Ga0207691_10126096 Ga0207691_101260963 308
80 3300025949 Ga0207667_10238478 Ga0207667_102384782 308
81 3300025961 Ga0207712_10026058 Ga0207712_100260583 308
82 3300025972 Ga0207668_10104147 Ga0207668_101041472 308
83 3300025986 Ga0207658_10200802 Ga0207658_102008022 308
84 3300026023 Ga0207677_10125461 Ga0207677_101254612 308
85 3300026035 Ga0207703_10007155 Ga0207703_100071556 308
86 3300026041 Ga0207639_10049175 Ga0207639_100491753 308
87 3300026075 Ga0207708_10003048 Ga0207708_100030489 308
88 3300026089 Ga0207648_10001622 Ga0207648_100016224 308
89 3300026118 Ga0207675_100000324 Ga0207675_10000032413 308
90 3300026121 Ga0207683_10000077 Ga0207683_1000007772 308
91 3300028379 Ga0268266_10011847 Ga0268266_100118473 308
92 3300028380 Ga0268265_10008953 Ga0268265_100089535 308
93 3300035114 Ga0373939_0057979 Ga0373939_0057979_132_1145 308
94 3300035691 Ga0373931_0047926 Ga0373931_0047926_643_1656 308
95 3300048904 Ga0496101_0015182 Ga0496101_0015182_3463_4476 308
96 3300048905 Ga0496102_0000915 Ga0496102_0000915_3402_4415 308
97 3300048906 Ga0496103_0024888 Ga0496103_0024888_1224_2237 308
98 3300048909 Ga0496106_0010211 Ga0496106_0010211_1123_2136 308
99 3300048918 Ga0496115_0005192 Ga0496115_0005192_3790_4803 308
100 3300034819 Ga0373958_0032216 Ga0373958_0032216_85_1017 310
101 3300041410 Ga0439461_0001671 Ga0439461_0001671_1913_2938 313
102 3300041411 Ga0439466_0002159 Ga0439466_0002159_1821_2846 313
103 3300050492 nmdc:mga0yw44_14128_c2 nmdc:mga0yw44_14128_c2_2601_3545 314
104 3300006186 Ga0075369_10035586 Ga0075369_100355863 315
105 3300048908 Ga0496105_0066575 Ga0496105_0066575_1985_2941 318
106 3300049568 Ga0501031_0003559 Ga0501031_0003559_6961_7974 319
107 3300049569 Ga0501032_0004950 Ga0501032_0004950_2036_3049 319
108 3300049571 Ga0501034_0009889 Ga0501034_0009889_6961_7974 319
109 3300049573 Ga0501037_0013608 Ga0501037_0013608_533_1546 319
110 3300049575 Ga0501039_0020591 Ga0501039_0020591_326_1339 319
111 3300049576 Ga0501040_0139122 Ga0501040_0139122_389_1402 319
112 3300049579 Ga0501043_0042133 Ga0501043_0042133_2394_3407 319
113 3300049580 Ga0501046_0024825 Ga0501046_0024825_2036_3049 319
114 3300049581 Ga0501047_0021818 Ga0501047_0021818_1493_2506 319
115 3300049583 Ga0501067_0015476 Ga0501067_0015476_805_1818 319
116 3300049585 Ga0501069_0004427 Ga0501069_0004427_4935_5948 319
117 3300049587 Ga0501071_0010148 Ga0501071_0010148_769_1782 319
118 3300049588 Ga0501072_0004542 Ga0501072_0004542_4546_5559 319
119 3300049589 Ga0501073_0018809 Ga0501073_0018809_2052_3065 319
120 3300049590 Ga0501074_0135914 Ga0501074_0135914_261_1274 319
121 3300049592 Ga0501076_0201494 Ga0501076_0201494_36_1049 319
122 3300049593 Ga0501077_0026031 Ga0501077_0026031_2140_3153 319
123 3300049741 Ga0501079_0190485 Ga0501079_0190485_327_1340 319
124 3300049742 Ga0501080_0131573 Ga0501080_0131573_1043_2056 319
125 3300049744 Ga0501083_0008871 Ga0501083_0008871_4868_5881 319
126 3300049822 Ga0501035_0176509 Ga0501035_0176509_219_1232 319
127 3300049823 Ga0501044_0012714 Ga0501044_0012714_6961_7974 319
128 3300054114 Ga0501084_0039067 Ga0501084_0039067_105_1118 319
129 3300060353 Ga0501082_0024895 Ga0501082_0024895_424_1437 319
130 3300061734 Ga0530510_0162905 Ga0530510_0162905_603_1616 319
131 3300026075 Ga0207708_10125334 Ga0207708_101253342 321
132 3300041997 Ga0439431_0000447 Ga0439431_0000447_7529_8554 322
133 3300042435 Ga0439434_0012896 Ga0439434_0012896_133_1158 322
134 3300006186 Ga0075369_10050367 Ga0075369_100503672 323
135 3300031824 Ga0307413_10017608 Ga0307413_100176084 323
136 3300050516 nmdc:mga0sz30_48225_c1 nmdc:mga0sz30_48225_c1_37_1053 323
137 3300050491 nmdc:mga00v17_24553_c1 nmdc:mga00v17_24553_c1_98_1114 324
138 3300006038 Ga0075365_10002099 Ga0075365_100020995 325
139 3300006048 Ga0075363_100000682 Ga0075363_1000006824 325
140 3300006195 Ga0075366_10167653 Ga0075366_101676532 325
141 3300050490 nmdc:mga03n38_1769_c1 nmdc:mga03n38_1769_c1_4292_5308 325
142 3300050492 nmdc:mga0yw44_3548_c1 nmdc:mga0yw44_3548_c1_2478_3494 325
143 3300050493 nmdc:mga0k408_103548_c2 nmdc:mga0k408_103548_c2_62_1078 325
144 3300050495 nmdc:mga04h51_66581_c1 nmdc:mga04h51_66581_c1_83_1099 325
145 3300044658 Ga0466972_0033222 Ga0466972_0033222_66_1076 326
146 3300005844 Ga0068862_100144824 Ga0068862_1001448242 327
147 3300042002 Ga0439442_011141 Ga0439442_011141_783_1799 327
148 3300048905 Ga0496102_0014909 Ga0496102_0014909_3165_4175 327
149 3300006042 Ga0075368_10059354 Ga0075368_100593542 328
150 3300027866 Ga0209813_10058967 Ga0209813_100589672 328
151 3300050495 nmdc:mga04h51_59170_c1 nmdc:mga04h51_59170_c1_154_1170 328
152 3300005434 Ga0070709_10151708 Ga0070709_101517081 329
153 3300005438 Ga0070701_10081819 Ga0070701_100818191 329
154 3300005439 Ga0070711_100052850 Ga0070711_1000528502 329
155 3300005444 Ga0070694_100291737 Ga0070694_1002917371 329
156 3300005549 Ga0070704_100028516 Ga0070704_1000285162 329
157 3300005718 Ga0068866_10008170 Ga0068866_100081704 329
158 3300005843 Ga0068860_100316990 Ga0068860_1003169902 329
159 3300006038 Ga0075365_10058194 Ga0075365_100581942 329
160 3300006051 Ga0075364_10004603 Ga0075364_100046034 329
161 3300006051 Ga0075364_10119395 Ga0075364_101193952 329
162 3300006051 Ga0075364_10119522 Ga0075364_101195222 329
163 3300006173 Ga0070716_100013650 Ga0070716_1000136503 329
164 3300006175 Ga0070712_100013747 Ga0070712_1000137472 329
165 3300006177 Ga0075362_10059104 Ga0075362_100591042 329
166 3300006178 Ga0075367_10024781 Ga0075367_100247813 329
167 3300006186 Ga0075369_10019582 Ga0075369_100195821 329
168 3300006353 Ga0075370_10090503 Ga0075370_100905032 329
169 3300006844 Ga0075428_100005018 Ga0075428_10000501813 329
170 3300006846 Ga0075430_100119671 Ga0075430_1001196712 329
171 3300006847 Ga0075431_100023608 Ga0075431_1000236082 329
172 3300006881 Ga0068865_100145574 Ga0068865_1001455742 329
173 3300009147 Ga0114129_10022999 Ga0114129_100229994 329
174 3300025899 Ga0207642_10138945 Ga0207642_101389452 329
175 3300025915 Ga0207693_10007684 Ga0207693_100076844 329
176 3300025916 Ga0207663_10059942 Ga0207663_100599422 329
177 3300025935 Ga0207709_10072913 Ga0207709_100729132 329
178 3300026067 Ga0207678_10114233 Ga0207678_101142333 329
179 3300026118 Ga0207675_100106243 Ga0207675_1001062433 329
180 3300035691 Ga0373931_0014257 Ga0373931_0014257_459_1475 329
181 3300048905 Ga0496102_0053984 Ga0496102_0053984_1143_2159 329
182 3300050494 nmdc:mga06z11_155511_c1 nmdc:mga06z11_155511_c1_258_1274 329
183 3300050496 nmdc:mga07m45_89246_c1 nmdc:mga07m45_89246_c1_173_1189 329
184 3300050507 nmdc:mga05p37_22120_c2 nmdc:mga05p37_22120_c2_5361_6377 329
185 3300050509 nmdc:mga0qj67_6776_c1 nmdc:mga0qj67_6776_c1_6756_7772 329
186 3300050510 nmdc:mga06r32_9568_c1 nmdc:mga06r32_9568_c1_4708_5724 329
187 3300050516 nmdc:mga0sz30_52691_c1 nmdc:mga0sz30_52691_c1_393_1409 329
188 3300049569 Ga0501032_0031377 Ga0501032_0031377_87_1103 330
189 3300049571 Ga0501034_0178912 Ga0501034_0178912_867_1883 330
190 3300049581 Ga0501047_0031179 Ga0501047_0031179_2080_3096 330
191 3300049822 Ga0501035_0001861 Ga0501035_0001861_15936_16952 330
192 3300049823 Ga0501044_0000150 Ga0501044_0000150_32959_33975 330
193 3300046455 Ga0495603_0067823 Ga0495603_0067823_809_1804 331
194 iso_pu_bacteria 2816332119 2816424827 332
195 3300035725 Ga0373947_0182509 Ga0373947_0182509_75_1091 333
196 3300047321 Ga0495676_0040198 Ga0495676_0040198_1203_2219 333
197 iso_pu_bacteria 2995463766 2995466439 333
198 iso_pu_bacteria 2643221687 2644485591 334
199 iso_pu_bacteria 2643221715 2644639001 334
200 iso_pu_bacteria 2738541264 2738664200 334
201 iso_pu_bacteria 2738541274 2738703000 334
202 iso_pu_bacteria 2738541274 2738706980 334
203 iso_pu_bacteria 2738541356 2739143335 334
204 iso_pu_bacteria 2738543028 2739333684 334
205 iso_pu_bacteria 2738543028 2739333821 334
206 iso_pu_bacteria 2842134933 2842136808 334
207 iso_pu_bacteria 2902792274 2902796088 334
208 iso_pu_bacteria 2902799365 2902800536 334
209 iso_pu_bacteria 2902810491 2902814122 334
210 iso_pu_bacteria 2902837492 2902843389 334
211 iso_pu_bacteria 2939582691 2939586705 334
212 3300053087 Ga0500643_000213 Ga0500643_000213_319_1329 336
213 3300005440 Ga0070705_100011946 Ga0070705_1000119462 337
214 3300044656 Ga0466969_0019268 Ga0466969_0019268_1039_2052 337
215 3300044693 Ga0466961_0018216 Ga0466961_0018216_2895_3908 337
216 3300045049 Ga0466959_0032140 Ga0466959_0032140_194_1207 337
217 3300045976 Ga0466967_0078503 Ga0466967_0078503_153_1166 337
218 3300046459 Ga0495629_0000546 Ga0495629_0000546_7619_8632 337
219 3300046462 Ga0495651_0007772 Ga0495651_0007772_534_1547 337
220 3300046462 Ga0495651_0038321 Ga0495651_0038321_1782_2798 337
221 3300046463 Ga0495653_0015204 Ga0495653_0015204_52_1065 337
222 3300046499 Ga0495594_0000907 Ga0495594_0000907_7570_8583 337
223 3300046511 Ga0495608_0021528 Ga0495608_0021528_2249_3262 337
224 3300046516 Ga0495628_0013118 Ga0495628_0013118_5104_6117 337
225 3300046517 Ga0495630_0020357 Ga0495630_0020357_3820_4833 337
226 3300046529 Ga0495652_0012110 Ga0495652_0012110_6659_7672 337
227 3300046529 Ga0495652_0066076 Ga0495652_0066076_974_1990 337
228 3300046531 Ga0495665_0027228 Ga0495665_0027228_587_1600 337
229 3300046533 Ga0495640_0001256 Ga0495640_0001256_4742_5758 337
230 3300046533 Ga0495640_0004019 Ga0495640_0004019_6383_7396 337
231 3300046536 Ga0495587_0006340 Ga0495587_0006340_6653_7666 337
232 3300046543 Ga0495645_0010749 Ga0495645_0010749_3204_4217 337
233 3300046559 Ga0495667_0016349 Ga0495667_0016349_666_1679 337
234 3300046642 Ga0495634_0035550 Ga0495634_0035550_2277_3290 337
235 3300046648 Ga0495611_0078433 Ga0495611_0078433_96_1109 337
236 3300046663 Ga0495635_0007371 Ga0495635_0007371_57_1070 337
237 3300046674 Ga0495588_0023666 Ga0495588_0023666_1864_2880 337
238 3300046675 Ga0495657_0011542 Ga0495657_0011542_59_1072 337
239 3300046678 Ga0495599_0005251 Ga0495599_0005251_6659_7672 337
240 3300046679 Ga0495623_0005019 Ga0495623_0005019_534_1547 337
241 3300046689 Ga0495613_0003801 Ga0495613_0003801_10185_11198 337
242 3300046689 Ga0495613_0004495 Ga0495613_0004495_1209_2225 337
243 3300046809 Ga0495600_0004749 Ga0495600_0004749_534_1547 337
244 3300047317 Ga0495604_0023894 Ga0495604_0023894_534_1547 337
245 3300047319 Ga0495674_0164092 Ga0495674_0164092_48_1061 337
246 3300047321 Ga0495676_0022256 Ga0495676_0022256_1916_2929 337
247 3300047321 Ga0495676_0026456 Ga0495676_0026456_3490_4503 337
248 3300047444 Ga0495675_0003362 Ga0495675_0003362_1964_2977 337
249 3300047444 Ga0495675_0043633 Ga0495675_0043633_563_1579 337
250 3300047471 Ga0495684_0005393 Ga0495684_0005393_8410_9423 337
251 3300048088 Ga0495602_0010713 Ga0495602_0010713_1836_2849 337
252 3300048915 Ga0496112_0077455 Ga0496112_0077455_235_1248 337
253 3300049568 Ga0501031_0039482 Ga0501031_0039482_214_1230 337
254 3300049822 Ga0501035_0198366 Ga0501035_0198366_118_1131 337
255 3300002074 JGI24748J21848_1002207 JGI24748J21848_10022071 338
256 3300002077 JGI24744J21845_10006091 JGI24744J21845_100060911 338
257 3300003792 Ga0055540_1003459 Ga0055540_10034596 338
258 3300003792 Ga0055540_1004892 Ga0055540_10048925 338
259 3300003792 Ga0055540_1007819 Ga0055540_10078194 338
260 3300005330 Ga0070690_100067610 Ga0070690_1000676101 338
261 3300005333 Ga0070677_10045961 Ga0070677_100459613 338
262 3300005334 Ga0068869_100014804 Ga0068869_1000148044 338
263 3300005335 Ga0070666_10038481 Ga0070666_100384812 338
264 3300005336 Ga0070680_100196710 Ga0070680_1001967103 338
265 3300005337 Ga0070682_100103958 Ga0070682_1001039583 338
266 3300005338 Ga0068868_100080455 Ga0068868_1000804553 338
267 3300005340 Ga0070689_100021792 Ga0070689_1000217923 338
268 3300005341 Ga0070691_10008853 Ga0070691_100088531 338
269 3300005341 Ga0070691_10105690 Ga0070691_101056901 338
270 3300005345 Ga0070692_10035561 Ga0070692_100355613 338
271 3300005347 Ga0070668_100002331 Ga0070668_10000233112 338
272 3300005347 Ga0070668_100047349 Ga0070668_1000473494 338
273 3300005354 Ga0070675_100038759 Ga0070675_1000387594 338
274 3300005355 Ga0070671_100229625 Ga0070671_1002296252 338
275 3300005355 Ga0070671_100280683 Ga0070671_1002806832 338
276 3300005356 Ga0070674_100001422 Ga0070674_10000142213 338
277 3300005356 Ga0070674_100026065 Ga0070674_1000260653 338
278 3300005365 Ga0070688_100006500 Ga0070688_1000065004 338
279 3300005365 Ga0070688_100070618 Ga0070688_1000706182 338
280 3300005366 Ga0070659_100033533 Ga0070659_1000335331 338
281 3300005367 Ga0070667_100000075 Ga0070667_100000075119 338
282 3300005367 Ga0070667_100004972 Ga0070667_1000049722 338
283 3300005367 Ga0070667_100046698 Ga0070667_1000466981 338
284 3300005434 Ga0070709_10031089 Ga0070709_100310891 338
285 3300005434 Ga0070709_10107613 Ga0070709_101076132 338
286 3300005437 Ga0070710_10001944 Ga0070710_100019448 338
287 3300005437 Ga0070710_10031660 Ga0070710_100316601 338
288 3300005438 Ga0070701_10000435 Ga0070701_1000043510 338
289 3300005439 Ga0070711_100001721 Ga0070711_10000172111 338
290 3300005439 Ga0070711_100003570 Ga0070711_1000035707 338
291 3300005440 Ga0070705_100037296 Ga0070705_1000372963 338
292 3300005441 Ga0070700_100003106 Ga0070700_1000031061 338
293 3300005441 Ga0070700_100033608 Ga0070700_1000336081 338
294 3300005444 Ga0070694_100088743 Ga0070694_1000887433 338
295 3300005455 Ga0070663_100061262 Ga0070663_1000612621 338
296 3300005455 Ga0070663_100117785 Ga0070663_1001177852 338
297 3300005455 Ga0070663_100197247 Ga0070663_1001972471 338
298 3300005455 Ga0070663_100252258 Ga0070663_1002522581 338
299 3300005456 Ga0070678_100001428 Ga0070678_1000014281 338
300 3300005456 Ga0070678_100015071 Ga0070678_1000150714 338
301 3300005456 Ga0070678_100154238 Ga0070678_1001542382 338
302 3300005456 Ga0070678_100407146 Ga0070678_1004071461 338
303 3300005459 Ga0068867_100026418 Ga0068867_1000264184 338
304 3300005466 Ga0070685_10079849 Ga0070685_100798492 338
305 3300005466 Ga0070685_10106165 Ga0070685_101061652 338
306 3300005466 Ga0070685_10137050 Ga0070685_101370502 338
307 3300005530 Ga0070679_100309127 Ga0070679_1003091272 338
308 3300005539 Ga0068853_100018982 Ga0068853_1000189821 338
309 3300005539 Ga0068853_100142578 Ga0068853_1001425782 338
310 3300005539 Ga0068853_100212282 Ga0068853_1002122823 338
311 3300005543 Ga0070672_100225660 Ga0070672_1002256602 338
312 3300005544 Ga0070686_100048494 Ga0070686_1000484943 338
313 3300005545 Ga0070695_100086844 Ga0070695_1000868441 338
314 3300005546 Ga0070696_100003298 Ga0070696_10000329810 338
315 3300005546 Ga0070696_100171427 Ga0070696_1001714272 338
316 3300005547 Ga0070693_100005306 Ga0070693_1000053061 338
317 3300005547 Ga0070693_100025397 Ga0070693_1000253974 338
318 3300005547 Ga0070693_100072408 Ga0070693_1000724081 338
319 3300005547 Ga0070693_100097755 Ga0070693_1000977552 338
320 3300005548 Ga0070665_100001679 Ga0070665_1000016792 338
321 3300005548 Ga0070665_100058267 Ga0070665_1000582672 338
322 3300005548 Ga0070665_100162347 Ga0070665_1001623471 338
323 3300005549 Ga0070704_100001436 Ga0070704_1000014361 338
324 3300005549 Ga0070704_100018644 Ga0070704_1000186442 338
325 3300005549 Ga0070704_100238338 Ga0070704_1002383382 338
326 3300005578 Ga0068854_100002812 Ga0068854_10000281210 338
327 3300005578 Ga0068854_100039896 Ga0068854_1000398962 338
328 3300005578 Ga0068854_100068024 Ga0068854_1000680243 338
329 3300005615 Ga0070702_100011985 Ga0070702_1000119854 338
330 3300005615 Ga0070702_100045685 Ga0070702_1000456852 338
331 3300005617 Ga0068859_100000077 Ga0068859_10000007768 338
332 3300005617 Ga0068859_100005680 Ga0068859_1000056801 338
333 3300005617 Ga0068859_100042188 Ga0068859_1000421884 338
334 3300005718 Ga0068866_10000564 Ga0068866_100005648 338
335 3300005718 Ga0068866_10017449 Ga0068866_100174493 338
336 3300005719 Ga0068861_100001894 Ga0068861_1000018941 338
337 3300005719 Ga0068861_100310440 Ga0068861_1003104401 338
338 3300005834 Ga0068851_10057998 Ga0068851_100579981 338
339 3300005841 Ga0068863_100103073 Ga0068863_1001030733 338
340 3300005841 Ga0068863_100382190 Ga0068863_1003821901 338
341 3300005842 Ga0068858_100005232 Ga0068858_10000523213 338
342 3300005842 Ga0068858_100010804 Ga0068858_1000108048 338
343 3300005842 Ga0068858_100014269 Ga0068858_1000142694 338
344 3300005842 Ga0068858_100019169 Ga0068858_1000191693 338
345 3300005843 Ga0068860_100000025 Ga0068860_100000025234 338
346 3300005843 Ga0068860_100001896 Ga0068860_1000018962 338
347 3300005843 Ga0068860_100005582 Ga0068860_10000558213 338
348 3300005843 Ga0068860_100064628 Ga0068860_1000646283 338
349 3300005843 Ga0068860_100277587 Ga0068860_1002775872 338
350 3300005844 Ga0068862_100004339 Ga0068862_10000433911 338
351 3300005844 Ga0068862_100198958 Ga0068862_1001989582 338
352 3300006038 Ga0075365_10002870 Ga0075365_100028706 338
353 3300006038 Ga0075365_10013149 Ga0075365_100131492 338
354 3300006038 Ga0075365_10074319 Ga0075365_100743192 338
355 3300006038 Ga0075365_10084118 Ga0075365_100841183 338
356 3300006048 Ga0075363_100001854 Ga0075363_1000018544 338
357 3300006051 Ga0075364_10007585 Ga0075364_100075854 338
358 3300006051 Ga0075364_10024577 Ga0075364_100245773 338
359 3300006051 Ga0075364_10036246 Ga0075364_100362463 338
360 3300006163 Ga0070715_10001550 Ga0070715_100015501 338
361 3300006163 Ga0070715_10007835 Ga0070715_100078353 338
362 3300006173 Ga0070716_100006523 Ga0070716_1000065233 338
363 3300006173 Ga0070716_100008515 Ga0070716_1000085155 338
364 3300006173 Ga0070716_100089491 Ga0070716_1000894911 338
365 3300006175 Ga0070712_100001623 Ga0070712_10000162314 338
366 3300006175 Ga0070712_100047760 Ga0070712_1000477603 338
367 3300006178 Ga0075367_10021404 Ga0075367_100214043 338
368 3300006186 Ga0075369_10000432 Ga0075369_1000043210 338
369 3300006186 Ga0075369_10003792 Ga0075369_100037924 338
370 3300006186 Ga0075369_10015734 Ga0075369_100157343 338
371 3300006186 Ga0075369_10037824 Ga0075369_100378243 338
372 3300006237 Ga0097621_100029904 Ga0097621_1000299044 338
373 3300006237 Ga0097621_100127190 Ga0097621_1001271901 338
374 3300006353 Ga0075370_10007035 Ga0075370_100070353 338
375 3300006358 Ga0068871_100023271 Ga0068871_1000232714 338
376 3300006881 Ga0068865_100023845 Ga0068865_1000238451 338
377 3300006881 Ga0068865_100066157 Ga0068865_1000661572 338
378 3300006881 Ga0068865_100310225 Ga0068865_1003102252 338
379 3300006931 Ga0097620_100000077 Ga0097620_10000007745 338
380 3300006931 Ga0097620_100005680 Ga0097620_1000056801 338
381 3300006931 Ga0097620_100042189 Ga0097620_1000421893 338
382 3300006931 Ga0097620_100116593 Ga0097620_1001165933 338
383 3300009098 Ga0105245_10004227 Ga0105245_100042271 338
384 3300009098 Ga0105245_10038255 Ga0105245_100382554 338
385 3300009101 Ga0105247_10000010 Ga0105247_10000010101 338
386 3300009101 Ga0105247_10002429 Ga0105247_1000242913 338
387 3300009101 Ga0105247_10139251 Ga0105247_101392512 338
388 3300009148 Ga0105243_10003474 Ga0105243_1000347413 338
389 3300009148 Ga0105243_10256443 Ga0105243_102564431 338
390 3300009174 Ga0105241_10171423 Ga0105241_101714231 338
391 3300009176 Ga0105242_10003222 Ga0105242_1000322213 338
392 3300009176 Ga0105242_10035466 Ga0105242_100354663 338
393 3300009177 Ga0105248_10000078 Ga0105248_1000007846 338
394 3300009177 Ga0105248_10063430 Ga0105248_100634304 338
395 3300009177 Ga0105248_10179124 Ga0105248_101791241 338
396 3300009177 Ga0105248_10387577 Ga0105248_103875772 338
397 3300009545 Ga0105237_10002051 Ga0105237_100020518 338
398 3300009545 Ga0105237_10059499 Ga0105237_100594994 338
399 3300009553 Ga0105249_10004495 Ga0105249_1000449511 338
400 3300009553 Ga0105249_10071738 Ga0105249_100717383 338
401 3300009553 Ga0105249_10079289 Ga0105249_100792893 338
402 3300009553 Ga0105249_10290935 Ga0105249_102909352 338
403 3300010375 Ga0105239_10003039 Ga0105239_1000303913 338
404 3300010375 Ga0105239_10007335 Ga0105239_1000733513 338
405 3300011119 Ga0105246_10347497 Ga0105246_103474971 338
406 3300013100 Ga0157373_10100696 Ga0157373_101006961 338
407 3300013102 Ga0157371_10074596 Ga0157371_100745961 338
408 3300013105 Ga0157369_10065414 Ga0157369_100654141 338
409 3300013296 Ga0157374_10004568 Ga0157374_100045686 338
410 3300013296 Ga0157374_10048997 Ga0157374_100489971 338
411 3300013297 Ga0157378_10006119 Ga0157378_1000611910 338
412 3300013297 Ga0157378_10042343 Ga0157378_100423433 338
413 3300013306 Ga0163162_10005045 Ga0163162_1000504513 338
414 3300013306 Ga0163162_10008900 Ga0163162_100089008 338
415 3300013306 Ga0163162_10081460 Ga0163162_100814602 338
416 3300013306 Ga0163162_10487077 Ga0163162_104870771 338
417 3300013307 Ga0157372_10006232 Ga0157372_100062321 338
418 3300013308 Ga0157375_10035308 Ga0157375_100353081 338
419 3300013308 Ga0157375_10184167 Ga0157375_101841672 338
420 3300014325 Ga0163163_10247774 Ga0163163_102477742 338
421 3300014326 Ga0157380_10002701 Ga0157380_1000270111 338
422 3300014326 Ga0157380_10309548 Ga0157380_103095481 338
423 3300014968 Ga0157379_10294840 Ga0157379_102948402 338
424 3300014969 Ga0157376_10041038 Ga0157376_100410384 338
425 3300017792 Ga0163161_10002645 Ga0163161_1000264513 338
426 3300017792 Ga0163161_10081226 Ga0163161_100812262 338
427 3300021384 Ga0213876_10083340 Ga0213876_100833402 338
428 3300025273 Ga0209673_1033192 Ga0209673_10331922 338
429 3300025303 Ga0209051_1001387 Ga0209051_100138714 338
430 3300025303 Ga0209051_1005756 Ga0209051_10057564 338
431 3300025303 Ga0209051_1007639 Ga0209051_10076393 338
432 3300025303 Ga0209051_1015869 Ga0209051_10158694 338
433 3300025885 Ga0207653_10015342 Ga0207653_100153423 338
434 3300025898 Ga0207692_10014881 Ga0207692_100148813 338
435 3300025898 Ga0207692_10016015 Ga0207692_100160154 338
436 3300025898 Ga0207692_10020015 Ga0207692_100200153 338
437 3300025899 Ga0207642_10003363 Ga0207642_100033633 338
438 3300025899 Ga0207642_10005782 Ga0207642_100057824 338
439 3300025899 Ga0207642_10018491 Ga0207642_100184912 338
440 3300025899 Ga0207642_10026627 Ga0207642_100266274 338
441 3300025900 Ga0207710_10000028 Ga0207710_10000028103 338
442 3300025900 Ga0207710_10001082 Ga0207710_1000108212 338
443 3300025900 Ga0207710_10001277 Ga0207710_1000127713 338
444 3300025901 Ga0207688_10001235 Ga0207688_1000123513 338
445 3300025901 Ga0207688_10003983 Ga0207688_100039835 338
446 3300025901 Ga0207688_10007147 Ga0207688_100071476 338
447 3300025904 Ga0207647_10062841 Ga0207647_100628413 338
448 3300025905 Ga0207685_10002868 Ga0207685_100028681 338
449 3300025905 Ga0207685_10027666 Ga0207685_100276661 338
450 3300025905 Ga0207685_10031040 Ga0207685_100310402 338
451 3300025906 Ga0207699_10015436 Ga0207699_100154364 338
452 3300025906 Ga0207699_10131111 Ga0207699_101311112 338
453 3300025907 Ga0207645_10009109 Ga0207645_100091092 338
454 3300025908 Ga0207643_10166322 Ga0207643_101663222 338
455 3300025911 Ga0207654_10102439 Ga0207654_101024391 338
456 3300025912 Ga0207707_10090440 Ga0207707_100904403 338
457 3300025913 Ga0207695_10260924 Ga0207695_102609241 338
458 3300025914 Ga0207671_10004398 Ga0207671_100043989 338
459 3300025915 Ga0207693_10003919 Ga0207693_1000391913 338
460 3300025915 Ga0207693_10008115 Ga0207693_100081153 338
461 3300025915 Ga0207693_10010959 Ga0207693_100109594 338
462 3300025915 Ga0207693_10110336 Ga0207693_101103362 338
463 3300025916 Ga0207663_10007980 Ga0207663_100079804 338
464 3300025916 Ga0207663_10030182 Ga0207663_100301823 338
465 3300025916 Ga0207663_10265891 Ga0207663_102658912 338
466 3300025917 Ga0207660_10097492 Ga0207660_100974923 338
467 3300025918 Ga0207662_10053195 Ga0207662_100531953 338
468 3300025918 Ga0207662_10100205 Ga0207662_101002051 338
469 3300025919 Ga0207657_10017934 Ga0207657_100179346 338
470 3300025919 Ga0207657_10018386 Ga0207657_100183864 338
471 3300025923 Ga0207681_10014692 Ga0207681_100146921 338
472 3300025923 Ga0207681_10018021 Ga0207681_100180214 338
473 3300025926 Ga0207659_10196607 Ga0207659_101966072 338
474 3300025926 Ga0207659_10360117 Ga0207659_103601172 338
475 3300025927 Ga0207687_10000594 Ga0207687_100005945 338
476 3300025927 Ga0207687_10004640 Ga0207687_100046405 338
477 3300025931 Ga0207644_10050528 Ga0207644_100505282 338
478 3300025931 Ga0207644_10255527 Ga0207644_102555271 338
479 3300025932 Ga0207690_10040310 Ga0207690_100403104 338
480 3300025933 Ga0207706_10017373 Ga0207706_100173734 338
481 3300025933 Ga0207706_10020804 Ga0207706_100208045 338
482 3300025933 Ga0207706_10101089 Ga0207706_101010893 338
483 3300025934 Ga0207686_10003068 Ga0207686_100030689 338
484 3300025934 Ga0207686_10003183 Ga0207686_100031837 338
485 3300025934 Ga0207686_10071015 Ga0207686_100710153 338
486 3300025934 Ga0207686_10102079 Ga0207686_101020793 338
487 3300025935 Ga0207709_10001097 Ga0207709_100010971 338
488 3300025936 Ga0207670_10133717 Ga0207670_101337172 338
489 3300025936 Ga0207670_10148498 Ga0207670_101484981 338
490 3300025937 Ga0207669_10000196 Ga0207669_1000019613 338
491 3300025937 Ga0207669_10000449 Ga0207669_100004493 338
492 3300025937 Ga0207669_10107688 Ga0207669_101076883 338
493 3300025938 Ga0207704_10000682 Ga0207704_1000068215 338
494 3300025938 Ga0207704_10001017 Ga0207704_1000101712 338
495 3300025938 Ga0207704_10182330 Ga0207704_101823302 338
496 3300025939 Ga0207665_10010565 Ga0207665_100105654 338
497 3300025939 Ga0207665_10011685 Ga0207665_100116853 338
498 3300025939 Ga0207665_10021889 Ga0207665_100218894 338
499 3300025939 Ga0207665_10115987 Ga0207665_101159871 338
500 3300025940 Ga0207691_10054663 Ga0207691_100546634 338
501 3300025941 Ga0207711_10000069 Ga0207711_10000069103 338
502 3300025941 Ga0207711_10116782 Ga0207711_101167821 338
503 3300025941 Ga0207711_10133170 Ga0207711_101331702 338
504 3300025942 Ga0207689_10009333 Ga0207689_100093337 338
505 3300025942 Ga0207689_10053029 Ga0207689_100530293 338
506 3300025942 Ga0207689_10145791 Ga0207689_101457913 338
507 3300025961 Ga0207712_10122198 Ga0207712_101221982 338
508 3300025972 Ga0207668_10000708 Ga0207668_100007083 338
509 3300025972 Ga0207668_10001896 Ga0207668_100018963 338
510 3300025972 Ga0207668_10006210 Ga0207668_100062101 338
511 3300025972 Ga0207668_10147467 Ga0207668_101474672 338
512 3300025981 Ga0207640_10033664 Ga0207640_100336644 338
513 3300025986 Ga0207658_10002764 Ga0207658_1000276412 338
514 3300025986 Ga0207658_10040590 Ga0207658_100405902 338
515 3300025986 Ga0207658_10072092 Ga0207658_100720921 338
516 3300025986 Ga0207658_10096480 Ga0207658_100964803 338
517 3300025986 Ga0207658_10186301 Ga0207658_101863012 338
518 3300026023 Ga0207677_10023893 Ga0207677_100238932 338
519 3300026023 Ga0207677_10033108 Ga0207677_100331082 338
520 3300026023 Ga0207677_10044193 Ga0207677_100441932 338
521 3300026023 Ga0207677_10058521 Ga0207677_100585213 338
522 3300026035 Ga0207703_10002614 Ga0207703_100026145 338
523 3300026035 Ga0207703_10043847 Ga0207703_100438473 338
524 3300026041 Ga0207639_10001979 Ga0207639_100019791 338
525 3300026041 Ga0207639_10185604 Ga0207639_101856043 338
526 3300026067 Ga0207678_10016962 Ga0207678_100169625 338
527 3300026067 Ga0207678_10018104 Ga0207678_100181044 338
528 3300026067 Ga0207678_10026917 Ga0207678_100269171 338
529 3300026067 Ga0207678_10107147 Ga0207678_101071472 338
530 3300026067 Ga0207678_10220010 Ga0207678_102200102 338
531 3300026075 Ga0207708_10000667 Ga0207708_1000066710 338
532 3300026075 Ga0207708_10006709 Ga0207708_100067091 338
533 3300026075 Ga0207708_10014636 Ga0207708_100146364 338
534 3300026078 Ga0207702_10373177 Ga0207702_103731772 338
535 3300026088 Ga0207641_10125919 Ga0207641_101259193 338
536 3300026088 Ga0207641_10160588 Ga0207641_101605882 338
537 3300026089 Ga0207648_10005568 Ga0207648_100055681 338
538 3300026089 Ga0207648_10097826 Ga0207648_100978263 338
539 3300026095 Ga0207676_10055890 Ga0207676_100558903 338
540 3300026118 Ga0207675_100001148 Ga0207675_1000011484 338
541 3300026118 Ga0207675_100005071 Ga0207675_1000050711 338
542 3300026118 Ga0207675_100033465 Ga0207675_1000334654 338
543 3300026118 Ga0207675_100115440 Ga0207675_1001154402 338
544 3300026121 Ga0207683_10002279 Ga0207683_100022797 338
545 3300026121 Ga0207683_10022293 Ga0207683_100222935 338
546 3300026121 Ga0207683_10037711 Ga0207683_100377113 338
547 3300026121 Ga0207683_10066532 Ga0207683_100665322 338
548 3300026121 Ga0207683_10188693 Ga0207683_101886932 338
549 3300026121 Ga0207683_10229171 Ga0207683_102291712 338
550 3300028379 Ga0268266_10042481 Ga0268266_100424814 338
551 3300028379 Ga0268266_10070058 Ga0268266_100700583 338
552 3300028379 Ga0268266_10168142 Ga0268266_101681423 338
553 3300028379 Ga0268266_10326929 Ga0268266_103269292 338
554 3300028380 Ga0268265_10007934 Ga0268265_100079342 338
555 3300028380 Ga0268265_10036678 Ga0268265_100366783 338
556 3300028381 Ga0268264_10000053 Ga0268264_10000053257 338
557 3300028381 Ga0268264_10001281 Ga0268264_100012814 338
558 3300028381 Ga0268264_10003529 Ga0268264_1000352913 338
559 3300028381 Ga0268264_10088693 Ga0268264_100886933 338
560 3300028381 Ga0268264_10135316 Ga0268264_101353162 338
561 3300028381 Ga0268264_10162542 Ga0268264_101625422 338
562 3300031901 Ga0307406_10190871 Ga0307406_101908711 338
563 3300031995 Ga0307409_100035556 Ga0307409_1000355563 338
564 3300032126 Ga0307415_100339902 Ga0307415_1003399022 338
565 3300035084 Ga0373928_0010922 Ga0373928_0010922_369_1385 338
566 3300035088 Ga0373940_0037173 Ga0373940_0037173_12_1028 338
567 3300035114 Ga0373939_0033116 Ga0373939_0033116_171_1187 338
568 3300039437 Ga0436365_0307188 Ga0436365_0307188_103_1119 338
569 3300039447 Ga0436361_0276372 Ga0436361_0276372_117_1133 338
570 3300041452 Ga0451793_0781259 Ga0451793_0781259_1808_2824 338
571 3300044658 Ga0466972_0026587 Ga0466972_0026587_907_1938 338
572 3300044658 Ga0466972_0078209 Ga0466972_0078209_386_1411 338
573 3300044683 Ga0466965_0006756 Ga0466965_0006756_3165_4190 338
574 3300044683 Ga0466965_0181528 Ga0466965_0181528_60_1076 338
575 3300044694 Ga0466963_0040258 Ga0466963_0040258_1423_2445 338
576 3300044706 Ga0466964_0035409 Ga0466964_0035409_658_1674 338
577 3300044735 Ga0466968_0007037 Ga0466968_0007037_1630_2655 338
578 3300044842 Ga0466957_0011701 Ga0466957_0011701_1938_2963 338
579 3300044842 Ga0466957_0013117 Ga0466957_0013117_17_1033 338
580 3300044901 Ga0466960_0000043 Ga0466960_0000043_4233_5264 338
581 3300044901 Ga0466960_0009641 Ga0466960_0009641_778_1803 338
582 3300045049 Ga0466959_0041991 Ga0466959_0041991_83_1108 338
583 3300045976 Ga0466967_0044525 Ga0466967_0044525_401_1426 338
584 3300045976 Ga0466967_0051054 Ga0466967_0051054_717_1739 338
585 3300046454 Ga0495592_0162033 Ga0495592_0162033_430_1446 338
586 3300046455 Ga0495603_0052727 Ga0495603_0052727_1236_2252 338
587 3300046459 Ga0495629_0013452 Ga0495629_0013452_3360_4376 338
588 3300046459 Ga0495629_0022019 Ga0495629_0022019_104_1120 338
589 3300046459 Ga0495629_0186995 Ga0495629_0186995_271_1287 338
590 3300046460 Ga0495638_0000745 Ga0495638_0000745_14081_15097 338
591 3300046460 Ga0495638_0007521 Ga0495638_0007521_965_1981 338
592 3300046460 Ga0495638_0096995 Ga0495638_0096995_81_1097 338
593 3300046461 Ga0495641_0017883 Ga0495641_0017883_2077_3093 338
594 3300046475 Ga0495639_0031046 Ga0495639_0031046_275_1291 338
595 3300046511 Ga0495608_0096391 Ga0495608_0096391_311_1327 338
596 3300046517 Ga0495630_0064839 Ga0495630_0064839_174_1190 338
597 3300046524 Ga0495648_0001220 Ga0495648_0001220_21256_22272 338
598 3300046533 Ga0495640_0171835 Ga0495640_0171835_220_1236 338
599 3300046616 Ga0495668_0056732 Ga0495668_0056732_496_1512 338
600 3300046683 Ga0495658_0011413 Ga0495658_0011413_1424_2440 338
601 3300046690 Ga0495624_0070933 Ga0495624_0070933_452_1468 338
602 3300047319 Ga0495674_0021560 Ga0495674_0021560_1812_2828 338
603 3300047319 Ga0495674_0047098 Ga0495674_0047098_284_1300 338
604 3300047320 Ga0495672_0018774 Ga0495672_0018774_1706_2722 338
605 3300047320 Ga0495672_0038799 Ga0495672_0038799_525_1541 338
606 3300047472 Ga0495686_0025392 Ga0495686_0025392_2616_3632 338
607 3300047673 Ga0495593_0013924 Ga0495593_0013924_106_1122 338
608 3300047673 Ga0495593_0014462 Ga0495593_0014462_312_1328 338
609 3300047673 Ga0495593_0045883 Ga0495593_0045883_351_1367 338
610 3300048903 Ga0496100_0000142 Ga0496100_0000142_38557_39573 338
611 3300048903 Ga0496100_0016873 Ga0496100_0016873_3061_4077 338
612 3300048903 Ga0496100_0054467 Ga0496100_0054467_495_1511 338
613 3300048904 Ga0496101_0000011 Ga0496101_0000011_139075_140091 338
614 3300048904 Ga0496101_0002609 Ga0496101_0002609_1516_2532 338
615 3300048904 Ga0496101_0008063 Ga0496101_0008063_5650_6666 338
616 3300048904 Ga0496101_0080061 Ga0496101_0080061_11_1027 338
617 3300048905 Ga0496102_0000012 Ga0496102_0000012_163404_164420 338
618 3300048905 Ga0496102_0000070 Ga0496102_0000070_11423_12439 338
619 3300048905 Ga0496102_0001632 Ga0496102_0001632_9347_10363 338
620 3300048905 Ga0496102_0329400 Ga0496102_0329400_313_1329 338
621 3300048905 Ga0496102_0357196 Ga0496102_0357196_289_1305 338
622 3300048906 Ga0496103_0000005 Ga0496103_0000005_151043_152059 338
623 3300048906 Ga0496103_0000342 Ga0496103_0000342_33497_34513 338
624 3300048906 Ga0496103_0006721 Ga0496103_0006721_5650_6666 338
625 3300048906 Ga0496103_0014620 Ga0496103_0014620_744_1760 338
626 3300048906 Ga0496103_0122412 Ga0496103_0122412_586_1602 338
627 3300048907 Ga0496104_0250402 Ga0496104_0250402_310_1326 338
628 3300048909 Ga0496106_0001251 Ga0496106_0001251_4628_5644 338
629 3300048909 Ga0496106_0005715 Ga0496106_0005715_7480_8496 338
630 3300048909 Ga0496106_0015675 Ga0496106_0015675_4294_5310 338
631 3300048910 Ga0496107_0001038 Ga0496107_0001038_9007_10023 338
632 3300048910 Ga0496107_0008820 Ga0496107_0008820_5239_6255 338
633 3300048910 Ga0496107_0009361 Ga0496107_0009361_354_1370 338
634 3300048910 Ga0496107_0082594 Ga0496107_0082594_54_1070 338
635 3300048910 Ga0496107_0094223 Ga0496107_0094223_660_1676 338
636 3300048911 Ga0496108_0006199 Ga0496108_0006199_6222_7238 338
637 3300048912 Ga0496109_0031454 Ga0496109_0031454_3149_4165 338
638 3300048912 Ga0496109_0164439 Ga0496109_0164439_69_1085 338
639 3300048913 Ga0496110_0033275 Ga0496110_0033275_598_1614 338
640 3300048915 Ga0496112_0031776 Ga0496112_0031776_3940_4956 338
641 3300048917 Ga0496114_0000766 Ga0496114_0000766_21265_22281 338
642 3300048917 Ga0496114_0009779 Ga0496114_0009779_5510_6526 338
643 3300048917 Ga0496114_0035403 Ga0496114_0035403_222_1238 338
644 3300048917 Ga0496114_0218007 Ga0496114_0218007_464_1480 338
645 3300048917 Ga0496114_0250321 Ga0496114_0250321_142_1158 338
646 3300048918 Ga0496115_0001326 Ga0496115_0001326_16230_17246 338
647 3300048918 Ga0496115_0002565 Ga0496115_0002565_533_1549 338
648 3300048918 Ga0496115_0113667 Ga0496115_0113667_300_1316 338
649 3300048919 Ga0496116_0000050 Ga0496116_0000050_159625_160641 338
650 3300048920 Ga0496117_0000042 Ga0496117_0000042_151051_152067 338
651 3300048920 Ga0496117_0000233 Ga0496117_0000233_70690_71706 338
652 3300048921 Ga0496118_0000037 Ga0496118_0000037_151051_152067 338
653 3300048921 Ga0496118_0001816 Ga0496118_0001816_12103_13119 338
654 3300048922 Ga0496119_0000486 Ga0496119_0000486_1786_2802 338
655 3300048922 Ga0496119_0004931 Ga0496119_0004931_10742_11758 338
656 3300048922 Ga0496119_0122295 Ga0496119_0122295_262_1278 338
657 3300048923 Ga0496120_0000121 Ga0496120_0000121_128811_129827 338
658 3300048923 Ga0496120_0006473 Ga0496120_0006473_4306_5322 338
659 3300048924 Ga0496121_0001091 Ga0496121_0001091_21826_22842 338
660 3300048928 Ga0496125_0042820 Ga0496125_0042820_2458_3474 338
661 3300048929 Ga0496126_0000236 Ga0496126_0000236_115058_116074 338
662 3300048929 Ga0496126_0029046 Ga0496126_0029046_3919_4935 338
663 3300048929 Ga0496126_0073036 Ga0496126_0073036_676_1692 338
664 3300049569 Ga0501032_0031446 Ga0501032_0031446_1585_2610 338
665 3300049573 Ga0501037_0040445 Ga0501037_0040445_822_1847 338
666 3300049575 Ga0501039_0000835 Ga0501039_0000835_1419_2444 338
667 3300049579 Ga0501043_0016855 Ga0501043_0016855_1598_2623 338
668 3300049586 Ga0501070_0008673 Ga0501070_0008673_1424_2449 338
669 3300049823 Ga0501044_0005313 Ga0501044_0005313_11704_12729 338
670 3300049823 Ga0501044_0225994 Ga0501044_0225994_311_1327 338
671 3300050489 nmdc:mga03683_72169_c1 nmdc:mga03683_72169_c1_31_1047 338
672 3300050491 nmdc:mga00v17_44291_c1 nmdc:mga00v17_44291_c1_59_1075 338
673 3300050491 nmdc:mga00v17_9564_c1 nmdc:mga00v17_9564_c1_3416_4432 338
674 3300050492 nmdc:mga0yw44_180369_c1 nmdc:mga0yw44_180369_c1_50_1066 338
675 3300050494 nmdc:mga06z11_115445_c1 nmdc:mga06z11_115445_c1_436_1452 338
676 3300050496 nmdc:mga07m45_23217_c1 nmdc:mga07m45_23217_c1_405_1421 338
677 3300050516 nmdc:mga0sz30_1591_c2 nmdc:mga0sz30_1591_c2_3790_4806 338
678 3300050516 nmdc:mga0sz30_29044_c1 nmdc:mga0sz30_29044_c1_341_1357 338
679 3300050516 nmdc:mga0sz30_37734_c1 nmdc:mga0sz30_37734_c1_471_1487 338
680 3300053080 Ga0500635_0020872 Ga0500635_0020872_337_1353 338
681 3300053085 Ga0495619_0023894 Ga0495619_0023894_98_1114 338
682 3300053087 Ga0500643_002806 Ga0500643_002806_7369_8385 338
683 3300053087 Ga0500643_008952 Ga0500643_008952_2349_3365 338
684 3300053104 Ga0500556_0006057 Ga0500556_0006057_354_1370 338
685 3300053131 Ga0500652_013657 Ga0500652_013657_249_1265 338
686 3300053134 Ga0500658_0037654 Ga0500658_0037654_116_1132 338
687 3300053142 Ga0500577_0051227 Ga0500577_0051227_273_1289 338
688 3300053158 Ga0500627_0052924 Ga0500627_0052924_666_1682 338
689 3300053730 Ga0500645_000017 Ga0500645_000017_85477_86493 338
690 3300053730 Ga0500645_000188 Ga0500645_000188_12998_14014 338
691 3300053730 Ga0500645_001793 Ga0500645_001793_203_1219 338
692 3300053730 Ga0500645_025452 Ga0500645_025452_530_1546 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

3

54

0.89

PF05834

Lycopene_cycl

Lycopene cyclase protein

3

154

0.83

PF01494

FAD_binding_3

FAD binding domain

2

205

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o4t-assembly1.cif.gz_A structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) 0.994 3 32
4j0f-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p212121 space group 0.9767 3 33
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9556 3 33
4oqy-assembly1.cif.gz_A streptomyces sp. gf3546 imine reductase 0.9552 3 32
8jyt-assembly1.cif.gz_A ancestral imine reducatase n560 0.9519 3 32
ID Description Score Start End Superfamily
af_Q4CWB6_396_583_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9813 3 33 3.40.50.720
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9732 3 33 3.50.50.60
af_O06538_2_320_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9683 2 320 3.50.50.60
af_Q4DB76_342_532_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9546 3 33 3.40.50.720
2vq3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9545 3 32 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B1KY07-F1-model_v4 deleted 0.981 1 101
AF-A0A1T3VRY1-F1-model_v4 Monooxygenase 0.9797 24 338 GO:0004497
GO:0071949
AF-A0A4R2HY09-F1-model_v4 Flavin-dependent dehydrogenase 0.9767 1 336
AF-A0A7I7KVW0-F1-model_v4 Oxidoreductase 0.9762 2 338 GO:0071949
AF-A0A1A2TMA6-F1-model_v4 Monooxygenase 0.9741 2 338 GO:0004497
GO:0071949

Feature Viewer

pLDDT pTM Quality
87.73 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map