F475587

General Info

Members Datasets Scaffolds Average Seq Length
692 499 1385 174

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10223600|Ga0265338_102236002
Length 172
Sequence MAKTSSQKFIARNRCPRVQIEYDVELYGAEKKVELPFVMGVMADLTGKPAEGQEPPPVGDRKFLEIDVDNFDDRLKACKPRVAFQVPNTLTGEGNLSVEMTFDSMDDFSPAAVARKVDSLNKLLQTRTELANLLTYMDGKDKAEELIGRLLNDPELMKSLGSAPAPTVKPAE

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
105 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
131 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
204 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
208 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
209 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
210 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
214 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
215 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
216 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
231 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
232 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
233 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
241 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
242 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
243 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
244 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
245 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
246 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
247 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
250 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
251 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
252 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
253 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
254 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
260 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
261 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
262 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
289 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
290 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
291 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
314 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
317 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
323 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
336 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
342 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
358 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
368 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
369 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
370 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
371 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
372 2519899620 Rhizobium sp. Pop5 Isolate Nodule
373 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
374 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
375 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
376 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
377 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
378 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
379 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
380 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
381 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
382 2718217882 Rhizobium sp. N741 Isolate Nodule
383 2718217927 Rhizobium sp. N324 Isolate Nodule
384 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
385 2718218009 Rhizobium sp. N561 Isolate Nodule
386 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
387 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
388 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
389 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
390 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
391 2718218363 Rhizobium sp. N113 Isolate Nodule
392 2718218365 Rhizobium sp. N731 Isolate Nodule
393 2718218366 Rhizobium sp. N621 Isolate Nodule
394 2721755514 Rhizobium sp. N6212 Isolate Nodule
395 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
396 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
397 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
398 2721755810 Rhizobium sp. N871 Isolate Nodule
399 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
400 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
401 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
402 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
403 2728369365 Rhizobium sp. N1341 Isolate Nodule
404 2728369397 Rhizobium sp. N1314 Isolate Nodule
405 2734482264 Dyella sp. AD052 Isolate Unclassified
406 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
407 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
408 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
409 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
410 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
411 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
412 2738543009 Luteibacter sp. OK325 Isolate Unclassified
413 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
414 2791355256 Rhizobium sp. M10 Isolate Nodule
415 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
416 2791355260 Rhizobium sp. L9 Isolate Nodule
417 2791355261 Rhizobium sp. J15 Isolate Nodule
418 2791355262 Rhizobium sp. M1 Isolate Nodule
419 2791355263 Rhizobium chutanense C5 Isolate Nodule
420 2791355264 Rhizobium sp. S9 Isolate Nodule
421 2791355265 Rhizobium sp. H4 Isolate Nodule
422 2791355266 Rhizobium sp. L43 Isolate Nodule
423 2791355267 Rhizobium sp. L18 Isolate Nodule
424 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
425 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
426 2802429633 Rhizobium anhuiense J3 Isolate Nodule
427 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
428 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
429 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
430 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
431 2838048938 Rhizobium pisi 27/80 Isolate Nodule
432 2838061910 Rhizobium phaseoli L15 Isolate Nodule
433 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
434 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
435 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
436 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
437 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
438 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
439 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
440 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
441 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
442 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
443 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
444 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
445 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
446 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
447 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
448 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
449 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
450 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
451 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
452 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
453 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
454 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
455 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
456 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
457 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
458 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
459 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
460 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
461 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
462 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
463 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
464 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
465 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
466 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
467 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
468 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
469 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
470 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
471 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
472 2865014394 Pantoea sp. R-71966 Isolate Unclassified
473 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
474 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
475 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
476 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
477 2936381700 Rhizobium chutanense C16 Isolate Unclassified
478 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
479 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
480 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
481 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
482 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
483 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
484 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
485 639633007 Azoarcus olearius BH72 Isolate Unclassified
486 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
487 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
488 8005275841 Rhizobium sp. N4311 Isolate Nodule
489 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
490 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
491 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
492 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
493 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
494 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
495 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
496 8018176218 Rhizobium sp. N122 Isolate Nodule
497 8024501048 Rhizobium sp. H4 Isolate Nodule
498 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
499 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.17
Metatranscriptomes 3.76
Isolates 19.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.78
Nodule 14.16
Rhizoplane 3.76
Rhizosphere 64.74
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10223600 3300028800 Bacteria 1405
2 JGI24746J21847_1020172 3300001977 Bacteria 936
3 JGI24739J22299_10056948 3300001989 Bacteria 1245
4 JGI25162J39368_1008911 3300002737 Bacteria 1391
5 JGI25154J39366_1000539 3300002738 Bacteria 18841
6 JGI25157J39369_1000018 3300002741 Bacteria 177410
7 JGI25159J45721_1008197 3300002987 Bacteria 2898
8 JGI25151J46595_10000340 3300003187 Bacteria 50006
9 JGI25153J46596_10022598 3300003215 Bacteria 2312
10 Ga0006770J48903_1073083 3300003305 Bacteria 550
11 rootH1_10008298 3300003316 Bacteria 7116
12 rootH1_10008298 3300003323 Bacteria 13422
13 rootH1_10017599 3300003316 Bacteria 8038
14 rootL2_10077243 3300003322 Bacteria 9028
15 JGI25160J50197_1000767 3300003354 Bacteria 17314
16 Ga0055539_1000437 3300003752 Bacteria 14566
17 Ga0055539_1001061 3300003752 Bacteria 5842
18 Ga0055533_1000011 3300003756 Bacteria 467893
19 Ga0055525_1000691 3300003759 Bacteria 12485
20 Ga0055535_1009861 3300003761 Bacteria 1611
21 Ga0055536_1001503 3300003781 Bacteria 14011
22 Ga0055540_1005504 3300003792 Bacteria 5299
23 Ga0058863_11714636 3300004799 Bacteria 701
24 Ga0058860_11994122 3300004801 Bacteria 1092
25 Ga0058860_12025189 3300004801 Bacteria 1529
26 Ga0065704_10121329 3300005289 Bacteria 1768
27 Ga0065712_10007612 3300005290 Bacteria 4322
28 Ga0065712_10443677 3300005290 Bacteria 692
29 Ga0065715_10011248 3300005293 Bacteria 2386
30 Ga0065715_10107974 3300005293 Bacteria 2741
31 Ga0065707_10174252 3300005295 Bacteria 1462
32 Ga0070658_10690559 3300005327 Bacteria 886
33 Ga0070683_100000387 3300005329 Bacteria 30469
34 Ga0070683_100089142 3300005329 Bacteria 2895
35 Ga0070690_100001642 3300005330 Bacteria 11759
36 Ga0070670_100032038 3300005331 Bacteria 4526
37 Ga0070670_100491359 3300005331 Bacteria 1091
38 Ga0070670_100806480 3300005331 Bacteria 848
39 Ga0068869_100029452 3300005334 Bacteria 3847
40 Ga0070666_10142274 3300005335 Bacteria 1671
41 Ga0070682_100808671 3300005337 Bacteria 762
42 Ga0068868_100094804 3300005338 Bacteria 2408
43 Ga0068868_100350634 3300005338 Bacteria 1264
44 Ga0070660_100833273 3300005339 Bacteria 776
45 Ga0070689_100001730 3300005340 Bacteria 13955
46 Ga0070689_100391515 3300005340 Bacteria 1173
47 Ga0070689_100809673 3300005340 Bacteria 824
48 Ga0070661_100142807 3300005344 Bacteria 1805
49 Ga0070668_100006994 3300005347 Bacteria 8361
50 Ga0070669_100000810 3300005353 Bacteria 22749
51 Ga0070669_100563751 3300005353 Bacteria 951
52 Ga0070675_100018854 3300005354 Bacteria 5494
53 Ga0070675_100519511 3300005354 Bacteria 1074
54 Ga0070675_100544653 3300005354 Bacteria 1049
55 Ga0070671_100032811 3300005355 Bacteria 4292
56 Ga0070671_100837463 3300005355 Bacteria 802
57 Ga0070671_101040503 3300005355 Bacteria 718
58 Ga0070688_100297510 3300005365 Bacteria 1165
59 Ga0070659_100445203 3300005366 Bacteria 1098
60 Ga0070659_101053508 3300005366 Bacteria 715
61 Ga0070667_100087043 3300005367 Bacteria 2681
62 Ga0070711_101221980 3300005439 Bacteria 650
63 Ga0070708_100829694 3300005445 Unclassified 869
64 Ga0070663_100022964 3300005455 Bacteria 4176
65 Ga0070678_100312544 3300005456 Bacteria 1339
66 Ga0070662_100126089 3300005457 Bacteria 1968
67 Ga0068867_100478716 3300005459 Bacteria 1066
68 Ga0070707_100191004 3300005468 Bacteria 1997
69 Ga0070698_100515477 3300005471 Bacteria 1134
70 Ga0070699_100037802 3300005518 Unclassified 4179
71 Ga0070679_100417650 3300005530 Bacteria 1287
72 Ga0070684_100000221 3300005535 Bacteria 39898
73 Ga0070697_100006665 3300005536 Bacteria 8957
74 Ga0068853_100539418 3300005539 Bacteria 1104
75 Ga0070672_100219876 3300005543 Bacteria 1593
76 Ga0070672_100300810 3300005543 Bacteria 1360
77 Ga0070686_100172160 3300005544 Bacteria 1532
78 Ga0070686_100314922 3300005544 Bacteria 1165
79 Ga0070695_100344913 3300005545 Bacteria 1114
80 Ga0070696_100479588 3300005546 Bacteria 986
81 Ga0070665_100114464 3300005548 Bacteria 2700
82 Ga0070665_100190780 3300005548 Bacteria 2050
83 Ga0070665_100411879 3300005548 Bacteria 1360
84 Ga0068855_100002070 3300005563 Bacteria 24846
85 Ga0068855_100096411 3300005563 Bacteria 3408
86 Ga0068855_101105248 3300005563 Bacteria 828
87 Ga0070664_100001047 3300005564 Bacteria 21733
88 Ga0070664_100211037 3300005564 Bacteria 1735
89 Ga0068857_100012736 3300005577 Bacteria 7329
90 Ga0068857_100013094 3300005577 Bacteria 7228
91 Ga0068856_100003249 3300005614 Bacteria 16544
92 Ga0068856_100067645 3300005614 Bacteria 3530
93 Ga0068856_100321156 3300005614 Bacteria 1565
94 Ga0068856_101435215 3300005614 Bacteria 704
95 Ga0070702_100070087 3300005615 Bacteria 2068
96 Ga0070702_100135005 3300005615 Bacteria 1564
97 Ga0068852_101368889 3300005616 Bacteria 730
98 Ga0068859_100902597 3300005617 Bacteria 968
99 Ga0068864_100210475 3300005618 Bacteria 1790
100 Ga0068861_100011157 3300005719 Bacteria 6239
101 Ga0068851_10127117 3300005834 Bacteria 1375
102 Ga0068858_100042506 3300005842 Bacteria 4214
103 Ga0068858_100228354 3300005842 Bacteria 1764
104 Ga0068862_100238646 3300005844 Bacteria 1652
105 Ga0081455_10499960 3300005937 Bacteria 817
106 Ga0081540_1046343 3300005983 Bacteria 2196
107 Ga0075363_100563875 3300006048 Bacteria 680
108 Ga0075364_10001642 3300006051 Bacteria 12275
109 Ga0070716_100364728 3300006173 Bacteria 1027
110 Ga0070712_100268044 3300006175 Bacteria 1371
111 Ga0075366_10132709 3300006195 Bacteria 1503
112 Ga0097621_100119281 3300006237 Bacteria 2236
113 Ga0068871_100580109 3300006358 Bacteria 1018
114 Ga0075428_100020972 3300006844 Bacteria 7238
115 Ga0075428_100124334 3300006844 Bacteria 2808
116 Ga0075428_100299789 3300006844 Bacteria 1728
117 Ga0075428_100942295 3300006844 Bacteria 915
118 Ga0075430_100000716 3300006846 Bacteria 25364
119 Ga0075431_100020300 3300006847 Bacteria 6786
120 Ga0075431_100290211 3300006847 Bacteria 1655
121 Ga0075431_100638363 3300006847 Bacteria 1046
122 Ga0075433_10052359 3300006852 Bacteria 3557
123 Ga0075434_100108516 3300006871 Bacteria 2786
124 Ga0075434_101061046 3300006871 Bacteria 824
125 Ga0075429_100005556 3300006880 Bacteria 10861
126 Ga0075429_100021139 3300006880 Bacteria 5642
127 Ga0075429_100164669 3300006880 Bacteria 1942
128 Ga0075429_100475425 3300006880 Bacteria 1095
129 Ga0068865_100692750 3300006881 Bacteria 870
130 Ga0097620_100902643 3300006931 Bacteria 968
131 Ga0105251_10315113 3300009011 Bacteria 710
132 Ga0105244_10038121 3300009036 Bacteria 2508
133 Ga0105244_10244760 3300009036 Bacteria 837
134 Ga0105250_10055792 3300009092 Bacteria 1585
135 Ga0105240_10138124 3300009093 Bacteria 2916
136 Ga0105240_10344605 3300009093 Bacteria 1692
137 Ga0105240_10417581 3300009093 Bacteria 1508
138 Ga0111539_10007570 3300009094 Bacteria 13881
139 Ga0111539_10332414 3300009094 Bacteria 1769
140 Ga0111539_11075457 3300009094 Bacteria 935
141 Ga0105245_10039092 3300009098 Bacteria 4223
142 Ga0114129_10015179 3300009147 Bacteria 10963
143 Ga0114129_10246155 3300009147 Bacteria 2402
144 Ga0114129_10711678 3300009147 Bacteria 1290
145 Ga0105243_10002392 3300009148 Bacteria 15724
146 Ga0105243_10884629 3300009148 Bacteria 887
147 Ga0105241_10113847 3300009174 Bacteria 2169
148 Ga0105241_10326067 3300009174 Bacteria 1326
149 Ga0105248_10045882 3300009177 Bacteria 4899
150 Ga0105248_10726498 3300009177 Bacteria 1120
151 Ga0105237_10025360 3300009545 Bacteria 6063
152 Ga0105237_11038102 3300009545 Bacteria 826
153 Ga0105238_10007111 3300009551 Bacteria 11199
154 Ga0105249_10002713 3300009553 Bacteria 15297
155 Ga0123341_1006170 3300009765 Bacteria 10805
156 Ga0123342_1018906 3300009766 Bacteria 5372
157 Ga0123342_1027741 3300009766 Bacteria 3132
158 Ga0105239_10284729 3300010375 Bacteria 1861
159 Ga0105239_10538941 3300010375 Bacteria 1329
160 Ga0105239_10756639 3300010375 Bacteria 1112
161 Ga0105239_11338040 3300010375 Bacteria 826
162 Ga0105246_10004710 3300011119 Bacteria 8304
163 Ga0105246_10017444 3300011119 Bacteria 4562
164 Ga0157373_10068497 3300013100 Bacteria 2508
165 Ga0157373_11080308 3300013100 Bacteria 601
166 Ga0157371_10310175 3300013102 Bacteria 1143
167 Ga0157371_10330882 3300013102 Bacteria 1107
168 Ga0157370_10120323 3300013104 Bacteria 2451
169 Ga0157370_10646277 3300013104 Bacteria 967
170 Ga0157369_10015923 3300013105 Bacteria 8467
171 Ga0157369_10053690 3300013105 Bacteria 4354
172 Ga0157369_10582141 3300013105 Bacteria 1156
173 Ga0157374_10036487 3300013296 Bacteria 4503
174 Ga0157374_10114702 3300013296 Bacteria 2594
175 Ga0157378_10029581 3300013297 Bacteria 4837
176 Ga0157378_11296510 3300013297 Unclassified 769
177 Ga0163162_10001320 3300013306 Bacteria 23166
178 Ga0163162_10252643 3300013306 Bacteria 1895
179 Ga0157372_10134794 3300013307 Bacteria 2843
180 Ga0157372_10171417 3300013307 Bacteria 2511
181 Ga0157375_10013045 3300013308 Bacteria 7384
182 Ga0157375_10984314 3300013308 Bacteria 984
183 Ga0157375_11198331 3300013308 Bacteria 891
184 Ga0163163_10073601 3300014325 Bacteria 3408
185 Ga0182008_10011812 3300014497 Bacteria 4631
186 Ga0182008_10067121 3300014497 Bacteria 1765
187 Ga0182008_10074079 3300014497 Bacteria 1675
188 Ga0157377_10778261 3300014745 Bacteria 703
189 Ga0157379_10141281 3300014968 Bacteria 2170
190 Ga0157376_10234776 3300014969 Bacteria 1705
191 Ga0157376_11957041 3300014969 Bacteria 623
192 Ga0182006_1046717 3300015261 Bacteria 1681
193 Ga0182007_10028397 3300015262 Bacteria 1922
194 Ga0163161_10000161 3300017792 Bacteria 61815
195 Ga0163161_10023197 3300017792 Bacteria 4374
196 Ga0163161_10118567 3300017792 Bacteria 1986
197 Ga0206352_10308299 3300020078 Bacteria 741
198 Ga0213872_10013913 3300021361 Unclassified 3761
199 Ga0213872_10035024 3300021361 Bacteria 2296
200 Ga0213874_10177113 3300021377 Bacteria 757
201 Ga0213874_10202220 3300021377 Bacteria 715
202 Ga0213876_10008738 3300021384 Bacteria 5473
203 Ga0213876_10032007 3300021384 Bacteria 2774
204 Ga0213875_10062661 3300021388 Bacteria 1739
205 Ga0213871_10030033 3300021441 Bacteria 1412
206 Ga0247553_100425 3300023672 Bacteria 1511
207 Ga0209760_106254 3300025207 Bacteria 955
208 Ga0209674_100003 3300025226 Bacteria 2196646
209 Ga0209674_100104 3300025226 Bacteria 154080
210 Ga0209672_100009 3300025228 Bacteria 883623
211 Ga0209563_100010 3300025230 Bacteria 1337457
212 Ga0209437_100035 3300025233 Bacteria 481110
213 Ga0209258_100011 3300025242 Bacteria 867542
214 Ga0209258_101616 3300025242 Bacteria 7335
215 Ga0209646_1000188 3300025246 Bacteria 76972
216 Ga0209026_1000033 3300025250 Bacteria 318512
217 Ga0209677_100068 3300025253 Bacteria 146135
218 Ga0209677_100159 3300025253 Bacteria 61322
219 Ga0209677_101949 3300025253 Bacteria 8239
220 Ga0209148_1000013 3300025254 Bacteria 956684
221 Ga0209759_1000024 3300025256 Bacteria 318512
222 Ga0207666_1005952 3300025271 Bacteria 1570
223 Ga0209455_1000012 3300025272 Bacteria 867234
224 Ga0209455_1039536 3300025272 Bacteria 727
225 Ga0209130_1000252 3300025284 Bacteria 67611
226 Ga0209676_1000361 3300025292 Bacteria 85925
227 Ga0209025_1000633 3300025294 Bacteria 62208
228 Ga0209758_1002743 3300025297 Bacteria 17298
229 Ga0207426_1000098 3300025302 Bacteria 264264
230 Ga0209051_1000184 3300025303 Bacteria 112134
231 Ga0209257_1014244 3300025304 Bacteria 3434
232 Ga0207656_10080509 3300025321 Bacteria 1463
233 Ga0207696_1003005 3300025711 Bacteria 7881
234 Ga0207655_1005696 3300025728 Bacteria 8419
235 Ga0207713_1000001 3300025735 Bacteria 2295391
236 Ga0207713_1000191 3300025735 Bacteria 85634
237 Ga0207713_1092495 3300025735 Bacteria 1060
238 Ga0207688_10126059 3300025901 Bacteria 1497
239 Ga0207680_10114877 3300025903 Bacteria 1752
240 Ga0207643_10125518 3300025908 Bacteria 1523
241 Ga0207684_11056103 3300025910 Bacteria 678
242 Ga0207654_10061360 3300025911 Bacteria 2200
243 Ga0207654_10406732 3300025911 Bacteria 947
244 Ga0207695_10000367 3300025913 Bacteria 103313
245 Ga0207695_10009048 3300025913 Bacteria 12379
246 Ga0207695_10096782 3300025913 Bacteria 2953
247 Ga0207695_10320613 3300025913 Bacteria 1439
248 Ga0207671_10033198 3300025914 Bacteria 3840
249 Ga0207693_10257805 3300025915 Bacteria 1368
250 Ga0207693_10274949 3300025915 Unclassified 1320
251 Ga0207663_10924975 3300025916 Bacteria 698
252 Ga0207657_10050442 3300025919 Bacteria 3622
253 Ga0207649_10449572 3300025920 Bacteria 972
254 Ga0207652_10299642 3300025921 Bacteria 1451
255 Ga0207646_10157502 3300025922 Bacteria 2049
256 Ga0207646_10192556 3300025922 Bacteria 1842
257 Ga0207681_10003328 3300025923 Bacteria 10062
258 Ga0207694_10441111 3300025924 Bacteria 1086
259 Ga0207650_10021599 3300025925 Bacteria 4548
260 Ga0207650_10202213 3300025925 Bacteria 1592
261 Ga0207659_10014095 3300025926 Bacteria 5147
262 Ga0207659_10200081 3300025926 Bacteria 1595
263 Ga0207664_10166103 3300025929 Bacteria 1886
264 Ga0207644_10024515 3300025931 Bacteria 4143
265 Ga0207644_10758387 3300025931 Bacteria 811
266 Ga0207690_10519281 3300025932 Bacteria 965
267 Ga0207706_10446359 3300025933 Bacteria 1119
268 Ga0207709_10001520 3300025935 Bacteria 16003
269 Ga0207709_10224695 3300025935 Bacteria 1356
270 Ga0207670_10001268 3300025936 Bacteria 13343
271 Ga0207670_10364038 3300025936 Bacteria 1148
272 Ga0207704_10693974 3300025938 Bacteria 842
273 Ga0207665_10023132 3300025939 Bacteria 4093
274 Ga0207665_10129343 3300025939 Bacteria 1791
275 Ga0207691_10155232 3300025940 Bacteria 2010
276 Ga0207691_10176513 3300025940 Bacteria 1868
277 Ga0207711_10024965 3300025941 Bacteria 5013
278 Ga0207711_10055594 3300025941 Bacteria 3398
279 Ga0207689_10014798 3300025942 Bacteria 6623
280 Ga0207661_10001828 3300025944 Bacteria 14543
281 Ga0207661_10759338 3300025944 Bacteria 893
282 Ga0207679_10000614 3300025945 Bacteria 23779
283 Ga0207667_10053462 3300025949 Bacteria 4250
284 Ga0207712_10021071 3300025961 Bacteria 4275
285 Ga0207668_10133391 3300025972 Bacteria 1899
286 Ga0207658_10135093 3300025986 Bacteria 1987
287 Ga0207658_11528736 3300025986 Bacteria 610
288 Ga0207677_10464250 3300026023 Bacteria 1087
289 Ga0207703_10194438 3300026035 Bacteria 1799
290 Ga0207708_10335657 3300026075 Bacteria 1237
291 Ga0207702_10000553 3300026078 Bacteria 41640
292 Ga0207702_10010507 3300026078 Bacteria 7743
293 Ga0207702_10748049 3300026078 Bacteria 965
294 Ga0207674_10004589 3300026116 Bacteria 16584
295 Ga0207674_10018697 3300026116 Bacteria 7524
296 Ga0207675_100042747 3300026118 Bacteria 4231
297 Ga0207683_10297604 3300026121 Bacteria 1476
298 Ga0207698_10054912 3300026142 Bacteria 3067
299 Ga0209371_1002254 3300027312 Bacteria 11080
300 Ga0209371_1003244 3300027312 Bacteria 8116
301 Ga0207428_10074873 3300027907 Bacteria 2654
302 Ga0268266_10514215 3300028379 Bacteria 1144
303 Ga0268266_10601452 3300028379 Bacteria 1056
304 Ga0268266_10774798 3300028379 Bacteria 926
305 Ga0268265_10097078 3300028380 Bacteria 2370
306 Ga0268264_10529128 3300028381 Bacteria 1153
307 Ga0268264_11157188 3300028381 Bacteria 783
308 Ga0268256_1001589 3300030500 Bacteria 13256
309 Ga0265768_100242 3300030963 Bacteria 2021
310 Ga0265327_10007638 3300031251 Bacteria 8287
311 Ga0265316_10043108 3300031344 Bacteria 3601
312 Ga0265316_10069217 3300031344 Bacteria 2724
313 Ga0265316_10222637 3300031344 Bacteria 1392
314 Ga0316579_10013986 3300031691 Bacteria 3461
315 Ga0316579_10041831 3300031691 Bacteria 2127
316 Ga0316576_10009927 3300031727 Bacteria 6162
317 Ga0316576_10092149 3300031727 Bacteria 2258
318 Ga0316576_10170496 3300031727 Bacteria 1642
319 Ga0316576_10170499 3300031727 Bacteria 1642
320 Ga0316578_10179341 3300031728 Bacteria 1276
321 Ga0316578_10301757 3300031728 Bacteria 957
322 Ga0316577_10041335 3300031733 Bacteria 2579
323 Ga0316577_10051452 3300031733 Bacteria 2298
324 Ga0307412_10016003 3300031911 Bacteria 4457
325 Ga0307414_10098255 3300032004 Bacteria 2196
326 Ga0316583_10033426 3300032133 Bacteria 1827
327 Ga0316583_10173901 3300032133 Bacteria 749
328 Ga0316585_10005378 3300032137 Bacteria 3612
329 Ga0316580_10001491 3300032139 Bacteria 6134
330 Ga0316593_10000488 3300032168 Bacteria 7342
331 Ga0316593_10020556 3300032168 Bacteria 2054
332 Ga0316592_1001006 3300033524 Bacteria 4353
333 Ga0316592_1002951 3300033524 Bacteria 3003
334 Ga0316592_1003160 3300033524 Bacteria 2937
335 Ga0316592_1042423 3300033524 Bacteria 1008
336 Ga0316592_1046781 3300033524 Unclassified 963
337 Ga0316592_1085722 3300033524 Bacteria 718
338 Ga0316586_1002585 3300033527 Bacteria 2276
339 Ga0316586_1029737 3300033527 Bacteria 931
340 Ga0316588_1018969 3300033528 Bacteria 1545
341 Ga0316588_1021639 3300033528 Bacteria 1464
342 Ga0316587_1001414 3300033529 Bacteria 2949
343 Ga0316596_1029621 3300033541 Bacteria 1417
344 Ga0373934_0002760 3300035086 Bacteria 6439
345 Ga0316574_0007153 3300035398 Bacteria 6101
346 Ga0316574_0016600 3300035398 Bacteria 4293
347 Ga0316584_0416826 3300036712 Bacteria 954
348 Ga0395900_0237124 3300037418 Bacteria 1832
349 Ga0395898_0433956 3300037466 Bacteria 1252
350 Ga0316581_0121049 3300037588 Bacteria 807
351 Ga0316581_0165608 3300037588 Bacteria 681
352 Ga0436364_0037831 3300037853 Bacteria 3819
353 Ga0436364_1085191 3300037853 Bacteria 15736
354 Ga0395901_0020370 3300038443 Bacteria 6790
355 Ga0395901_0818530 3300038443 Bacteria 919
356 Ga0400485_05534 3300038735 Bacteria 1644
357 Ga0400483_199082 3300039062 Bacteria 3226
358 Ga0400489_37544 3300039093 Bacteria 5843
359 Ga0400487_10280 3300039110 Bacteria 138613
360 Ga0400487_17580 3300039110 Bacteria 5719
361 Ga0400487_41326 3300039110 Bacteria 1229
362 Ga0436365_0647074 3300039437 Bacteria 3335
363 Ga0436365_1112230 3300039437 Bacteria 19675
364 Ga0436365_1625636 3300039437 Bacteria 6413
365 Ga0436360_0122311 3300039438 Bacteria 6258
366 Ga0436360_0619086 3300039438 Bacteria 1074
367 Ga0436360_0735944 3300039438 Bacteria 5963
368 Ga0436360_0885445 3300039438 Bacteria 1485
369 Ga0436360_1317915 3300039438 Bacteria 1677
370 Ga0436361_0013250 3300039447 Bacteria 11384
371 Ga0436361_0193310 3300039447 Bacteria 2431
372 Ga0436361_0294503 3300039447 Bacteria 2459
373 Ga0436361_0298641 3300039447 Bacteria 4915
374 Ga0436361_0528059 3300039447 Bacteria 2892
375 Ga0436361_0740948 3300039447 Bacteria 4091
376 Ga0436363_0479409 3300039450 Bacteria 7404
377 Ga0436363_1298424 3300039450 Bacteria 747
378 Ga0436363_1688978 3300039450 Bacteria 1769
379 Ga0436362_0579570 3300039453 Bacteria 1200
380 Ga0436362_0829410 3300039453 Bacteria 1298
381 Ga0436362_0999886 3300039453 Bacteria 1176
382 Ga0436362_1117703 3300039453 Bacteria 1405
383 Ga0439436_0003170 3300041404 Bacteria 4986
384 Ga0439438_038442 3300041405 Bacteria 1249
385 Ga0439439_0015255 3300041406 Bacteria 1874
386 Ga0439466_0000057 3300041411 Bacteria 45095
387 Ga0439465_0007042 3300041413 Bacteria 3573
388 Ga0439465_0197813 3300041413 Bacteria 732
389 Ga0451839_0778740 3300041496 Bacteria 599
390 Ga0451841_0317458 3300041498 Bacteria 1381
391 Ga0439431_0008305 3300041997 Bacteria 2332
392 Ga0439432_107314 3300042006 Bacteria 832
393 Ga0439449_0001163 3300042007 Bacteria 10312
394 Ga0439452_020204 3300042010 Bacteria 1750
395 Ga0439457_009092 3300042014 Bacteria 2320
396 Ga0439462_0006135 3300042015 Bacteria 2979
397 Ga0439463_054315 3300042016 Bacteria 1022
398 Ga0450907_000087 3300042146 Bacteria 36820
399 Ga0439464_0011074 3300042439 Bacteria 2384
400 Ga0451577_0000645 3300042876 Bacteria 55477
401 Ga0451577_0005076 3300042876 Bacteria 13585
402 Ga0453684_0000625 3300044712 Bacteria 128854
403 Ga0453684_0005496 3300044712 Bacteria 25046
404 Ga0453684_0151515 3300044712 Bacteria 2755
405 Ga0453684_2081223 3300044712 Bacteria 570
406 Ga0451576_0369423 3300045051 Bacteria 1503
407 Ga0451576_0504970 3300045051 Bacteria 1270
408 Ga0466967_0640524 3300045976 Bacteria 1051
409 Ga0466967_0671875 3300045976 Bacteria 1025
410 Ga0466967_1128638 3300045976 Bacteria 781
411 Ga0495617_000351 3300046452 Bacteria 25399
412 Ga0495627_004507 3300046453 Bacteria 5809
413 Ga0495590_0000330 3300046457 Bacteria 24619
414 Ga0495591_000771 3300046458 Bacteria 23136
415 Ga0495638_0017837 3300046460 Bacteria 4724
416 Ga0495650_0049242 3300046471 Bacteria 1751
417 Ga0495605_0002234 3300046474 Bacteria 12096
418 Ga0495607_0015910 3300046501 Bacteria 4863
419 Ga0495607_0176321 3300046501 Bacteria 1075
420 Ga0495583_0301096 3300046506 Bacteria 637
421 Ga0495606_0001952 3300046507 Bacteria 25463
422 Ga0495606_0081511 3300046507 Bacteria 2011
423 Ga0495606_0213863 3300046507 Bacteria 1090
424 Ga0495610_0043936 3300046512 Bacteria 2222
425 Ga0495610_0071082 3300046512 Bacteria 1623
426 Ga0495632_0001068 3300046519 Bacteria 23479
427 Ga0495648_0011077 3300046524 Bacteria 6827
428 Ga0495648_0056432 3300046524 Bacteria 2363
429 Ga0495642_0145131 3300046528 Bacteria 1025
430 Ga0495667_0344900 3300046559 Bacteria 941
431 Ga0495611_0038153 3300046648 Bacteria 2136
432 Ga0495625_0111134 3300046660 Bacteria 1873
433 Ga0495635_0099457 3300046663 Bacteria 1988
434 Ga0495661_0000628 3300046665 Bacteria 35864
435 Ga0495669_0018905 3300046684 Bacteria 2968
436 Ga0495613_0172168 3300046689 Bacteria 1536
437 Ga0495670_0040760 3300046691 Bacteria 2316
438 Ga0495589_0040157 3300046794 Bacteria 2337
439 Ga0495660_0056313 3300046810 Bacteria 2124
440 Ga0495660_0140598 3300046810 Bacteria 1202
441 Ga0495636_0337480 3300047318 Bacteria 710
442 Ga0495674_0279321 3300047319 Bacteria 1368
443 Ga0495672_0000418 3300047320 Bacteria 51297
444 Ga0495683_0234612 3300047323 Bacteria 812
445 Ga0495675_0454107 3300047444 Bacteria 741
446 Ga0495679_002048 3300047446 Bacteria 10643
447 Ga0495679_047506 3300047446 Bacteria 1302
448 Ga0495685_143103 3300047447 Bacteria 778
449 Ga0495673_0062452 3300047469 Bacteria 1591
450 Ga0495673_0063322 3300047469 Bacteria 1577
451 Ga0495681_0029578 3300047470 Bacteria 2802
452 Ga0495684_0171327 3300047471 Unclassified 1614
453 Ga0495686_0026685 3300047472 Bacteria 3778
454 Ga0495626_0253806 3300048091 Bacteria 705
455 Ga0496100_0065607 3300048903 Bacteria 2406
456 Ga0496100_0271530 3300048903 Bacteria 1261
457 Ga0496101_0165589 3300048904 Bacteria 1697
458 Ga0496101_0364762 3300048904 Bacteria 1136
459 Ga0496102_0005459 3300048905 Bacteria 10782
460 Ga0496102_0029734 3300048905 Bacteria 4889
461 Ga0496103_0601470 3300048906 Bacteria 700
462 Ga0496104_0001980 3300048907 Bacteria 17748
463 Ga0496104_0261089 3300048907 Bacteria 1645
464 Ga0496105_0002026 3300048908 Bacteria 14644
465 Ga0496105_0127690 3300048908 Bacteria 2096
466 Ga0496105_0449582 3300048908 Bacteria 1017
467 Ga0496105_0650575 3300048908 Bacteria 813
468 Ga0496106_0181996 3300048909 Bacteria 1668
469 Ga0496107_0093129 3300048910 Bacteria 2203
470 Ga0496108_0008532 3300048911 Bacteria 8311
471 Ga0496108_0927943 3300048911 Bacteria 746
472 Ga0496109_0004929 3300048912 Bacteria 11141
473 Ga0496110_0000797 3300048913 Bacteria 22029
474 Ga0496111_0001605 3300048914 Bacteria 13078
475 Ga0496112_0002405 3300048915 Bacteria 15065
476 Ga0496113_0065318 3300048916 Bacteria 2754
477 Ga0496113_1016570 3300048916 Bacteria 652
478 Ga0496114_0432381 3300048917 Bacteria 1166
479 Ga0496116_0016892 3300048919 Bacteria 5691
480 Ga0496117_0000004 3300048920 Bacteria 877131
481 Ga0496117_0000602 3300048920 Bacteria 58964
482 Ga0496118_0000072 3300048921 Bacteria 201387
483 Ga0496118_0000232 3300048921 Bacteria 97818
484 Ga0496118_0059872 3300048921 Bacteria 2832
485 Ga0496119_0000064 3300048922 Bacteria 167571
486 Ga0496119_0004654 3300048922 Bacteria 13530
487 Ga0496120_0000067 3300048923 Bacteria 167571
488 Ga0496120_0000733 3300048923 Bacteria 48086
489 Ga0496121_0000047 3300048924 Bacteria 335768
490 Ga0496122_0001991 3300048925 Bacteria 30461
491 Ga0496122_0236883 3300048925 Bacteria 1032
492 Ga0496123_0000620 3300048926 Bacteria 59624
493 Ga0496123_0001262 3300048926 Bacteria 36371
494 Ga0496123_0093427 3300048926 Bacteria 1776
495 Ga0496124_0011554 3300048927 Bacteria 8811
496 Ga0496124_0020783 3300048927 Bacteria 6058
497 Ga0496124_0026780 3300048927 Bacteria 5191
498 Ga0496124_0067980 3300048927 Bacteria 2963
499 Ga0496125_0010211 3300048928 Bacteria 9519
500 Ga0496126_0094497 3300048929 Bacteria 2623
501 Ga0501305_045353 3300049161 Bacteria 725
502 Ga0495678_023508 3300049459 Bacteria 2677
503 Ga0495682_0118519 3300049460 Bacteria 948
504 Ga0501032_0010263 3300049569 Bacteria 6757
505 Ga0501033_0044696 3300049570 Bacteria 3297
506 Ga0501034_0000360 3300049571 Bacteria 77568
507 Ga0501036_0052069 3300049572 Bacteria 3467
508 Ga0501037_0017106 3300049573 Bacteria 5336
509 Ga0501038_0001066 3300049574 Bacteria 24743
510 Ga0501039_0057645 3300049575 Bacteria 3008
511 Ga0501040_0240972 3300049576 Bacteria 1289
512 Ga0501041_0337238 3300049577 Bacteria 952
513 Ga0501043_0141259 3300049579 Bacteria 1886
514 Ga0501043_0277487 3300049579 Bacteria 1285
515 Ga0501047_0051264 3300049581 Bacteria 3987
516 Ga0501070_0256868 3300049586 Bacteria 1429
517 Ga0501070_0892663 3300049586 Bacteria 694
518 Ga0501071_0043370 3300049587 Bacteria 3225
519 Ga0501072_0187412 3300049588 Bacteria 1650
520 Ga0501073_0086140 3300049589 Bacteria 2185
521 Ga0501073_0642243 3300049589 Bacteria 733
522 Ga0501075_0146537 3300049591 Bacteria 1799
523 Ga0501076_0126635 3300049592 Bacteria 2070
524 Ga0501077_0301729 3300049593 Bacteria 1020
525 Ga0501079_0020772 3300049741 Bacteria 5021
526 Ga0501080_0050121 3300049742 Bacteria 3887
527 Ga0501080_0419990 3300049742 Bacteria 1201
528 Ga0501081_0577002 3300049743 Bacteria 841
529 Ga0501035_0141518 3300049822 Bacteria 2091
530 Ga0501044_0751562 3300049823 Bacteria 857
531 Ga0501045_0079226 3300049824 Bacteria 2422
532 nmdc:mga00v17_573_c1 3300050491 Bacteria 20549
533 nmdc:mga00v17_6948_c2 3300050491 Bacteria 3215
534 nmdc:mga05p37_572542_c1 3300050507 Bacteria 1281
535 nmdc:mga05p37_767580_c1 3300050507 Bacteria 1060
536 nmdc:mga05p37_84853_c1 3300050507 Bacteria 3902
537 nmdc:mga09592_102526_c1 3300050508 Bacteria 2451
538 nmdc:mga09592_123224_c1 3300050508 Bacteria 2227
539 nmdc:mga09592_454_c1 3300050508 Bacteria 30435
540 nmdc:mga0qj67_3504_c1 3300050509 Bacteria 11318
541 nmdc:mga06r32_1074283_c1 3300050510 Bacteria 755
542 nmdc:mga06r32_4114_c1 3300050510 Bacteria 13027
543 nmdc:mga06r32_873478_c1 3300050510 Bacteria 857
544 nmdc:mga08y16_132674_c1 3300050511 Bacteria 2589
545 nmdc:mga08y16_6519_c1 3300050511 Bacteria 12241
546 nmdc:mga08y16_659104_c1 3300050511 Bacteria 1050
547 nmdc:mga0n895_419834_c1 3300050512 Bacteria 1352
548 nmdc:mga0n895_555639_c1 3300050512 Bacteria 1153
549 nmdc:mga0rr50_321004_c1 3300050513 Bacteria 1298
550 nmdc:mga0a205_81623_c1 3300050515 Bacteria 3123
551 Ga0495619_0225062 3300053085 Bacteria 1299
552 Ga0500568_0075403 3300053139 Bacteria 1286
553 Ga0500622_0009545 3300053156 Bacteria 5364
554 Ga0501084_0074109 3300054114 Bacteria 2850
555 Ga0587082_109187 3300059504 Bacteria 612
556 Ga0587085_024346 3300059506 Bacteria 948
557 Ga0587079_094509 3300059647 Bacteria 705
558 Ga0587105_014637 3300059651 Bacteria 637
559 Ga0501082_0108180 3300060353 Bacteria 2406
560 Ga0466962_0393800 3300061719 Bacteria 693
561 Ga0530510_0173840 3300061734 Bacteria 1596
562 2513636271 2513237093 Bacteria 7545552
563 2513988173 2513237156 Bacteria 6402557
564 2515744540 2515154134 Bacteria 7220242
565 2517081945 2516653085 Bacteria 7346596
566 2520381760 2519899620 Bacteria 6499161
567 2530649693 2529292951 Bacteria 6916614
568 2538833918 2537561836 Bacteria 3910579
569 2588513610 2588253730 Bacteria 6881675
570 2608669145 2608642108 Bacteria 4104624
571 2616298376 2615840624 Bacteria 6557588
572 2643831748 2643221562 Bacteria 4048635
573 2643896951 2643221577 Bacteria 3710843
574 2644479158 2643221685 Bacteria 3673288
575 2688393926 2687453341 Bacteria 6534136
576 2719178995 2718217882 Bacteria 6556348
577 2719383551 2718217927 Bacteria 6972593
578 2719663352 2718217997 Bacteria 6740740
579 2719729360 2718218009 Bacteria 6478651
580 2720488756 2718218199 Bacteria 6740745
581 2720615784 2718218232 Bacteria 6720332
582 2720633917 2718218235 Bacteria 6630699
583 2720777661 2718218269 Bacteria 6906114
584 2721027451 2718218334 Bacteria 4765486
585 2721143607 2718218363 Bacteria 6524337
586 2721155355 2718218365 Bacteria 6274507
587 2721166703 2718218366 Bacteria 6425255
588 2722837681 2721755514 Bacteria 6424414
589 2723031111 2721755556 Bacteria 6745503
590 2723563775 2721755684 Bacteria 6859907
591 2723570639 2721755685 Bacteria 6704835
592 2724041253 2721755810 Bacteria 6479005
593 2724087403 2721755819 Bacteria 6906405
594 2724102186 2721755822 Bacteria 6726041
595 2724107377 2721755823 Bacteria 6752556
596 2730104802 2728369352 Bacteria 6745171
597 2730161456 2728369365 Bacteria 6555560
598 2730296235 2728369397 Bacteria 6274511
599 2735836975 2734482264 Unclassified 5014763
600 2738822698 2738541296 Bacteria 7285013
601 2738834905 2738541298 Bacteria 7286732
602 2738876384 2738541306 Bacteria 7284992
603 2738947197 2738541317 Bacteria 5340176
604 2739188328 2738543002 Bacteria 7284546
605 2739222981 2738543008 Bacteria 7282815
606 2739226376 2738543009 Bacteria 4944499
607 2792751043 2791355123 Bacteria 8049106
608 2793299675 2791355256 Bacteria 6798008
609 2793318930 2791355259 Bacteria 7254731
610 2793325175 2791355260 Bacteria 6598818
611 2793331423 2791355261 Bacteria 6661293
612 2793338372 2791355262 Bacteria 6774204
613 2793343482 2791355263 Bacteria 6872478
614 2793351097 2791355264 Bacteria 6429314
615 2793357319 2791355265 Bacteria 6539969
616 2793364341 2791355266 Bacteria 7116587
617 2793371337 2791355267 Bacteria 7222458
618 2805931670 2802429605 Bacteria 6875453
619 2805937935 2802429606 Bacteria 6346811
620 2806049409 2802429633 Bacteria 7341974
621 2806063802 2802429635 Bacteria 7650140
622 2806071030 2802429636 Bacteria 7597525
623 2838022059 2838016132 Bacteria 6577831
624 2838027337 2838022645 Bacteria 6494267
625 2838054023 2838048938 Bacteria 6044578
626 2838066901 2838061910 Bacteria 6794874
627 2838674605 2838668709 Bacteria 6671819
628 2838700956 2838694306 Bacteria 6853137
629 2838707046 2838701080 Bacteria 6669771
630 2838736033 2838729681 Bacteria 7400765
631 2838748288 2838742623 Bacteria 7396178
632 2842083697 2842077413 Bacteria 6508645
633 2842124774 2842118031 Bacteria 7033875
634 2842151647 2842146304 Bacteria 5957337
635 2842203514 2842198810 Bacteria 6608673
636 2842210978 2842205361 Bacteria 6340321
637 2842223277 2842217011 Bacteria 7497767
638 2842236757 2842229732 Bacteria 7475766
639 2842249473 2842243621 Bacteria 7421798
640 2842256835 2842250916 Bacteria 6579627
641 2842263462 2842257432 Bacteria 7401195
642 2842270554 2842264693 Bacteria 6472963
643 2842284527 2842278818 Bacteria 6340002
644 2842290648 2842285085 Bacteria 6011953
645 2842297886 2842291075 Bacteria 7076806
646 2842317279 2842311132 Bacteria 6616990
647 2842323532 2842317721 Bacteria 6793725
648 2842347993 2842341865 Bacteria 7003929
649 2842369539 2842363717 Bacteria 6844742
650 2842377264 2842370503 Bacteria 7038661
651 2842384350 2842377471 Bacteria 7140707
652 2842391369 2842384541 Bacteria 7057858
653 2842402174 2842395702 Bacteria 6780583
654 2842408471 2842402390 Bacteria 6681310
655 2842414593 2842409023 Bacteria 6687331
656 2842421829 2842415677 Bacteria 6596907
657 2842434374 2842428310 Bacteria 6767288
658 2842440709 2842434925 Bacteria 6502746
659 2842447361 2842441272 Bacteria 6769273
660 2842453775 2842447887 Bacteria 6754142
661 2842468730 2842462802 Bacteria 6588055
662 2842475283 2842469257 Bacteria 6752936
663 2842495604 2842489311 Bacteria 6620893
664 2842502256 2842495871 Bacteria 6820686
665 2844530645 2844528606 Bacteria 4733806
666 2865018577 2865014394 Bacteria 4764573
667 2882637740 2882632389 Bacteria 8154593
668 2894512328 2894510363 Bacteria 5121143
669 2913312706 2913308742 Bacteria 5350706
670 2935907807 2935901341 Bacteria 7341747
671 2936386099 2936381700 Bacteria 7006523
672 2945911985 2945909444 Bacteria 7065066
673 2945940000 2945934425 Bacteria 7444609
674 2945953317 2945951305 Bacteria 4918162
675 2945986746 2945984333 Bacteria 7358892
676 2978975847 2978975091 Bacteria 4704313
677 2990707124 2990703756 Bacteria 7715990
678 3000377678 3000376612 Bacteria 4705565
679 639789062 639633007 Bacteria 4376040
680 642424080 641736151 Bacteria 7477263
681 8001523634 8001522603 Bacteria 4726425
682 8005276777 8005275841 Bacteria 6929066
683 8005286903 8005282627 Bacteria 6675747
684 8005310029 8005307578 Bacteria 7395396
685 8005435378 8005430974 Bacteria 6689030
686 8005625111 8005619151 Bacteria 7030230
687 8005628869 8005626139 Bacteria 6534237
688 8005674773 8005668836 Bacteria 6953162
689 8005699087 8005695170 Bacteria 6912330
690 8018182126 8018176218 Bacteria 6896178
691 8024504817 8024501048 Bacteria 6427847
692 8056379652 8056375014 Bacteria 7006639
693 8056385702 8056382006 Bacteria 6408074
694 Ga0265338_10223600
695 JGI24746J21847_1020172
696 JGI24739J22299_10056948
697 JGI25162J39368_1008911
698 JGI25154J39366_1000539
699 JGI25157J39369_1000018
700 JGI25159J45721_1008197
701 JGI25151J46595_10000340
702 JGI25153J46596_10022598
703 Ga0006770J48903_1073083
704 rootH1_10008298
705 rootH1_10017599
706 rootL2_10077243
707 JGI25160J50197_1000767
708 Ga0055539_1000437
709 Ga0055539_1001061
710 Ga0055533_1000011
711 Ga0055525_1000691
712 Ga0055535_1009861
713 Ga0055536_1001503
714 Ga0055540_1005504
715 Ga0058863_11714636
716 Ga0058860_11994122
717 Ga0058860_12025189
718 Ga0065704_10121329
719 Ga0065712_10007612
720 Ga0065712_10443677
721 Ga0065715_10011248
722 Ga0065715_10107974
723 Ga0065707_10174252
724 Ga0070658_10690559
725 Ga0070683_100000387
726 Ga0070683_100089142
727 Ga0070690_100001642
728 Ga0070670_100032038
729 Ga0070670_100491359
730 Ga0070670_100806480
731 Ga0068869_100029452
732 Ga0070666_10142274
733 Ga0070682_100808671
734 Ga0068868_100094804
735 Ga0068868_100350634
736 Ga0070660_100833273
737 Ga0070689_100001730
738 Ga0070689_100391515
739 Ga0070689_100809673
740 Ga0070661_100142807
741 Ga0070668_100006994
742 Ga0070669_100000810
743 Ga0070669_100563751
744 Ga0070675_100018854
745 Ga0070675_100519511
746 Ga0070675_100544653
747 Ga0070671_100032811
748 Ga0070671_100837463
749 Ga0070671_101040503
750 Ga0070688_100297510
751 Ga0070659_100445203
752 Ga0070659_101053508
753 Ga0070667_100087043
754 Ga0070711_101221980
755 Ga0070708_100829694
756 Ga0070663_100022964
757 Ga0070678_100312544
758 Ga0070662_100126089
759 Ga0068867_100478716
760 Ga0070707_100191004
761 Ga0070698_100515477
762 Ga0070699_100037802
763 Ga0070679_100417650
764 Ga0070684_100000221
765 Ga0070697_100006665
766 Ga0068853_100539418
767 Ga0070672_100219876
768 Ga0070672_100300810
769 Ga0070686_100172160
770 Ga0070686_100314922
771 Ga0070695_100344913
772 Ga0070696_100479588
773 Ga0070665_100114464
774 Ga0070665_100190780
775 Ga0070665_100411879
776 Ga0068855_100002070
777 Ga0068855_100096411
778 Ga0068855_101105248
779 Ga0070664_100001047
780 Ga0070664_100211037
781 Ga0068857_100012736
782 Ga0068857_100013094
783 Ga0068856_100003249
784 Ga0068856_100067645
785 Ga0068856_100321156
786 Ga0068856_101435215
787 Ga0070702_100070087
788 Ga0070702_100135005
789 Ga0068852_101368889
790 Ga0068859_100902597
791 Ga0068864_100210475
792 Ga0068861_100011157
793 Ga0068851_10127117
794 Ga0068858_100042506
795 Ga0068858_100228354
796 Ga0068862_100238646
797 Ga0081455_10499960
798 Ga0081540_1046343
799 Ga0075363_100563875
800 Ga0075364_10001642
801 Ga0070716_100364728
802 Ga0070712_100268044
803 Ga0075366_10132709
804 Ga0097621_100119281
805 Ga0068871_100580109
806 Ga0075428_100020972
807 Ga0075428_100124334
808 Ga0075428_100299789
809 Ga0075428_100942295
810 Ga0075430_100000716
811 Ga0075431_100020300
812 Ga0075431_100290211
813 Ga0075431_100638363
814 Ga0075433_10052359
815 Ga0075434_100108516
816 Ga0075434_101061046
817 Ga0075429_100005556
818 Ga0075429_100021139
819 Ga0075429_100164669
820 Ga0075429_100475425
821 Ga0068865_100692750
822 Ga0097620_100902643
823 Ga0105251_10315113
824 Ga0105244_10038121
825 Ga0105244_10244760
826 Ga0105250_10055792
827 Ga0105240_10138124
828 Ga0105240_10344605
829 Ga0105240_10417581
830 Ga0111539_10007570
831 Ga0111539_10332414
832 Ga0111539_11075457
833 Ga0105245_10039092
834 Ga0114129_10015179
835 Ga0114129_10246155
836 Ga0114129_10711678
837 Ga0105243_10002392
838 Ga0105243_10884629
839 Ga0105241_10113847
840 Ga0105241_10326067
841 Ga0105248_10045882
842 Ga0105248_10726498
843 Ga0105237_10025360
844 Ga0105237_11038102
845 Ga0105238_10007111
846 Ga0105249_10002713
847 Ga0123341_1006170
848 Ga0123342_1018906
849 Ga0123342_1027741
850 Ga0105239_10284729
851 Ga0105239_10538941
852 Ga0105239_10756639
853 Ga0105239_11338040
854 Ga0105246_10004710
855 Ga0105246_10017444
856 Ga0157373_10068497
857 Ga0157373_11080308
858 Ga0157371_10310175
859 Ga0157371_10330882
860 Ga0157370_10120323
861 Ga0157370_10646277
862 Ga0157369_10015923
863 Ga0157369_10053690
864 Ga0157369_10582141
865 Ga0157374_10036487
866 Ga0157374_10114702
867 Ga0157378_10029581
868 Ga0157378_11296510
869 Ga0163162_10001320
870 Ga0163162_10252643
871 Ga0157372_10134794
872 Ga0157372_10171417
873 Ga0157375_10013045
874 Ga0157375_10984314
875 Ga0157375_11198331
876 Ga0163163_10073601
877 Ga0182008_10011812
878 Ga0182008_10067121
879 Ga0182008_10074079
880 Ga0157377_10778261
881 Ga0157379_10141281
882 Ga0157376_10234776
883 Ga0157376_11957041
884 Ga0182006_1046717
885 Ga0182007_10028397
886 Ga0163161_10000161
887 Ga0163161_10023197
888 Ga0163161_10118567
889 Ga0206352_10308299
890 Ga0213872_10013913
891 Ga0213872_10035024
892 Ga0213874_10177113
893 Ga0213874_10202220
894 Ga0213876_10008738
895 Ga0213876_10032007
896 Ga0213875_10062661
897 Ga0213871_10030033
898 Ga0247553_100425
899 Ga0209760_106254
900 Ga0209674_100003
901 Ga0209674_100104
902 Ga0209672_100009
903 Ga0209563_100010
904 Ga0209437_100035
905 Ga0209258_100011
906 Ga0209258_101616
907 Ga0209646_1000188
908 Ga0209026_1000033
909 Ga0209677_100068
910 Ga0209677_100159
911 Ga0209677_101949
912 Ga0209148_1000013
913 Ga0209759_1000024
914 Ga0207666_1005952
915 Ga0209455_1000012
916 Ga0209455_1039536
917 Ga0209130_1000252
918 Ga0209676_1000361
919 Ga0209025_1000633
920 Ga0209758_1002743
921 Ga0207426_1000098
922 Ga0209051_1000184
923 Ga0209257_1014244
924 Ga0207656_10080509
925 Ga0207696_1003005
926 Ga0207655_1005696
927 Ga0207713_1000001
928 Ga0207713_1000191
929 Ga0207713_1092495
930 Ga0207688_10126059
931 Ga0207680_10114877
932 Ga0207643_10125518
933 Ga0207684_11056103
934 Ga0207654_10061360
935 Ga0207654_10406732
936 Ga0207695_10000367
937 Ga0207695_10009048
938 Ga0207695_10096782
939 Ga0207695_10320613
940 Ga0207671_10033198
941 Ga0207693_10257805
942 Ga0207693_10274949
943 Ga0207663_10924975
944 Ga0207657_10050442
945 Ga0207649_10449572
946 Ga0207652_10299642
947 Ga0207646_10157502
948 Ga0207646_10192556
949 Ga0207681_10003328
950 Ga0207694_10441111
951 Ga0207650_10021599
952 Ga0207650_10202213
953 Ga0207659_10014095
954 Ga0207659_10200081
955 Ga0207664_10166103
956 Ga0207644_10024515
957 Ga0207644_10758387
958 Ga0207690_10519281
959 Ga0207706_10446359
960 Ga0207709_10001520
961 Ga0207709_10224695
962 Ga0207670_10001268
963 Ga0207670_10364038
964 Ga0207704_10693974
965 Ga0207665_10023132
966 Ga0207665_10129343
967 Ga0207691_10155232
968 Ga0207691_10176513
969 Ga0207711_10024965
970 Ga0207711_10055594
971 Ga0207689_10014798
972 Ga0207661_10001828
973 Ga0207661_10759338
974 Ga0207679_10000614
975 Ga0207667_10053462
976 Ga0207712_10021071
977 Ga0207668_10133391
978 Ga0207658_10135093
979 Ga0207658_11528736
980 Ga0207677_10464250
981 Ga0207703_10194438
982 Ga0207708_10335657
983 Ga0207702_10000553
984 Ga0207702_10010507
985 Ga0207702_10748049
986 Ga0207674_10004589
987 Ga0207674_10018697
988 Ga0207675_100042747
989 Ga0207683_10297604
990 Ga0207698_10054912
991 Ga0209371_1002254
992 Ga0209371_1003244
993 Ga0207428_10074873
994 Ga0268266_10514215
995 Ga0268266_10601452
996 Ga0268266_10774798
997 Ga0268265_10097078
998 Ga0268264_10529128
999 Ga0268264_11157188
1000 Ga0268256_1001589
1001 Ga0265768_100242
1002 Ga0265327_10007638
1003 Ga0265316_10043108
1004 Ga0265316_10069217
1005 Ga0265316_10222637
1006 Ga0316579_10013986
1007 Ga0316579_10041831
1008 Ga0316576_10009927
1009 Ga0316576_10092149
1010 Ga0316576_10170496
1011 Ga0316576_10170499
1012 Ga0316578_10179341
1013 Ga0316578_10301757
1014 Ga0316577_10041335
1015 Ga0316577_10051452
1016 Ga0307412_10016003
1017 Ga0307414_10098255
1018 Ga0316583_10033426
1019 Ga0316583_10173901
1020 Ga0316585_10005378
1021 Ga0316580_10001491
1022 Ga0316593_10000488
1023 Ga0316593_10020556
1024 Ga0316592_1001006
1025 Ga0316592_1002951
1026 Ga0316592_1003160
1027 Ga0316592_1042423
1028 Ga0316592_1046781
1029 Ga0316592_1085722
1030 Ga0316586_1002585
1031 Ga0316586_1029737
1032 Ga0316588_1018969
1033 Ga0316588_1021639
1034 Ga0316587_1001414
1035 Ga0316596_1029621
1036 Ga0373934_0002760
1037 Ga0316574_0007153
1038 Ga0316574_0016600
1039 Ga0316584_0416826
1040 Ga0395900_0237124
1041 Ga0395898_0433956
1042 Ga0316581_0121049
1043 Ga0316581_0165608
1044 Ga0436364_0037831
1045 Ga0436364_1085191
1046 Ga0395901_0020370
1047 Ga0395901_0818530
1048 Ga0400485_05534
1049 Ga0400483_199082
1050 Ga0400489_37544
1051 Ga0400487_10280
1052 Ga0400487_17580
1053 Ga0400487_41326
1054 Ga0436365_0647074
1055 Ga0436365_1112230
1056 Ga0436365_1625636
1057 Ga0436360_0122311
1058 Ga0436360_0619086
1059 Ga0436360_0735944
1060 Ga0436360_0885445
1061 Ga0436360_1317915
1062 Ga0436361_0013250
1063 Ga0436361_0193310
1064 Ga0436361_0294503
1065 Ga0436361_0298641
1066 Ga0436361_0528059
1067 Ga0436361_0740948
1068 Ga0436363_0479409
1069 Ga0436363_1298424
1070 Ga0436363_1688978
1071 Ga0436362_0579570
1072 Ga0436362_0829410
1073 Ga0436362_0999886
1074 Ga0436362_1117703
1075 Ga0439436_0003170
1076 Ga0439438_038442
1077 Ga0439439_0015255
1078 Ga0439466_0000057
1079 Ga0439465_0007042
1080 Ga0439465_0197813
1081 Ga0451839_0778740
1082 Ga0451841_0317458
1083 Ga0439431_0008305
1084 Ga0439432_107314
1085 Ga0439449_0001163
1086 Ga0439452_020204
1087 Ga0439457_009092
1088 Ga0439462_0006135
1089 Ga0439463_054315
1090 Ga0450907_000087
1091 Ga0439464_0011074
1092 Ga0451577_0000645
1093 Ga0451577_0005076
1094 Ga0453684_0000625
1095 Ga0453684_0005496
1096 Ga0453684_0151515
1097 Ga0453684_2081223
1098 Ga0451576_0369423
1099 Ga0451576_0504970
1100 Ga0466967_0640524
1101 Ga0466967_0671875
1102 Ga0466967_1128638
1103 Ga0495617_000351
1104 Ga0495627_004507
1105 Ga0495590_0000330
1106 Ga0495591_000771
1107 Ga0495638_0017837
1108 Ga0495650_0049242
1109 Ga0495605_0002234
1110 Ga0495607_0015910
1111 Ga0495607_0176321
1112 Ga0495583_0301096
1113 Ga0495606_0001952
1114 Ga0495606_0081511
1115 Ga0495606_0213863
1116 Ga0495610_0043936
1117 Ga0495610_0071082
1118 Ga0495632_0001068
1119 Ga0495648_0011077
1120 Ga0495648_0056432
1121 Ga0495642_0145131
1122 Ga0495667_0344900
1123 Ga0495611_0038153
1124 Ga0495625_0111134
1125 Ga0495635_0099457
1126 Ga0495661_0000628
1127 Ga0495669_0018905
1128 Ga0495613_0172168
1129 Ga0495670_0040760
1130 Ga0495589_0040157
1131 Ga0495660_0056313
1132 Ga0495660_0140598
1133 Ga0495636_0337480
1134 Ga0495674_0279321
1135 Ga0495672_0000418
1136 Ga0495683_0234612
1137 Ga0495675_0454107
1138 Ga0495679_002048
1139 Ga0495679_047506
1140 Ga0495685_143103
1141 Ga0495673_0062452
1142 Ga0495673_0063322
1143 Ga0495681_0029578
1144 Ga0495684_0171327
1145 Ga0495686_0026685
1146 Ga0495626_0253806
1147 Ga0496100_0065607
1148 Ga0496100_0271530
1149 Ga0496101_0165589
1150 Ga0496101_0364762
1151 Ga0496102_0005459
1152 Ga0496102_0029734
1153 Ga0496103_0601470
1154 Ga0496104_0001980
1155 Ga0496104_0261089
1156 Ga0496105_0002026
1157 Ga0496105_0127690
1158 Ga0496105_0449582
1159 Ga0496105_0650575
1160 Ga0496106_0181996
1161 Ga0496107_0093129
1162 Ga0496108_0008532
1163 Ga0496108_0927943
1164 Ga0496109_0004929
1165 Ga0496110_0000797
1166 Ga0496111_0001605
1167 Ga0496112_0002405
1168 Ga0496113_0065318
1169 Ga0496113_1016570
1170 Ga0496114_0432381
1171 Ga0496116_0016892
1172 Ga0496117_0000004
1173 Ga0496117_0000602
1174 Ga0496118_0000072
1175 Ga0496118_0000232
1176 Ga0496118_0059872
1177 Ga0496119_0000064
1178 Ga0496119_0004654
1179 Ga0496120_0000067
1180 Ga0496120_0000733
1181 Ga0496121_0000047
1182 Ga0496122_0001991
1183 Ga0496122_0236883
1184 Ga0496123_0000620
1185 Ga0496123_0001262
1186 Ga0496123_0093427
1187 Ga0496124_0011554
1188 Ga0496124_0020783
1189 Ga0496124_0026780
1190 Ga0496124_0067980
1191 Ga0496125_0010211
1192 Ga0496126_0094497
1193 Ga0501305_045353
1194 Ga0495678_023508
1195 Ga0495682_0118519
1196 Ga0501032_0010263
1197 Ga0501033_0044696
1198 Ga0501034_0000360
1199 Ga0501036_0052069
1200 Ga0501037_0017106
1201 Ga0501038_0001066
1202 Ga0501039_0057645
1203 Ga0501040_0240972
1204 Ga0501041_0337238
1205 Ga0501043_0141259
1206 Ga0501043_0277487
1207 Ga0501047_0051264
1208 Ga0501070_0256868
1209 Ga0501070_0892663
1210 Ga0501071_0043370
1211 Ga0501072_0187412
1212 Ga0501073_0086140
1213 Ga0501073_0642243
1214 Ga0501075_0146537
1215 Ga0501076_0126635
1216 Ga0501077_0301729
1217 Ga0501079_0020772
1218 Ga0501080_0050121
1219 Ga0501080_0419990
1220 Ga0501081_0577002
1221 Ga0501035_0141518
1222 Ga0501044_0751562
1223 Ga0501045_0079226
1224 nmdc:mga00v17_573_c1
1225 nmdc:mga00v17_6948_c2
1226 nmdc:mga05p37_572542_c1
1227 nmdc:mga05p37_767580_c1
1228 nmdc:mga05p37_84853_c1
1229 nmdc:mga09592_102526_c1
1230 nmdc:mga09592_123224_c1
1231 nmdc:mga09592_454_c1
1232 nmdc:mga0qj67_3504_c1
1233 nmdc:mga06r32_1074283_c1
1234 nmdc:mga06r32_4114_c1
1235 nmdc:mga06r32_873478_c1
1236 nmdc:mga08y16_132674_c1
1237 nmdc:mga08y16_6519_c1
1238 nmdc:mga08y16_659104_c1
1239 nmdc:mga0n895_419834_c1
1240 nmdc:mga0n895_555639_c1
1241 nmdc:mga0rr50_321004_c1
1242 nmdc:mga0a205_81623_c1
1243 Ga0495619_0225062
1244 Ga0500568_0075403
1245 Ga0500622_0009545
1246 Ga0501084_0074109
1247 Ga0587082_109187
1248 Ga0587085_024346
1249 Ga0587079_094509
1250 Ga0587105_014637
1251 Ga0501082_0108180
1252 Ga0466962_0393800
1253 Ga0530510_0173840
1254 2513636271
1255 2513988173
1256 2515744540
1257 2517081945
1258 2520381760
1259 2530649693
1260 2538833918
1261 2588513610
1262 2608669145
1263 2616298376
1264 2643831748
1265 2643896951
1266 2644479158
1267 2688393926
1268 2719178995
1269 2719383551
1270 2719663352
1271 2719729360
1272 2720488756
1273 2720615784
1274 2720633917
1275 2720777661
1276 2721027451
1277 2721143607
1278 2721155355
1279 2721166703
1280 2722837681
1281 2723031111
1282 2723563775
1283 2723570639
1284 2724041253
1285 2724087403
1286 2724102186
1287 2724107377
1288 2730104802
1289 2730161456
1290 2730296235
1291 2735836975
1292 2738822698
1293 2738834905
1294 2738876384
1295 2738947197
1296 2739188328
1297 2739222981
1298 2739226376
1299 2792751043
1300 2793299675
1301 2793318930
1302 2793325175
1303 2793331423
1304 2793338372
1305 2793343482
1306 2793351097
1307 2793357319
1308 2793364341
1309 2793371337
1310 2805931670
1311 2805937935
1312 2806049409
1313 2806063802
1314 2806071030
1315 2838022059
1316 2838027337
1317 2838054023
1318 2838066901
1319 2838674605
1320 2838700956
1321 2838707046
1322 2838736033
1323 2838748288
1324 2842083697
1325 2842124774
1326 2842151647
1327 2842203514
1328 2842210978
1329 2842223277
1330 2842236757
1331 2842249473
1332 2842256835
1333 2842263462
1334 2842270554
1335 2842284527
1336 2842290648
1337 2842297886
1338 2842317279
1339 2842323532
1340 2842347993
1341 2842369539
1342 2842377264
1343 2842384350
1344 2842391369
1345 2842402174
1346 2842408471
1347 2842414593
1348 2842421829
1349 2842434374
1350 2842440709
1351 2842447361
1352 2842453775
1353 2842468730
1354 2842475283
1355 2842495604
1356 2842502256
1357 2844530645
1358 2865018577
1359 2882637740
1360 2894512328
1361 2913312706
1362 2935907807
1363 2936386099
1364 2945911985
1365 2945940000
1366 2945953317
1367 2945986746
1368 2978975847
1369 2990707124
1370 3000377678
1371 639789062
1372 642424080
1373 8001523634
1374 8005276777
1375 8005286903
1376 8005310029
1377 8005435378
1378 8005625111
1379 8005628869
1380 8005674773
1381 8005699087
1382 8018182126
1383 8024504817
1384 8056379652
1385 8056385702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05591

T6SS_VipA

Type VI secretion system, VipA, VC_A0107 or Hcp2

10

165

0.96

Map