F475593

General Info

Members Datasets Scaffolds Average Seq Length
692 566 1384 317

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0011176|Ga0395905_0011176_7440_8483
Length 347
Sequence MLTQSYGTIRLLILTRLRAIRIAGHIFIRGGIPLRRLLLLTAVLGLAISIAAPAKALTVVPPGNRHAEQPDVPGASSRRTKAGHTTFERKYEKVRDLLANDSDLISKIKMTARAYRIDPIHMIGAIVGEHTYNVDAYDSLQQYYVKAAAYAGNSFRFAYNGEKIDDFIARPEFAECNGKSGSYALWTCRERVWDRSFRGKQGFPNNRFSAVFFQPFYAGQTFGLGQINPLTALELSDLVAKVSGYPKLDESKASDVYQAIMDPDKSLAYMAASIKMSIDDYKRIAGMDISKNPGVTATLYNVGNPAARAAQLAAKNKGRAAGQQLMPEENYYGWLVNDKLAELKGLL

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
46 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
58 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
59 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
60 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
90 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
103 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
182 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
183 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
184 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
185 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
188 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
189 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
192 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
193 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
197 2509276019 Ensifer aridi TW10 Isolate Nodule
198 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
199 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
200 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
201 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
202 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
203 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
204 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
205 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
206 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
207 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
208 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
209 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
210 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
211 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
212 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
213 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
214 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
215 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
216 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
217 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
218 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
219 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
220 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
221 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
222 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
223 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
224 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
225 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
226 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
227 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
228 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
229 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
230 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
231 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
232 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
233 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
234 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
235 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
236 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
237 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
238 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
239 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
240 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
241 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
242 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
243 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
244 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
245 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
246 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
247 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
248 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
249 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
250 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
251 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
252 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
253 2643221558 Rhizobium sp. Root149 Isolate Unclassified
254 2643221568 Rhizobium sp. Root564 Isolate Unclassified
255 2643221607 Rhizobium sp. Root73 Isolate Unclassified
256 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
257 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
258 2643221688 Rhizobium sp. Root482 Isolate Unclassified
259 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
260 2643221693 Rhizobium sp. Root491 Isolate Unclassified
261 2643221719 Rhizobium sp. Root274 Isolate Unclassified
262 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
263 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
264 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
265 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
266 2738541293 Rhizobium sp. GV031 Isolate Unclassified
267 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
268 2738543024 Aminobacter sp. AP02 Isolate Unclassified
269 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
270 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
271 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
272 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
273 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
274 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
275 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
276 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
277 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
278 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
279 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
280 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
281 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
282 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
283 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
284 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
285 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
286 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
287 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
288 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
289 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
290 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
291 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
292 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
293 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
294 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
295 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
296 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
297 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
298 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
299 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
300 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
301 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
302 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
303 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
304 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
305 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
306 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
307 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
308 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
309 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
310 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
311 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
312 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
313 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
314 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
315 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
316 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
317 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
318 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
319 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
320 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
321 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
322 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
323 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
324 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
325 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
326 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
327 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
328 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
329 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
330 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
331 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
332 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
333 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
334 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
335 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
336 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
337 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
338 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
339 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
340 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
341 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
342 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
343 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
344 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
345 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
346 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
347 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
348 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
349 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
350 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
351 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
352 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
353 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
354 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
355 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
356 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
357 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
358 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
359 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
360 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
361 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
362 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
363 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
364 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
365 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
366 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
367 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
368 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
369 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
370 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
371 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
372 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
373 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
374 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
375 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
376 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
377 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
378 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
379 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
380 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
381 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
382 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
383 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
384 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
385 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
386 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
387 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
388 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
389 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
390 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
391 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
392 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
393 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
394 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
395 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
396 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
397 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
398 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
399 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
400 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
401 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
402 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
403 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
404 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
405 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
406 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
407 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
408 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
409 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
410 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
411 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
412 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
413 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
414 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
415 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
416 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
417 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
418 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
419 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
420 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
421 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
422 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
423 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
424 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
425 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
426 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
427 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
428 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
429 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
430 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
431 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
432 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
433 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
434 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
435 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
436 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
437 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
438 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
439 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
440 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
441 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
442 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
443 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
444 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
445 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
446 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
447 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
448 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
449 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
450 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
451 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
452 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
453 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
454 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
455 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
456 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
457 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
458 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
459 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
460 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
461 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
462 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
463 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
464 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
465 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
466 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
467 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
468 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
469 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
470 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
471 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
472 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
473 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
474 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
475 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
476 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
477 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
478 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
479 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
480 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
481 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
482 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
483 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
484 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
485 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
486 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
487 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
488 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
489 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
490 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
491 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
492 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
493 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
494 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
495 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
496 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
497 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
498 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
499 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
500 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
501 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
502 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
503 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
504 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
505 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
506 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
507 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
508 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
509 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
510 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
511 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
512 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
513 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
514 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
515 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
516 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
517 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
518 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
519 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
520 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
521 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
522 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
523 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
524 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
525 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
526 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
527 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
528 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
529 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
530 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
531 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
532 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
533 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
534 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
535 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
536 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
537 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
538 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
539 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
540 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
541 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
542 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
543 2996887358 Rhizobium sp. R711 Isolate Nodule
544 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
545 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
546 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
547 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
548 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
549 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
550 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
551 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
552 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
553 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
554 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
555 8005258706 Rhizobium sp. R693 Isolate Nodule
556 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
557 8005321885 Rhizobium sp. R72 Isolate Nodule
558 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
559 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
560 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
561 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
562 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
563 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
564 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
565 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
566 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.1
Metatranscriptomes 0.14
Isolates 53.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 19.08
Nodule 41.76
Rhizoplane 2.17
Rhizosphere 21.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0011176 3300037471 Bacteria 8679
2 RicEn_C4817 2010549000 Bacteria 1433
3 JGI24740J21852_10002325 3300001979 Bacteria 8648
4 JGI25155J39150_1000018 3300002704 Bacteria 157606
5 JGI25156J39149_1000055 3300002705 Bacteria 87733
6 JGI25162J39368_1001324 3300002737 Bacteria 13820
7 JGI25162J39368_1001456 3300002737 Bacteria 12524
8 JGI25154J39366_1000384 3300002738 Bacteria 24221
9 JGI25157J39369_1000076 3300002741 Bacteria 87678
10 JGI25152J39213_1000309 3300002773 Bacteria 31571
11 JGI25152J39213_1000648 3300002773 Bacteria 18401
12 JGI25152J39213_1001491 3300002773 Bacteria 9993
13 JGI25150J39212_1000018 3300002774 Bacteria 146535
14 JGI25150J39212_1004106 3300002774 Bacteria 3287
15 JGI25159J45721_1005441 3300002987 Bacteria 3997
16 JGI25151J46595_10000034 3300003187 Bacteria 192271
17 JGI25151J46595_10013528 3300003187 Bacteria 3669
18 JGI25165J46597_1001191 3300003214 Bacteria 15787
19 JGI25165J46597_1001335 3300003214 Bacteria 13869
20 JGI25153J46596_10003823 3300003215 Bacteria 8300
21 JGI25153J46596_10005428 3300003215 Bacteria 6696
22 rootH1_10226648 3300003323 Bacteria 1801
23 JGI25160J50197_1000051 3300003354 Bacteria 132923
24 JGI25160J50197_1000056 3300003354 Bacteria 119463
25 JGI25161J50226_1000011 3300003374 Bacteria 210140
26 JGI25161J50226_1000192 3300003374 Bacteria 39913
27 Ga0055526_1001303 3300003771 Bacteria 17875
28 Ga0055526_1001461 3300003771 Bacteria 16772
29 Ga0055524_1002221 3300003775 Bacteria 10181
30 Ga0055524_1003944 3300003775 Bacteria 7024
31 Ga0055530_10009538 3300003791 Bacteria 3714
32 Ga0055540_1000886 3300003792 Bacteria 19743
33 Ga0055543_1000041 3300004625 Bacteria 118501
34 Ga0055543_1000180 3300004625 Bacteria 52220
35 Ga0055543_1001069 3300004625 Bacteria 12064
36 Ga0065165_1000155 3300005262 Bacteria 119501
37 Ga0065165_1000303 3300005262 Bacteria 82513
38 Ga0070670_100000217 3300005331 Bacteria 53128
39 Ga0070668_100015599 3300005347 Bacteria 5679
40 Ga0070669_100116709 3300005353 Bacteria 2032
41 Ga0070667_100094799 3300005367 Bacteria 2572
42 Ga0070667_100106501 3300005367 Bacteria 2427
43 Ga0070665_100173427 3300005548 Bacteria 2158
44 Ga0075365_10000540 3300006038 Bacteria 14537
45 Ga0075365_10017204 3300006038 Bacteria 4417
46 Ga0075365_10037932 3300006038 Bacteria 3129
47 Ga0075368_10020936 3300006042 Bacteria 2480
48 Ga0075363_100011555 3300006048 Bacteria 4232
49 Ga0075363_100042115 3300006048 Bacteria 2411
50 Ga0075364_10025671 3300006051 Bacteria 3752
51 Ga0075362_10000994 3300006177 Bacteria 8685
52 Ga0075362_10049075 3300006177 Bacteria 1884
53 Ga0075367_10007501 3300006178 Bacteria 5590
54 Ga0075367_10016750 3300006178 Bacteria 4007
55 Ga0075367_10036179 3300006178 Bacteria 2861
56 Ga0075369_10001016 3300006186 Bacteria 9361
57 Ga0075369_10001058 3300006186 Bacteria 9208
58 Ga0075366_10026085 3300006195 Bacteria 3420
59 Ga0079104_1010553 3300006946 Bacteria 3035
60 Ga0105251_10007113 3300009011 Bacteria 6966
61 Ga0105244_10023759 3300009036 Bacteria 3356
62 Ga0105250_10024304 3300009092 Bacteria 2441
63 Ga0105247_10222388 3300009101 Bacteria 1278
64 Ga0105243_10020415 3300009148 Bacteria 5023
65 Ga0105248_10017883 3300009177 Bacteria 7823
66 Ga0105237_10003956 3300009545 Bacteria 17343
67 Ga0123341_1042294 3300009765 Bacteria 2894
68 Ga0123342_1005926 3300009766 Bacteria 17311
69 Ga0105239_10005695 3300010375 Bacteria 14553
70 Ga0105246_10171232 3300011119 Bacteria 1663
71 Ga0157373_10025263 3300013100 Bacteria 4298
72 Ga0157371_10000071 3300013102 Bacteria 164088
73 Ga0157370_10000079 3300013104 Bacteria 107305
74 Ga0157370_10012926 3300013104 Bacteria 8628
75 Ga0157370_10122743 3300013104 Bacteria 2425
76 Ga0157369_10065808 3300013105 Bacteria 3900
77 Ga0182007_10003879 3300015262 Bacteria 6935
78 Ga0182005_1008112 3300015265 Bacteria 3110
79 Ga0183363_1113 3300015690 Bacteria 22078
80 Ga0163161_10111884 3300017792 Bacteria 2042
81 Ga0214542_1000064 3300021321 Bacteria 127681
82 Ga0214543_1000063 3300021327 Bacteria 127694
83 Ga0228710_1000002 3300022740 Bacteria 287279
84 Ga0209435_100031 3300025206 Bacteria 164115
85 Ga0209436_100013 3300025208 Bacteria 131492
86 Ga0209436_104486 3300025208 Bacteria 3445
87 Ga0209563_103848 3300025230 Bacteria 3002
88 Ga0209437_100179 3300025233 Bacteria 134210
89 Ga0209437_100181 3300025233 Bacteria 132953
90 Ga0207425_1000035 3300025245 Bacteria 225942
91 Ga0207425_1001049 3300025245 Bacteria 12800
92 Ga0207425_1018977 3300025245 Bacteria 1487
93 Ga0209646_1000102 3300025246 Bacteria 164115
94 Ga0209646_1002136 3300025246 Bacteria 4591
95 Ga0209026_1000096 3300025250 Bacteria 164115
96 Ga0209759_1000090 3300025256 Bacteria 164115
97 Ga0209129_1000029 3300025258 Bacteria 401149
98 Ga0209129_1000409 3300025258 Bacteria 33785
99 Ga0209129_1000988 3300025258 Bacteria 17029
100 Ga0209129_1000993 3300025258 Bacteria 16985
101 Ga0209129_1001100 3300025258 Bacteria 15745
102 Ga0209129_1001572 3300025258 Bacteria 12539
103 Ga0209129_1009813 3300025258 Bacteria 2466
104 Ga0209233_1000185 3300025261 Bacteria 133788
105 Ga0209233_1000475 3300025261 Bacteria 24854
106 Ga0209233_1000514 3300025261 Bacteria 22716
107 Ga0209673_1000370 3300025273 Bacteria 81047
108 Ga0209673_1006786 3300025273 Bacteria 5440
109 Ga0209130_1000009 3300025284 Bacteria 498952
110 Ga0209130_1000058 3300025284 Bacteria 210250
111 Ga0209130_1000133 3300025284 Bacteria 119561
112 Ga0209130_1012418 3300025284 Bacteria 2231
113 Ga0209675_1017808 3300025291 Bacteria 2015
114 Ga0209025_1000132 3300025294 Bacteria 197432
115 Ga0209025_1000914 3300025294 Bacteria 45435
116 Ga0209025_1001178 3300025294 Bacteria 37028
117 Ga0209025_1003820 3300025294 Bacteria 13750
118 Ga0209025_1003970 3300025294 Bacteria 13280
119 Ga0209025_1010458 3300025294 Bacteria 6283
120 Ga0209025_1017689 3300025294 Bacteria 4096
121 Ga0209564_1000738 3300025295 Bacteria 46490
122 Ga0209564_1002121 3300025295 Bacteria 16824
123 Ga0209564_1002842 3300025295 Bacteria 12751
124 Ga0209564_1003680 3300025295 Bacteria 10120
125 Ga0209564_1011785 3300025295 Bacteria 3882
126 Ga0209564_1014726 3300025295 Bacteria 3230
127 Ga0209758_1001061 3300025297 Bacteria 35810
128 Ga0209758_1001207 3300025297 Bacteria 32535
129 Ga0209758_1001208 3300025297 Bacteria 32514
130 Ga0209758_1002613 3300025297 Bacteria 17931
131 Ga0209758_1002888 3300025297 Bacteria 16624
132 Ga0209050_1004529 3300025298 Bacteria 9343
133 Ga0209256_1000459 3300025299 Bacteria 61577
134 Ga0209256_1001010 3300025299 Bacteria 33243
135 Ga0209256_1001829 3300025299 Bacteria 19892
136 Ga0209256_1004467 3300025299 Bacteria 8754
137 Ga0209256_1008200 3300025299 Bacteria 4905
138 Ga0207426_1000131 3300025302 Bacteria 210250
139 Ga0207426_1000214 3300025302 Bacteria 137296
140 Ga0207426_1000248 3300025302 Bacteria 119561
141 Ga0207426_1000450 3300025302 Bacteria 65777
142 Ga0207426_1000747 3300025302 Bacteria 36594
143 Ga0209051_1001765 3300025303 Bacteria 17171
144 Ga0209051_1002754 3300025303 Bacteria 12165
145 Ga0209051_1015450 3300025303 Bacteria 3509
146 Ga0209257_1003933 3300025304 Bacteria 12073
147 Ga0209257_1021078 3300025304 Bacteria 2380
148 Ga0207713_1053816 3300025735 Bacteria 1582
149 Ga0207695_10000234 3300025913 Bacteria 146987
150 Ga0207671_10000234 3300025914 Bacteria 83448
151 Ga0207681_10048360 3300025923 Bacteria 2870
152 Ga0207650_10001202 3300025925 Bacteria 19013
153 Ga0207711_10031519 3300025941 Bacteria 4476
154 Ga0207712_10107929 3300025961 Bacteria 2082
155 Ga0207658_10032061 3300025986 Bacteria 3737
156 Ga0207658_10040948 3300025986 Bacteria 3352
157 Ga0209281_1000030 3300027111 Bacteria 425931
158 Ga0209281_1000893 3300027111 Bacteria 25367
159 Ga0209282_1000004 3300027666 Bacteria 425931
160 Ga0209813_10001006 3300027866 Bacteria 6324
161 Ga0209813_10006588 3300027866 Bacteria 2874
162 Ga0268266_10061332 3300028379 Bacteria 3243
163 Ga0268266_10075558 3300028379 Bacteria 2927
164 Ga0307515_10001473 3300028794 Bacteria 52908
165 Ga0307515_10004817 3300028794 Bacteria 27624
166 Ga0268256_1005620 3300030500 Bacteria 4873
167 Ga0307513_10000926 3300031456 Bacteria 42368
168 Ga0307408_100131027 3300031548 Bacteria 1956
169 Ga0307410_10034299 3300031852 Bacteria 3286
170 Ga0307406_10009129 3300031901 Bacteria 5552
171 Ga0307412_10000806 3300031911 Bacteria 18035
172 Ga0315914_1000001 3300031967 Bacteria 416633
173 Ga0307414_10284346 3300032004 Bacteria 1391
174 Ga0315913_1000022 3300033430 Bacteria 94546
175 Ga0315915_1000002 3300033464 Bacteria 425854
176 Ga0373935_0131629 3300035692 Bacteria 1681
177 Ga0373927_0000068 3300035695 Bacteria 75823
178 Ga0316584_0233652 3300036712 Bacteria 1347
179 Ga0373925_0013020 3300037068 Bacteria 6023
180 Ga0395900_0057051 3300037418 Bacteria 4020
181 Ga0395905_0003872 3300037471 Bacteria 15790
182 Ga0395905_0020145 3300037471 Bacteria 6318
183 Ga0495617_025522 3300046452 Bacteria 1992
184 Ga0495629_0190010 3300046459 Bacteria 1421
185 Ga0495638_0013686 3300046460 Bacteria 5512
186 Ga0495651_0156158 3300046462 Bacteria 1639
187 Ga0495605_0001553 3300046474 Bacteria 14915
188 Ga0495662_0038297 3300046476 Bacteria 2317
189 Ga0495585_0008650 3300046492 Bacteria 6157
190 Ga0495608_0107052 3300046511 Bacteria 1800
191 Ga0495610_0014968 3300046512 Bacteria 4531
192 Ga0495610_0061238 3300046512 Bacteria 1789
193 Ga0495620_0009436 3300046515 Bacteria 5191
194 Ga0495631_0002795 3300046518 Bacteria 9684
195 Ga0495632_0043369 3300046519 Bacteria 2248
196 Ga0495632_0062213 3300046519 Bacteria 1810
197 Ga0495643_0151590 3300046522 Bacteria 1148
198 Ga0495648_0042495 3300046524 Bacteria 2859
199 Ga0495652_0082521 3300046529 Bacteria 2649
200 Ga0495609_0014836 3300046538 Bacteria 3656
201 Ga0495622_0005652 3300046557 Bacteria 5796
202 Ga0495633_0011714 3300046558 Bacteria 4710
203 Ga0495611_0031931 3300046648 Bacteria 2320
204 Ga0495635_0016067 3300046663 Bacteria 5228
205 Ga0495658_0094898 3300046683 Bacteria 1772
206 Ga0495670_0142347 3300046691 Bacteria 1255
207 Ga0495600_0077144 3300046809 Bacteria 2176
208 Ga0495660_0087028 3300046810 Bacteria 1630
209 Ga0495604_0095947 3300047317 Bacteria 2189
210 Ga0495687_040153 3300047443 Bacteria 2064
211 Ga0495686_0006107 3300047472 Bacteria 9329
212 Ga0495686_0012893 3300047472 Bacteria 5827
213 Ga0495686_0036909 3300047472 Bacteria 3134
214 Ga0495686_0125233 3300047472 Bacteria 1528
215 Ga0495602_0071719 3300048088 Bacteria 2957
216 Ga0496101_0125194 3300048904 Bacteria 1947
217 Ga0496102_0224887 3300048905 Bacteria 1769
218 Ga0496103_0068735 3300048906 Bacteria 2214
219 Ga0496104_0248019 3300048907 Bacteria 1693
220 Ga0496106_0002784 3300048909 Bacteria 12961
221 Ga0496106_0120326 3300048909 Bacteria 2052
222 Ga0496109_0540691 3300048912 Bacteria 1099
223 Ga0496110_0233955 3300048913 Bacteria 1671
224 Ga0496113_0054392 3300048916 Bacteria 2997
225 Ga0496113_0179072 3300048916 Bacteria 1680
226 Ga0496116_0000057 3300048919 Bacteria 281652
227 Ga0496116_0027870 3300048919 Bacteria 4103
228 Ga0496116_0042171 3300048919 Bacteria 3123
229 Ga0496116_0042300 3300048919 Bacteria 3116
230 Ga0496116_0049733 3300048919 Bacteria 2799
231 Ga0496117_0000031 3300048920 Bacteria 381048
232 Ga0496118_0003703 3300048921 Bacteria 18940
233 Ga0496118_0008891 3300048921 Bacteria 10264
234 Ga0496119_0010805 3300048922 Bacteria 7640
235 Ga0496119_0012902 3300048922 Bacteria 6727
236 Ga0496119_0015744 3300048922 Bacteria 5799
237 Ga0496119_0022066 3300048922 Bacteria 4573
238 Ga0496119_0093962 3300048922 Bacteria 1698
239 Ga0496120_0000387 3300048923 Bacteria 71224
240 Ga0496120_0022613 3300048923 Bacteria 3953
241 Ga0496120_0136377 3300048923 Bacteria 1251
242 Ga0496121_0000034 3300048924 Bacteria 377095
243 Ga0496121_0006139 3300048924 Bacteria 15083
244 Ga0496121_0028052 3300048924 Bacteria 5250
245 Ga0496121_0039608 3300048924 Bacteria 4148
246 Ga0496122_0000023 3300048925 Bacteria 381035
247 Ga0496122_0078815 3300048925 Bacteria 2305
248 Ga0496122_0088955 3300048925 Bacteria 2113
249 Ga0496122_0176027 3300048925 Bacteria 1282
250 Ga0496123_0000027 3300048926 Bacteria 306773
251 Ga0496123_0000067 3300048926 Bacteria 209159
252 Ga0496123_0014786 3300048926 Bacteria 6444
253 Ga0496123_0052199 3300048926 Bacteria 2715
254 Ga0496124_0019498 3300048927 Bacteria 6308
255 Ga0496124_0048867 3300048927 Bacteria 3611
256 Ga0496124_0068788 3300048927 Bacteria 2941
257 Ga0496124_0088039 3300048927 Bacteria 2539
258 Ga0496124_0135385 3300048927 Bacteria 1951
259 Ga0496124_0146516 3300048927 Bacteria 1857
260 Ga0496125_0000030 3300048928 Bacteria 375023
261 Ga0496125_0028089 3300048928 Bacteria 5087
262 Ga0496125_0112171 3300048928 Bacteria 1971
263 Ga0496125_0141899 3300048928 Bacteria 1668
264 Ga0496126_0000115 3300048929 Bacteria 188546
265 Ga0496126_0186008 3300048929 Bacteria 1761
266 Ga0495678_016594 3300049459 Bacteria 3362
267 Ga0495678_048518 3300049459 Bacteria 1655
268 Ga0501031_0021541 3300049568 Bacteria 4202
269 Ga0501032_0176241 3300049569 Bacteria 1401
270 Ga0501033_0000281 3300049570 Bacteria 49116
271 Ga0501033_0000304 3300049570 Bacteria 46485
272 Ga0501034_0247447 3300049571 Bacteria 1728
273 Ga0501037_0000154 3300049573 Bacteria 64077
274 Ga0501037_0071028 3300049573 Bacteria 2533
275 Ga0501043_0000007 3300049579 Bacteria 224595
276 Ga0501043_0089540 3300049579 Bacteria 2419
277 Ga0501047_0045061 3300049581 Bacteria 4264
278 Ga0501067_0079750 3300049583 Bacteria 1814
279 Ga0501069_0000027 3300049585 Bacteria 106217
280 Ga0501070_0000215 3300049586 Bacteria 54743
281 Ga0501070_0000650 3300049586 Bacteria 31944
282 Ga0501071_0014470 3300049587 Bacteria 5396
283 Ga0501074_0000066 3300049590 Bacteria 50258
284 Ga0501080_0000542 3300049742 Bacteria 29722
285 Ga0501080_0003548 3300049742 Bacteria 13744
286 Ga0501083_0000012 3300049744 Bacteria 178668
287 Ga0501280_005297 3300049776 Bacteria 1848
288 Ga0501035_0000073 3300049822 Bacteria 122603
289 Ga0501035_0000374 3300049822 Bacteria 51467
290 Ga0501035_0000607 3300049822 Bacteria 39537
291 Ga0501035_0020041 3300049822 Bacteria 6143
292 Ga0501044_0000118 3300049823 Bacteria 95218
293 Ga0501044_0031664 3300049823 Bacteria 5565
294 nmdc:mga03683_19564_c1 3300050489 Bacteria 2586
295 nmdc:mga03683_63760_c1 3300050489 Bacteria 1563
296 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
297 nmdc:mga0yw44_18381_c1 3300050492 Bacteria 3827
298 nmdc:mga0yw44_45077_c1 3300050492 Bacteria 2642
299 nmdc:mga0k408_18949_c1 3300050493 Bacteria 3843
300 nmdc:mga06z11_56681_c1 3300050494 Bacteria 2028
301 nmdc:mga04h51_10397_c1 3300050495 Bacteria 2555
302 nmdc:mga0sz30_661_c1 3300050516 Bacteria 12749
303 Ga0500557_009180 3300053105 Bacteria 2410
304 Ga0500560_061485 3300053107 Bacteria 1225
305 Ga0500569_004387 3300053109 Bacteria 2962
306 Ga0500572_066528 3300053111 Bacteria 1105
307 Ga0500561_0010487 3300053137 Bacteria 1917
308 Ga0500568_0001281 3300053139 Bacteria 16548
309 Ga0500573_0012507 3300053140 Bacteria 4766
310 Ga0500590_035757 3300053148 Bacteria 2569
311 Ga0500604_0041809 3300053151 Bacteria 1387
312 Ga0500616_0003287 3300053153 Bacteria 12474
313 Ga0500616_0051342 3300053153 Bacteria 2173
314 Ga0500624_000897 3300053157 Bacteria 6346
315 Ga0500634_0002218 3300053161 Bacteria 8090
316 Ga0500636_0000030 3300053177 Bacteria 77501
317 Ga0500636_0006262 3300053177 Bacteria 6824
318 Ga0500636_0082485 3300053177 Bacteria 1851
319 Ga0500645_027846 3300053730 Bacteria 1712
320 Ga0587069_010412 3300059642 Bacteria 1223
321 2509108798 2508501122 Bacteria 6292184
322 2509377929 2509276019 Bacteria 6802256
323 2510308492 2510065057 Bacteria 6649661
324 2511135788 2510917022 Bacteria 6504556
325 2511194198 2510917030 Bacteria 7460662
326 2511391894 2511231027 Bacteria 5013807
327 2511498652 2511231052 Bacteria 6974333
328 2512534800 2512047086 Bacteria 6850303
329 2512973386 2512875026 Bacteria 6861065
330 2513587723 2513237086 Bacteria 7265287
331 2513600139 2513237088 Bacteria 6927906
332 2513602096 2513237089 Bacteria 6553624
333 2513619916 2513237091 Bacteria 6900273
334 2513886701 2513237140 Bacteria 7076289
335 2513904720 2513237143 Bacteria 6664116
336 2513983550 2513237156 Bacteria 6402557
337 2514003305 2513237160 Bacteria 6650282
338 2514418232 2513237305 Bacteria 7293571
339 2515612369 2515154107 Bacteria 6795637
340 2516894929 2516653046 Bacteria 6989037
341 2517571611 2517487022 Bacteria 7227575
342 2524450254 2524023207 Bacteria 6813453
343 2524461244 2524023209 Bacteria 6679728
344 2537874512 2537561587 Bacteria 5425293
345 2551674321 2551306084 Bacteria 8942552
346 2551677861 2551306084 Bacteria 8942552
347 2551686201 2551306085 Bacteria 7347181
348 2551694971 2551306086 Bacteria 6843938
349 2551700337 2551306087 Bacteria 7351905
350 2551710721 2551306089 Bacteria 7162724
351 2551722898 2551306090 Bacteria 7953713
352 2551731173 2551306091 Bacteria 7086830
353 2551734672 2551306092 Bacteria 6992595
354 2551746479 2551306093 Bacteria 7064773
355 2554249042 2554235003 Bacteria 5877155
356 2559296130 2558860242 Bacteria 5568029
357 2585231817 2582581299 Bacteria 6518058
358 2585257118 2582581304 Bacteria 5831370
359 2585272122 2582581307 Bacteria 6597605
360 2585279571 2582581308 Bacteria 7413247
361 2585327409 2582581315 Bacteria 7318924
362 2585334052 2582581316 Bacteria 7774528
363 2585388294 2582581865 Bacteria 6644329
364 2585396109 2582581866 Bacteria 6859583
365 2585535650 2585427527 Bacteria 7273426
366 2585551028 2585427530 Bacteria 7383882
367 2585563333 2585427531 Bacteria 6992870
368 2585845116 2585427594 Bacteria 6180594
369 2585897245 2585427608 Bacteria 6544331
370 2585909160 2585427609 Bacteria 6667127
371 2587984574 2585428125 Bacteria 6662905
372 2597810401 2597489875 Bacteria 7010078
373 2599603077 2599185210 Bacteria 5624189
374 2601611017 2600255279 Bacteria 5605316
375 2601747791 2600255308 Bacteria 5611129
376 2616306358 2615840626 Bacteria 7921970
377 2616551155 2615840698 Bacteria 7319877
378 2617382386 2617270742 Bacteria 6808054
379 2643814937 2643221558 Bacteria 5460675
380 2643854771 2643221568 Bacteria 5187270
381 2644052509 2643221607 Bacteria 6314006
382 2644201108 2643221636 Bacteria 6583769
383 2644484787 2643221686 Bacteria 6310811
384 2644492489 2643221688 Bacteria 5260751
385 2644501309 2643221689 Bacteria 6042950
386 2644521708 2643221693 Bacteria 5513853
387 2644657865 2643221719 Bacteria 4568197
388 2657682245 2657244999 Bacteria 5946535
389 2671115966 2667528174 Bacteria 6435400
390 2692319771 2690316117 Bacteria 6800650
391 2723573059 2721755686 Bacteria 7343952
392 2738800968 2738541293 Bacteria 7065685
393 2738947150 2738541317 Bacteria 5340176
394 2739310284 2738543024 Bacteria 5603683
395 2753458412 2751185821 Bacteria 6189929
396 2765465782 2765235802 Bacteria 5618596
397 2776269506 2775506902 Bacteria 6208009
398 2776282436 2775506904 Bacteria 5954060
399 2778179279 2775507266 Bacteria 7392367
400 2792582403 2791355082 Bacteria 5973319
401 2792621743 2791355091 Bacteria 6135441
402 2792629000 2791355092 Bacteria 6248105
403 2792640144 2791355094 Bacteria 7011481
404 2793281888 2791355253 Bacteria 5171699
405 2802717024 2802428858 Bacteria 6636079
406 2802724988 2802428859 Bacteria 6667919
407 2802729738 2802428860 Bacteria 6525526
408 2802737084 2802428861 Bacteria 6534206
409 2802743489 2802428862 Bacteria 6633353
410 2802749385 2802428863 Bacteria 6410669
411 2804753860 2802429268 Bacteria 6094027
412 2808988044 2808606387 Bacteria 5697198
413 2819244135 2818991272 Bacteria 4622173
414 2819561140 2818991439 Bacteria 6907412
415 2819612031 2818991448 Bacteria 6772224
416 2819638426 2818991453 Bacteria 7181617
417 2838034181 2838029111 Bacteria 6603031
418 2838678489 2838675328 Bacteria 4909118
419 2838718423 2838714209 Bacteria 5525906
420 2838722785 2838719591 Bacteria 5523910
421 2838728489 2838724970 Bacteria 4908691
422 2839993423 2839993093 Bacteria 5512535
423 2840766434 2840764183 Bacteria 6358399
424 2841736214 2841734538 Bacteria 6784580
425 2841850341 2841846520 Bacteria 5345850
426 2841863407 2841859092 Bacteria 5436171
427 2842129149 2842124991 Bacteria 5346824
428 2842133382 2842130223 Bacteria 4909145
429 2842155707 2842152218 Bacteria 4908957
430 2842174335 2842170452 Bacteria 5525737
431 2842178996 2842175837 Bacteria 4908771
432 2842190847 2842187318 Bacteria 5524014
433 2842214829 2842211629 Bacteria 5523832
434 2842227550 2842224351 Bacteria 5524473
435 2842302688 2842298080 Bacteria 6123127
436 2842358810 2842357229 Bacteria 6485165
437 2842480851 2842475841 Bacteria 6603183
438 2842485344 2842482326 Bacteria 7212537
439 2842507538 2842502639 Bacteria 6604161
440 2842514629 2842509118 Bacteria 6850950
441 2842519856 2842515876 Bacteria 5436280
442 2842527127 2842521101 Bacteria 6569494
443 2842874046 2842871566 Bacteria 4827117
444 2842926517 2842922631 Bacteria 5824079
445 2847421004 2847417321 Bacteria 6913799
446 2848995838 2848992105 Bacteria 6810864
447 2850082815 2850079185 Bacteria 6848280
448 2852387601 2852387548 Bacteria 8025568
449 2855827562 2855825444 Bacteria 6785811
450 2855842937 2855839649 Bacteria 7135830
451 2855873699 2855872281 Bacteria 6964271
452 2858801354 2858800743 Bacteria 6603254
453 2869165333 2869162929 Bacteria 6399702
454 2869176200 2869169390 Bacteria 6659796
455 2869248043 2869242130 Bacteria 6609239
456 2869257089 2869256925 Bacteria 6981691
457 2871480367 2871474448 Bacteria 6806570
458 2871483979 2871481445 Bacteria 6700002
459 2874122036 2874116593 Bacteria 6674494
460 2876386523 2876386047 Bacteria 6698674
461 2876424500 2876420981 Bacteria 6687741
462 2878789376 2878788777 Bacteria 6567085
463 2882634575 2882632389 Bacteria 8154593
464 2894653703 2894652903 Bacteria 4587256
465 2899795509 2899792073 Bacteria 4926588
466 2899849585 2899845264 Bacteria 5672268
467 2906407331 2906401398 Bacteria 6693206
468 2913300350 2913295892 Bacteria 6333755
469 2913312021 2913308742 Bacteria 5350706
470 2915981649 2915980308 Bacteria 6624279
471 2915989716 2915986958 Bacteria 6739310
472 2916000676 2915993759 Bacteria 7016183
473 2916007593 2916000859 Bacteria 6865702
474 2916014255 2916007675 Bacteria 6898660
475 2916021423 2916014648 Bacteria 6946486
476 2916028030 2916021584 Bacteria 6854472
477 2916034685 2916028427 Bacteria 6748433
478 2916041071 2916035215 Bacteria 6755766
479 2916048230 2916041962 Bacteria 6820487
480 2916054418 2916048683 Bacteria 6543552
481 2916061013 2916055098 Bacteria 6758838
482 2916066420 2916061851 Bacteria 6737736
483 2916075453 2916068649 Bacteria 6943657
484 2916076809 2916076590 Bacteria 6596108
485 2919118320 2919114240 Bacteria 5700270
486 2919120403 2919119836 Bacteria 5208557
487 2919170406 2919166419 Bacteria 4952238
488 2919411515 2919408235 Bacteria 6149349
489 2920760149 2920760137 Bacteria 7427611
490 2921207777 2921201388 Bacteria 6926299
491 2921208884 2921208531 Bacteria 6745326
492 2921243631 2921237296 Bacteria 6876710
493 2921248326 2921244191 Bacteria 6568419
494 2921252737 2921250672 Bacteria 6677771
495 2921263100 2921257292 Bacteria 6808382
496 2921270120 2921263974 Bacteria 6864552
497 2921283665 2921282425 Bacteria 6826397
498 2921290269 2921289301 Bacteria 7316391
499 2921303998 2921296804 Bacteria 7176999
500 2924147702 2924144063 Bacteria 6883928
501 2924157810 2924150972 Bacteria 7169444
502 2924158719 2924158325 Bacteria 7188855
503 2924166016 2924165586 Bacteria 7260590
504 2924178935 2924172951 Bacteria 6749356
505 2924184400 2924179722 Bacteria 6843264
506 2924193040 2924186466 Bacteria 6876637
507 2924199608 2924193448 Bacteria 6955718
508 2924206407 2924200457 Bacteria 6757188
509 2924214021 2924207177 Bacteria 6917007
510 2924220938 2924214083 Bacteria 7080103
511 2924222024 2924221636 Bacteria 7113495
512 2924234631 2924228884 Bacteria 6633132
513 2924741088 2924741084 Bacteria 6661321
514 2926754849 2926754445 Bacteria 5964435
515 2926762014 2926760298 Bacteria 5505990
516 2929142055 2929138655 Bacteria 5810547
517 2933010447 2933006813 Bacteria 4912075
518 2933015881 2933011516 Bacteria 5439334
519 2933597382 2933594066 Bacteria 5594265
520 2936997499 2936996657 Bacteria 6298727
521 2937008968 2937002841 Bacteria 6934057
522 2937015700 2937009748 Bacteria 6746052
523 2937020941 2937016420 Bacteria 6782579
524 2937028430 2937023124 Bacteria 6815156
525 2937031661 2937029754 Bacteria 6424026
526 2937041405 2937036028 Bacteria 6846469
527 2937049553 2937042894 Bacteria 6741576
528 2937056490 2937049772 Bacteria 6757901
529 2937063822 2937056579 Bacteria 7107896
530 2937070563 2937063883 Bacteria 7199456
531 2937077965 2937071275 Bacteria 6984483
532 2937081554 2937078374 Bacteria 6610289
533 2937090814 2937084907 Bacteria 6618516
534 2937098522 2937091812 Bacteria 6979387
535 2937102890 2937098957 Bacteria 7249374
536 2937109727 2937106411 Bacteria 6947143
537 2937118590 2937113482 Bacteria 6505872
538 2937124140 2937119839 Bacteria 6597547
539 2937132252 2937126314 Bacteria 6771275
540 2937840585 2937836603 Bacteria 6811263
541 2937866116 2937861824 Bacteria 6660327
542 2937982378 2937980651 Bacteria 6517427
543 2957376728 2957375807 Bacteria 6425588
544 2957388485 2957382221 Bacteria 6737050
545 2957395133 2957388812 Bacteria 6778072
546 2957401881 2957395598 Bacteria 6822399
547 2957408522 2957402308 Bacteria 6741770
548 2957414258 2957408893 Bacteria 6558585
549 2957429274 2957422303 Bacteria 7172205
550 2957436747 2957430029 Bacteria 7022557
551 2957441735 2957437181 Bacteria 6568994
552 2957448325 2957443900 Bacteria 6869977
553 2957457055 2957450854 Bacteria 6765715
554 2957464499 2957457609 Bacteria 6967680
555 2957470407 2957464669 Bacteria 6568877
556 2957477877 2957471148 Bacteria 6797643
557 2957479989 2957478035 Bacteria 6756658
558 2957491339 2957484790 Bacteria 6703082
559 2957497597 2957491536 Bacteria 6695180
560 2957504971 2957498199 Bacteria 7126688
561 2957512964 2957505466 Bacteria 7253085
562 2958077176 2958071322 Bacteria 6815895
563 2958109040 2958108152 Bacteria 6681128
564 2960584291 2960584000 Bacteria 6864594
565 2960592864 2960591022 Bacteria 6622873
566 2960602700 2960597568 Bacteria 6550735
567 2960610648 2960603979 Bacteria 6898737
568 2960616816 2960610863 Bacteria 6691244
569 2960619028 2960617483 Bacteria 6727748
570 2960631083 2960624210 Bacteria 6875384
571 2960635527 2960631154 Bacteria 6732508
572 2960638895 2960637947 Bacteria 7296468
573 2960646175 2960645483 Bacteria 7211087
574 2960660200 2960652885 Bacteria 7083688
575 2960664876 2960660292 Bacteria 7041660
576 2960673141 2960667422 Bacteria 6763020
577 2960675241 2960674078 Bacteria 6609048
578 2960681789 2960680706 Bacteria 6624464
579 2960693546 2960687367 Bacteria 6535474
580 2960700715 2960693952 Bacteria 6749742
581 2961184396 2961183825 Bacteria 6688536
582 2964608253 2964607997 Bacteria 7101408
583 2964621518 2964615318 Bacteria 6809089
584 2964622984 2964621998 Bacteria 6834995
585 2964635639 2964628898 Bacteria 7083044
586 2964642961 2964636051 Bacteria 7091832
587 2964649063 2964643177 Bacteria 6820887
588 2964655149 2964649959 Bacteria 6675118
589 2964660042 2964656573 Bacteria 7100150
590 2964670837 2964663802 Bacteria 7019362
591 2964671655 2964670856 Bacteria 6851364
592 2964678364 2964678106 Bacteria 6792020
593 2964685754 2964685014 Bacteria 6839111
594 2964698580 2964691889 Bacteria 6802758
595 2964705052 2964698721 Bacteria 6765331
596 2964712231 2964705432 Bacteria 7114648
597 2964713174 2964712639 Bacteria 6695970
598 2964726777 2964719344 Bacteria 7286602
599 2967670437 2967664464 Bacteria 6948836
600 2967672358 2967671571 Bacteria 7021409
601 2967681311 2967678726 Bacteria 7264382
602 2967692363 2967686174 Bacteria 6678622
603 2967696528 2967693043 Bacteria 6804451
604 2967700592 2967699805 Bacteria 6854538
605 2967707716 2967706974 Bacteria 7186053
606 2967721259 2967714385 Bacteria 7000047
607 2967728438 2967721400 Bacteria 7073753
608 2967732225 2967728569 Bacteria 6641507
609 2967738526 2967735183 Bacteria 6827012
610 2967748538 2967742019 Bacteria 6794534
611 2967754014 2967748971 Bacteria 6733771
612 2967757810 2967755722 Bacteria 6814706
613 2967765733 2967762386 Bacteria 6923502
614 2967775230 2967769361 Bacteria 6587838
615 2967782666 2967775926 Bacteria 6738189
616 2968144376 2968138860 Bacteria 6605449
617 2970022052 2970019648 Bacteria 7072033
618 2970028614 2970026789 Bacteria 6785236
619 2970040595 2970033650 Bacteria 7118744
620 2970046662 2970040964 Bacteria 6731123
621 2970048274 2970047711 Bacteria 7088379
622 2970060568 2970054988 Bacteria 6611507
623 2970068679 2970061556 Bacteria 7099761
624 2970075888 2970068827 Bacteria 7123112
625 2970082036 2970076120 Bacteria 6697332
626 2970087862 2970082768 Bacteria 6183754
627 2970095033 2970088815 Bacteria 6933825
628 2970097264 2970095765 Bacteria 6936963
629 2970104548 2970102677 Bacteria 6812532
630 2970114450 2970109326 Bacteria 6863976
631 2970120904 2970116247 Bacteria 6501857
632 2970127913 2970122695 Bacteria 6625855
633 2970133459 2970129317 Bacteria 6806560
634 2970147399 2970143518 Bacteria 6446480
635 2970156365 2970149975 Bacteria 6779706
636 2970163463 2970156795 Bacteria 7168044
637 2970169944 2970164137 Bacteria 6861252
638 2970177033 2970170962 Bacteria 6876229
639 2970184190 2970177841 Bacteria 6768001
640 2970189698 2970184632 Bacteria 7054431
641 2970198246 2970191845 Bacteria 7032787
642 2970535520 2970532167 Bacteria 6553173
643 2970619868 2970619444 Bacteria 6986144
644 2970628669 2970627176 Bacteria 6680862
645 2977523794 2977516862 Bacteria 6940108
646 2977530254 2977523885 Bacteria 6960446
647 2977531264 2977530762 Bacteria 6951399
648 2977543017 2977537788 Bacteria 6929320
649 2977547428 2977544691 Bacteria 6875412
650 2977557949 2977551784 Bacteria 7125765
651 2977560037 2977558990 Bacteria 6863948
652 2977570553 2977565890 Bacteria 6901543
653 2977579082 2977572785 Bacteria 6763888
654 2977583004 2977579622 Bacteria 6772100
655 2977855249 2977851361 Bacteria 6694324
656 2977909181 2977907340 Bacteria 6577984
657 2978972797 2978969890 Bacteria 5400756
658 2979092716 2979089926 Bacteria 5670289
659 2979099892 2979095461 Bacteria 5669583
660 2979104689 2979100975 Bacteria 5423623
661 2979768470 2979764755 Bacteria 6610066
662 2979772713 2979772303 Bacteria 6618277
663 2984513512 2984509177 Bacteria 5274802
664 2984522907 2984518228 Bacteria 5277463
665 2984542214 2984537506 Bacteria 5277481
666 2984591049 2984587000 Bacteria 5263363
667 2984601642 2984601300 Bacteria 5455244
668 2989780302 2989776772 Bacteria 4843317
669 2996890514 2996887358 Bacteria 5795980
670 3004250432 3004248173 Bacteria 6563236
671 3005416827 3005416602 Bacteria 7064308
672 643827592 643692032 Bacteria 6891900
673 648740777 648276728 Bacteria 6968865
674 650738548 650716007 Bacteria 5573770
675 8003573592 8003570095 Bacteria 5747666
676 8003995519 8003992118 Bacteria 7266902
677 8004003278 8003999396 Bacteria 7063185
678 8004316559 8004312739 Bacteria 7444653
679 8004640002 8004633249 Bacteria 6723080
680 8005249463 8005246636 Bacteria 4933972
681 8005262701 8005258706 Bacteria 6184835
682 8005315969 8005314921 Bacteria 7072929
683 8005325041 8005321885 Bacteria 5795980
684 8005487059 8005484373 Bacteria 6297373
685 8005645251 8005645114 Bacteria 6950293
686 8005661018 8005658619 Bacteria 4500593
687 8005687302 8005682033 Bacteria 6726518
688 8024491068 8024486573 Bacteria 6540512
689 8046768313 8046767195 Bacteria 7547379
690 8049296460 8049293176 Bacteria 6128433
691 8055433011 8055431914 Bacteria 4551896
692 8057582018 8057575449 Bacteria 7367519
693 Ga0395905_0011176
694 RicEn_C4817
695 JGI24740J21852_10002325
696 JGI25155J39150_1000018
697 JGI25156J39149_1000055
698 JGI25162J39368_1001324
699 JGI25162J39368_1001456
700 JGI25154J39366_1000384
701 JGI25157J39369_1000076
702 JGI25152J39213_1000309
703 JGI25152J39213_1000648
704 JGI25152J39213_1001491
705 JGI25150J39212_1000018
706 JGI25150J39212_1004106
707 JGI25159J45721_1005441
708 JGI25151J46595_10000034
709 JGI25151J46595_10013528
710 JGI25165J46597_1001191
711 JGI25165J46597_1001335
712 JGI25153J46596_10003823
713 JGI25153J46596_10005428
714 rootH1_10226648
715 JGI25160J50197_1000051
716 JGI25160J50197_1000056
717 JGI25161J50226_1000011
718 JGI25161J50226_1000192
719 Ga0055526_1001303
720 Ga0055526_1001461
721 Ga0055524_1002221
722 Ga0055524_1003944
723 Ga0055530_10009538
724 Ga0055540_1000886
725 Ga0055543_1000041
726 Ga0055543_1000180
727 Ga0055543_1001069
728 Ga0065165_1000155
729 Ga0065165_1000303
730 Ga0070670_100000217
731 Ga0070668_100015599
732 Ga0070669_100116709
733 Ga0070667_100094799
734 Ga0070667_100106501
735 Ga0070665_100173427
736 Ga0075365_10000540
737 Ga0075365_10017204
738 Ga0075365_10037932
739 Ga0075368_10020936
740 Ga0075363_100011555
741 Ga0075363_100042115
742 Ga0075364_10025671
743 Ga0075362_10000994
744 Ga0075362_10049075
745 Ga0075367_10007501
746 Ga0075367_10016750
747 Ga0075367_10036179
748 Ga0075369_10001016
749 Ga0075369_10001058
750 Ga0075366_10026085
751 Ga0079104_1010553
752 Ga0105251_10007113
753 Ga0105244_10023759
754 Ga0105250_10024304
755 Ga0105247_10222388
756 Ga0105243_10020415
757 Ga0105248_10017883
758 Ga0105237_10003956
759 Ga0123341_1042294
760 Ga0123342_1005926
761 Ga0105239_10005695
762 Ga0105246_10171232
763 Ga0157373_10025263
764 Ga0157371_10000071
765 Ga0157370_10000079
766 Ga0157370_10012926
767 Ga0157370_10122743
768 Ga0157369_10065808
769 Ga0182007_10003879
770 Ga0182005_1008112
771 Ga0183363_1113
772 Ga0163161_10111884
773 Ga0214542_1000064
774 Ga0214543_1000063
775 Ga0228710_1000002
776 Ga0209435_100031
777 Ga0209436_100013
778 Ga0209436_104486
779 Ga0209563_103848
780 Ga0209437_100179
781 Ga0209437_100181
782 Ga0207425_1000035
783 Ga0207425_1001049
784 Ga0207425_1018977
785 Ga0209646_1000102
786 Ga0209646_1002136
787 Ga0209026_1000096
788 Ga0209759_1000090
789 Ga0209129_1000029
790 Ga0209129_1000409
791 Ga0209129_1000988
792 Ga0209129_1000993
793 Ga0209129_1001100
794 Ga0209129_1001572
795 Ga0209129_1009813
796 Ga0209233_1000185
797 Ga0209233_1000475
798 Ga0209233_1000514
799 Ga0209673_1000370
800 Ga0209673_1006786
801 Ga0209130_1000009
802 Ga0209130_1000058
803 Ga0209130_1000133
804 Ga0209130_1012418
805 Ga0209675_1017808
806 Ga0209025_1000132
807 Ga0209025_1000914
808 Ga0209025_1001178
809 Ga0209025_1003820
810 Ga0209025_1003970
811 Ga0209025_1010458
812 Ga0209025_1017689
813 Ga0209564_1000738
814 Ga0209564_1002121
815 Ga0209564_1002842
816 Ga0209564_1003680
817 Ga0209564_1011785
818 Ga0209564_1014726
819 Ga0209758_1001061
820 Ga0209758_1001207
821 Ga0209758_1001208
822 Ga0209758_1002613
823 Ga0209758_1002888
824 Ga0209050_1004529
825 Ga0209256_1000459
826 Ga0209256_1001010
827 Ga0209256_1001829
828 Ga0209256_1004467
829 Ga0209256_1008200
830 Ga0207426_1000131
831 Ga0207426_1000214
832 Ga0207426_1000248
833 Ga0207426_1000450
834 Ga0207426_1000747
835 Ga0209051_1001765
836 Ga0209051_1002754
837 Ga0209051_1015450
838 Ga0209257_1003933
839 Ga0209257_1021078
840 Ga0207713_1053816
841 Ga0207695_10000234
842 Ga0207671_10000234
843 Ga0207681_10048360
844 Ga0207650_10001202
845 Ga0207711_10031519
846 Ga0207712_10107929
847 Ga0207658_10032061
848 Ga0207658_10040948
849 Ga0209281_1000030
850 Ga0209281_1000893
851 Ga0209282_1000004
852 Ga0209813_10001006
853 Ga0209813_10006588
854 Ga0268266_10061332
855 Ga0268266_10075558
856 Ga0307515_10001473
857 Ga0307515_10004817
858 Ga0268256_1005620
859 Ga0307513_10000926
860 Ga0307408_100131027
861 Ga0307410_10034299
862 Ga0307406_10009129
863 Ga0307412_10000806
864 Ga0315914_1000001
865 Ga0307414_10284346
866 Ga0315913_1000022
867 Ga0315915_1000002
868 Ga0373935_0131629
869 Ga0373927_0000068
870 Ga0316584_0233652
871 Ga0373925_0013020
872 Ga0395900_0057051
873 Ga0395905_0003872
874 Ga0395905_0020145
875 Ga0495617_025522
876 Ga0495629_0190010
877 Ga0495638_0013686
878 Ga0495651_0156158
879 Ga0495605_0001553
880 Ga0495662_0038297
881 Ga0495585_0008650
882 Ga0495608_0107052
883 Ga0495610_0014968
884 Ga0495610_0061238
885 Ga0495620_0009436
886 Ga0495631_0002795
887 Ga0495632_0043369
888 Ga0495632_0062213
889 Ga0495643_0151590
890 Ga0495648_0042495
891 Ga0495652_0082521
892 Ga0495609_0014836
893 Ga0495622_0005652
894 Ga0495633_0011714
895 Ga0495611_0031931
896 Ga0495635_0016067
897 Ga0495658_0094898
898 Ga0495670_0142347
899 Ga0495600_0077144
900 Ga0495660_0087028
901 Ga0495604_0095947
902 Ga0495687_040153
903 Ga0495686_0006107
904 Ga0495686_0012893
905 Ga0495686_0036909
906 Ga0495686_0125233
907 Ga0495602_0071719
908 Ga0496101_0125194
909 Ga0496102_0224887
910 Ga0496103_0068735
911 Ga0496104_0248019
912 Ga0496106_0002784
913 Ga0496106_0120326
914 Ga0496109_0540691
915 Ga0496110_0233955
916 Ga0496113_0054392
917 Ga0496113_0179072
918 Ga0496116_0000057
919 Ga0496116_0027870
920 Ga0496116_0042171
921 Ga0496116_0042300
922 Ga0496116_0049733
923 Ga0496117_0000031
924 Ga0496118_0003703
925 Ga0496118_0008891
926 Ga0496119_0010805
927 Ga0496119_0012902
928 Ga0496119_0015744
929 Ga0496119_0022066
930 Ga0496119_0093962
931 Ga0496120_0000387
932 Ga0496120_0022613
933 Ga0496120_0136377
934 Ga0496121_0000034
935 Ga0496121_0006139
936 Ga0496121_0028052
937 Ga0496121_0039608
938 Ga0496122_0000023
939 Ga0496122_0078815
940 Ga0496122_0088955
941 Ga0496122_0176027
942 Ga0496123_0000027
943 Ga0496123_0000067
944 Ga0496123_0014786
945 Ga0496123_0052199
946 Ga0496124_0019498
947 Ga0496124_0048867
948 Ga0496124_0068788
949 Ga0496124_0088039
950 Ga0496124_0135385
951 Ga0496124_0146516
952 Ga0496125_0000030
953 Ga0496125_0028089
954 Ga0496125_0112171
955 Ga0496125_0141899
956 Ga0496126_0000115
957 Ga0496126_0186008
958 Ga0495678_016594
959 Ga0495678_048518
960 Ga0501031_0021541
961 Ga0501032_0176241
962 Ga0501033_0000281
963 Ga0501033_0000304
964 Ga0501034_0247447
965 Ga0501037_0000154
966 Ga0501037_0071028
967 Ga0501043_0000007
968 Ga0501043_0089540
969 Ga0501047_0045061
970 Ga0501067_0079750
971 Ga0501069_0000027
972 Ga0501070_0000215
973 Ga0501070_0000650
974 Ga0501071_0014470
975 Ga0501074_0000066
976 Ga0501080_0000542
977 Ga0501080_0003548
978 Ga0501083_0000012
979 Ga0501280_005297
980 Ga0501035_0000073
981 Ga0501035_0000374
982 Ga0501035_0000607
983 Ga0501035_0020041
984 Ga0501044_0000118
985 Ga0501044_0031664
986 nmdc:mga03683_19564_c1
987 nmdc:mga03683_63760_c1
988 nmdc:mga00v17_15_c1
989 nmdc:mga0yw44_18381_c1
990 nmdc:mga0yw44_45077_c1
991 nmdc:mga0k408_18949_c1
992 nmdc:mga06z11_56681_c1
993 nmdc:mga04h51_10397_c1
994 nmdc:mga0sz30_661_c1
995 Ga0500557_009180
996 Ga0500560_061485
997 Ga0500569_004387
998 Ga0500572_066528
999 Ga0500561_0010487
1000 Ga0500568_0001281
1001 Ga0500573_0012507
1002 Ga0500590_035757
1003 Ga0500604_0041809
1004 Ga0500616_0003287
1005 Ga0500616_0051342
1006 Ga0500624_000897
1007 Ga0500634_0002218
1008 Ga0500636_0000030
1009 Ga0500636_0006262
1010 Ga0500636_0082485
1011 Ga0500645_027846
1012 Ga0587069_010412
1013 2509108798
1014 2509377929
1015 2510308492
1016 2511135788
1017 2511194198
1018 2511391894
1019 2511498652
1020 2512534800
1021 2512973386
1022 2513587723
1023 2513600139
1024 2513602096
1025 2513619916
1026 2513886701
1027 2513904720
1028 2513983550
1029 2514003305
1030 2514418232
1031 2515612369
1032 2516894929
1033 2517571611
1034 2524450254
1035 2524461244
1036 2537874512
1037 2551674321
1038 2551677861
1039 2551686201
1040 2551694971
1041 2551700337
1042 2551710721
1043 2551722898
1044 2551731173
1045 2551734672
1046 2551746479
1047 2554249042
1048 2559296130
1049 2585231817
1050 2585257118
1051 2585272122
1052 2585279571
1053 2585327409
1054 2585334052
1055 2585388294
1056 2585396109
1057 2585535650
1058 2585551028
1059 2585563333
1060 2585845116
1061 2585897245
1062 2585909160
1063 2587984574
1064 2597810401
1065 2599603077
1066 2601611017
1067 2601747791
1068 2616306358
1069 2616551155
1070 2617382386
1071 2643814937
1072 2643854771
1073 2644052509
1074 2644201108
1075 2644484787
1076 2644492489
1077 2644501309
1078 2644521708
1079 2644657865
1080 2657682245
1081 2671115966
1082 2692319771
1083 2723573059
1084 2738800968
1085 2738947150
1086 2739310284
1087 2753458412
1088 2765465782
1089 2776269506
1090 2776282436
1091 2778179279
1092 2792582403
1093 2792621743
1094 2792629000
1095 2792640144
1096 2793281888
1097 2802717024
1098 2802724988
1099 2802729738
1100 2802737084
1101 2802743489
1102 2802749385
1103 2804753860
1104 2808988044
1105 2819244135
1106 2819561140
1107 2819612031
1108 2819638426
1109 2838034181
1110 2838678489
1111 2838718423
1112 2838722785
1113 2838728489
1114 2839993423
1115 2840766434
1116 2841736214
1117 2841850341
1118 2841863407
1119 2842129149
1120 2842133382
1121 2842155707
1122 2842174335
1123 2842178996
1124 2842190847
1125 2842214829
1126 2842227550
1127 2842302688
1128 2842358810
1129 2842480851
1130 2842485344
1131 2842507538
1132 2842514629
1133 2842519856
1134 2842527127
1135 2842874046
1136 2842926517
1137 2847421004
1138 2848995838
1139 2850082815
1140 2852387601
1141 2855827562
1142 2855842937
1143 2855873699
1144 2858801354
1145 2869165333
1146 2869176200
1147 2869248043
1148 2869257089
1149 2871480367
1150 2871483979
1151 2874122036
1152 2876386523
1153 2876424500
1154 2878789376
1155 2882634575
1156 2894653703
1157 2899795509
1158 2899849585
1159 2906407331
1160 2913300350
1161 2913312021
1162 2915981649
1163 2915989716
1164 2916000676
1165 2916007593
1166 2916014255
1167 2916021423
1168 2916028030
1169 2916034685
1170 2916041071
1171 2916048230
1172 2916054418
1173 2916061013
1174 2916066420
1175 2916075453
1176 2916076809
1177 2919118320
1178 2919120403
1179 2919170406
1180 2919411515
1181 2920760149
1182 2921207777
1183 2921208884
1184 2921243631
1185 2921248326
1186 2921252737
1187 2921263100
1188 2921270120
1189 2921283665
1190 2921290269
1191 2921303998
1192 2924147702
1193 2924157810
1194 2924158719
1195 2924166016
1196 2924178935
1197 2924184400
1198 2924193040
1199 2924199608
1200 2924206407
1201 2924214021
1202 2924220938
1203 2924222024
1204 2924234631
1205 2924741088
1206 2926754849
1207 2926762014
1208 2929142055
1209 2933010447
1210 2933015881
1211 2933597382
1212 2936997499
1213 2937008968
1214 2937015700
1215 2937020941
1216 2937028430
1217 2937031661
1218 2937041405
1219 2937049553
1220 2937056490
1221 2937063822
1222 2937070563
1223 2937077965
1224 2937081554
1225 2937090814
1226 2937098522
1227 2937102890
1228 2937109727
1229 2937118590
1230 2937124140
1231 2937132252
1232 2937840585
1233 2937866116
1234 2937982378
1235 2957376728
1236 2957388485
1237 2957395133
1238 2957401881
1239 2957408522
1240 2957414258
1241 2957429274
1242 2957436747
1243 2957441735
1244 2957448325
1245 2957457055
1246 2957464499
1247 2957470407
1248 2957477877
1249 2957479989
1250 2957491339
1251 2957497597
1252 2957504971
1253 2957512964
1254 2958077176
1255 2958109040
1256 2960584291
1257 2960592864
1258 2960602700
1259 2960610648
1260 2960616816
1261 2960619028
1262 2960631083
1263 2960635527
1264 2960638895
1265 2960646175
1266 2960660200
1267 2960664876
1268 2960673141
1269 2960675241
1270 2960681789
1271 2960693546
1272 2960700715
1273 2961184396
1274 2964608253
1275 2964621518
1276 2964622984
1277 2964635639
1278 2964642961
1279 2964649063
1280 2964655149
1281 2964660042
1282 2964670837
1283 2964671655
1284 2964678364
1285 2964685754
1286 2964698580
1287 2964705052
1288 2964712231
1289 2964713174
1290 2964726777
1291 2967670437
1292 2967672358
1293 2967681311
1294 2967692363
1295 2967696528
1296 2967700592
1297 2967707716
1298 2967721259
1299 2967728438
1300 2967732225
1301 2967738526
1302 2967748538
1303 2967754014
1304 2967757810
1305 2967765733
1306 2967775230
1307 2967782666
1308 2968144376
1309 2970022052
1310 2970028614
1311 2970040595
1312 2970046662
1313 2970048274
1314 2970060568
1315 2970068679
1316 2970075888
1317 2970082036
1318 2970087862
1319 2970095033
1320 2970097264
1321 2970104548
1322 2970114450
1323 2970120904
1324 2970127913
1325 2970133459
1326 2970147399
1327 2970156365
1328 2970163463
1329 2970169944
1330 2970177033
1331 2970184190
1332 2970189698
1333 2970198246
1334 2970535520
1335 2970619868
1336 2970628669
1337 2977523794
1338 2977530254
1339 2977531264
1340 2977543017
1341 2977547428
1342 2977557949
1343 2977560037
1344 2977570553
1345 2977579082
1346 2977583004
1347 2977855249
1348 2977909181
1349 2978972797
1350 2979092716
1351 2979099892
1352 2979104689
1353 2979768470
1354 2979772713
1355 2984513512
1356 2984522907
1357 2984542214
1358 2984591049
1359 2984601642
1360 2989780302
1361 2996890514
1362 3004250432
1363 3005416827
1364 643827592
1365 648740777
1366 650738548
1367 8003573592
1368 8003995519
1369 8004003278
1370 8004316559
1371 8004640002
1372 8005249463
1373 8005262701
1374 8005315969
1375 8005325041
1376 8005487059
1377 8005645251
1378 8005661018
1379 8005687302
1380 8024491068
1381 8046768313
1382 8049296460
1383 8055433011
1384 8057582018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07182

DUF1402

Protein of unknown function (DUF1402)

50

347

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4luq-assembly1.cif.gz_A crystal structure of virulence effector tse3 in complex with neutralizer tsi3 0.5332 72 311
6gi3-assembly1.cif.gz_B structure of lytic transglycosylase mlte mutant s73a from e.coli 0.4492 60 315
4g9s-assembly1.cif.gz_A crystal structure of escherichia coli plig in complex with atlantic salmon g-type lysozyme 0.4482 35 313
6gi4-assembly1.cif.gz_B structure of lytic transglycosylase mlte mutant s75a from e.coli 0.4406 60 315
5ao8-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-nam-pentapeptide 0.4307 35 248
ID Description Score Start End Superfamily
4g9sA00 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.4477 35 313 1.10.530.10
4g9sA00 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.412 35 313 1.10.530.10
4fydB03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.2724 191 298 3.30.420.10
af_Q8N1E2_22_194_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.2675 35 247 1.10.530.10
af_Q8N1E2_22_194_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.2523 35 247 1.10.530.10
ID Description Score Start End GO Terms
AF-A0A528L366-F1-model_v4 DUF1402 family protein 0.931 129 316
AF-A0A530GY35-F1-model_v4 DUF1402 family protein 0.9289 146 316
AF-A0A529QPG0-F1-model_v4 DUF1402 family protein 0.9248 242 316
AF-A0A1L9QC15-F1-model_v4 deleted 0.922 62 316
AF-A0A528AZS9-F1-model_v4 DUF1402 family protein 0.9208 232 307

Map