F475596

General Info

Members Datasets Scaffolds Average Seq Length
692 373 1384 342

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0048187|Ga0439448_0048187_111_1232
Length 373
Sequence LQRLPPSGHRRVTVRAAGFSALRSVTPKELFMRIPSLLPFLLALVAGTALAQKTPLLVYTALETDQLKAYQEGFNKVHPDIELKWVRDSTGVITAKLLAEKANPQADVVMGVAASSLALLGRNGMLEGYKPLNYDAIMKSYVDKNSPPLWWGMDVWGATICFNTVEAQKKNIPKPETWKDLLKPVYKNQIVMPNPASSGTGFFDVTAWLNLWGDDNGKGGGWKFMDGLHENIAQYTHSGSKPCNMAAAGEYVMGISFEYRANANKAKGAPIDLVFPKEGLGWDLEAFAIHKGTKHLDAAKKLADWASSKDAMLLYGKNFAITAQPGVAAPLPNVPKDYESRLVKMDFAWAADNRERILAEWTKRYNAKSEPKK

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
138 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
139 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
145 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
146 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
147 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
149 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
150 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
154 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
223 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
257 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
258 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
311 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
328 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
329 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
330 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
331 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
332 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
333 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
334 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
335 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
336 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
337 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
338 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
339 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
340 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
341 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
342 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
343 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
344 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
345 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
346 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
347 2643221569 Achromobacter sp. Root565 Isolate Unclassified
348 2643221594 Achromobacter sp. Root170 Isolate Unclassified
349 2643221621 Achromobacter sp. Root83 Isolate Unclassified
350 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
351 2738543012 Acidovorax sp. CF301 Isolate Unclassified
352 2738543013 Variovorax sp. BT01 Isolate Unclassified
353 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
354 2816332133 Acidovorax radicis 2721A Isolate Unclassified
355 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
356 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
357 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
358 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
359 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
360 2842747753 Variovorax sp. R-72060 Isolate Unclassified
361 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
362 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
363 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
364 2858950400 Achromobacter sp. K91 Isolate Unclassified
365 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
366 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
367 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
368 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
369 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
370 2941479691
371 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
372 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
373 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 0
Isolates 4.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.33
Nodule 1.01
Rhizoplane 0.87
Rhizosphere 71.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0048187 3300042005 Bacteria 1391
2 JGI25155J39150_1000121 3300002704 Bacteria 38491
3 JGI25156J39149_1000100 3300002705 Bacteria 63565
4 JGI25154J39366_1000121 3300002738 Bacteria 62887
5 JGI25157J39369_1000130 3300002741 Bacteria 63360
6 JGI25150J39212_1001519 3300002774 Bacteria 6391
7 JGI25150J39212_1008535 3300002774 Bacteria 2000
8 JGI25159J45721_1000190 3300002987 Bacteria 28606
9 JGI25159J45721_1002986 3300002987 Bacteria 6144
10 JGI25151J46595_10018837 3300003187 Bacteria 2951
11 JGI25151J46595_10019083 3300003187 Bacteria 2923
12 JGI25153J46596_10002339 3300003215 Bacteria 10998
13 rootH1_10071182 3300003316 Bacteria 1986
14 rootL2_10086437 3300003322 Bacteria 1653
15 rootL2_10156818 3300003322 Bacteria 1335
16 JGI25160J50197_1000345 3300003354 Bacteria 30950
17 JGI25161J50226_1000007 3300003374 Bacteria 256181
18 Ga0055538_1000002 3300003751 Bacteria 999437
19 Ga0055539_1000002 3300003752 Bacteria 999437
20 Ga0055533_1000004 3300003756 Bacteria 999437
21 Ga0055525_1000002 3300003759 Bacteria 999437
22 Ga0055526_1000020 3300003771 Bacteria 188230
23 Ga0055526_1008255 3300003771 Bacteria 5230
24 Ga0055526_1012497 3300003771 Bacteria 3695
25 Ga0055526_1020106 3300003771 Bacteria 2395
26 Ga0055537_1000183 3300003773 Bacteria 46516
27 Ga0055537_1000254 3300003773 Bacteria 38945
28 Ga0055537_1006677 3300003773 Bacteria 2888
29 Ga0055524_1000101 3300003775 Bacteria 106527
30 Ga0055524_1000471 3300003775 Bacteria 32322
31 Ga0055536_1017457 3300003781 Bacteria 2348
32 Ga0055534_1001095 3300003784 Bacteria 11537
33 Ga0055534_1001577 3300003784 Bacteria 8856
34 Ga0055528_1001026 3300003790 Bacteria 18496
35 Ga0055530_10001334 3300003791 Bacteria 18475
36 Ga0055540_1000099 3300003792 Bacteria 96187
37 Ga0055531_10013122 3300003794 Bacteria 3844
38 Ga0055541_1000002 3300003841 Bacteria 896405
39 Ga0055543_1001205 3300004625 Bacteria 10864
40 Ga0065715_10049973 3300005293 Bacteria 1219
41 Ga0065707_10021263 3300005295 Bacteria 1443
42 Ga0065707_10025584 3300005295 Bacteria 1763
43 Ga0065707_10093320 3300005295 Bacteria 3643
44 Ga0070658_10221720 3300005327 Bacteria 1599
45 Ga0070676_10005475 3300005328 Bacteria 6762
46 Ga0070676_10054864 3300005328 Bacteria 2350
47 Ga0070676_10059423 3300005328 Bacteria 2267
48 Ga0070683_100043020 3300005329 Bacteria 4161
49 Ga0070690_100002075 3300005330 Bacteria 10702
50 Ga0070690_100043091 3300005330 Bacteria 2860
51 Ga0070670_100008340 3300005331 Bacteria 8832
52 Ga0070670_100146042 3300005331 Bacteria 2046
53 Ga0070670_100174832 3300005331 Bacteria 1863
54 Ga0070670_100286220 3300005331 Bacteria 1439
55 Ga0070666_10004654 3300005335 Bacteria 8378
56 Ga0068868_100003547 3300005338 Bacteria 10876
57 Ga0068868_100118838 3300005338 Bacteria 2155
58 Ga0068868_100176798 3300005338 Bacteria 1769
59 Ga0068868_100338209 3300005338 Bacteria 1286
60 Ga0070660_100057090 3300005339 Bacteria 3023
61 Ga0070689_100046642 3300005340 Bacteria 3339
62 Ga0070691_10102727 3300005341 Bacteria 1421
63 Ga0070661_100044865 3300005344 Bacteria 3230
64 Ga0070692_10200717 3300005345 Bacteria 1168
65 Ga0070668_100008228 3300005347 Bacteria 7744
66 Ga0070668_100069906 3300005347 Bacteria 2732
67 Ga0070669_100012786 3300005353 Bacteria 5959
68 Ga0070669_100036817 3300005353 Bacteria 3547
69 Ga0070669_100150414 3300005353 Bacteria 1802
70 Ga0070675_100019717 3300005354 Bacteria 5377
71 Ga0070675_100101870 3300005354 Bacteria 2419
72 Ga0070675_100111346 3300005354 Bacteria 2316
73 Ga0070675_100122376 3300005354 Bacteria 2211
74 Ga0070675_100191275 3300005354 Bacteria 1773
75 Ga0070675_100201967 3300005354 Bacteria 1725
76 Ga0070671_100005362 3300005355 Bacteria 10225
77 Ga0070671_100012210 3300005355 Bacteria 6909
78 Ga0070671_100033723 3300005355 Bacteria 4236
79 Ga0070671_100042851 3300005355 Bacteria 3763
80 Ga0070671_100073624 3300005355 Bacteria 2853
81 Ga0070671_100076416 3300005355 Bacteria 2798
82 Ga0070674_100004474 3300005356 Bacteria 7976
83 Ga0070674_100074001 3300005356 Bacteria 2416
84 Ga0070674_100109658 3300005356 Bacteria 2024
85 Ga0070674_100130689 3300005356 Bacteria 1871
86 Ga0070673_100000694 3300005364 Bacteria 18557
87 Ga0070673_100069049 3300005364 Bacteria 2831
88 Ga0070673_100078150 3300005364 Bacteria 2676
89 Ga0070673_100112208 3300005364 Bacteria 2263
90 Ga0070673_100260087 3300005364 Bacteria 1516
91 Ga0070688_100009318 3300005365 Bacteria 5365
92 Ga0070688_100038186 3300005365 Bacteria 2931
93 Ga0070659_100028990 3300005366 Bacteria 4277
94 Ga0070667_100010648 3300005367 Bacteria 7595
95 Ga0070667_100016789 3300005367 Bacteria 6057
96 Ga0070667_100051232 3300005367 Bacteria 3480
97 Ga0070667_100262524 3300005367 Bacteria 1547
98 Ga0070701_10030791 3300005438 Bacteria 2657
99 Ga0070701_10068255 3300005438 Bacteria 1894
100 Ga0070701_10093623 3300005438 Bacteria 1651
101 Ga0070705_100040144 3300005440 Bacteria 2660
102 Ga0070694_100004656 3300005444 Bacteria 8251
103 Ga0070694_100005264 3300005444 Bacteria 7820
104 Ga0070708_100000315 3300005445 Bacteria 36417
105 Ga0070708_100465395 3300005445 Bacteria 1193
106 Ga0070663_100071966 3300005455 Bacteria 2517
107 Ga0070678_100022799 3300005456 Bacteria 4158
108 Ga0070678_100128903 3300005456 Bacteria 2007
109 Ga0070678_100169129 3300005456 Bacteria 1778
110 Ga0070678_100242948 3300005456 Bacteria 1506
111 Ga0070662_100061938 3300005457 Bacteria 2732
112 Ga0070681_10199563 3300005458 Bacteria 1919
113 Ga0068867_100023179 3300005459 Bacteria 4443
114 Ga0068867_100047316 3300005459 Bacteria 3162
115 Ga0068867_100337972 3300005459 Bacteria 1253
116 Ga0070685_10211923 3300005466 Bacteria 1265
117 Ga0070706_100002711 3300005467 Bacteria 17718
118 Ga0070707_100175814 3300005468 Bacteria 2087
119 Ga0070707_100256972 3300005468 Bacteria 1700
120 Ga0070698_100131622 3300005471 Bacteria 2457
121 Ga0070698_100154513 3300005471 Bacteria 2240
122 Ga0070684_100203051 3300005535 Bacteria 1806
123 Ga0070684_100503726 3300005535 Bacteria 1121
124 Ga0068853_100061096 3300005539 Bacteria 3259
125 Ga0070672_100035426 3300005543 Bacteria 3794
126 Ga0070672_100100188 3300005543 Bacteria 2349
127 Ga0070672_100277629 3300005543 Bacteria 1416
128 Ga0070672_100280430 3300005543 Bacteria 1409
129 Ga0070686_100177796 3300005544 Bacteria 1510
130 Ga0070695_100041780 3300005545 Bacteria 2908
131 Ga0070696_100027522 3300005546 Bacteria 3874
132 Ga0070693_100001479 3300005547 Bacteria 10573
133 Ga0070693_100016391 3300005547 Bacteria 3835
134 Ga0070665_100053512 3300005548 Bacteria 4048
135 Ga0070665_100119200 3300005548 Bacteria 2641
136 Ga0070665_100216738 3300005548 Bacteria 1915
137 Ga0070704_100018982 3300005549 Bacteria 4411
138 Ga0070704_100028056 3300005549 Bacteria 3740
139 Ga0070704_100034749 3300005549 Bacteria 3421
140 Ga0070704_100124000 3300005549 Bacteria 1990
141 Ga0068855_100000046 3300005563 Bacteria 147225
142 Ga0068855_100034097 3300005563 Bacteria 6073
143 Ga0070664_100031391 3300005564 Bacteria 4438
144 Ga0070664_100047904 3300005564 Bacteria 3612
145 Ga0070664_100121069 3300005564 Bacteria 2291
146 Ga0068857_100052496 3300005577 Bacteria 3617
147 Ga0068857_100066359 3300005577 Bacteria 3211
148 Ga0068857_100078704 3300005577 Bacteria 2942
149 Ga0068854_100038067 3300005578 Bacteria 3380
150 Ga0068854_100091832 3300005578 Bacteria 2260
151 Ga0068856_100027043 3300005614 Bacteria 5596
152 Ga0068856_100107861 3300005614 Bacteria 2781
153 Ga0070702_100131219 3300005615 Bacteria 1583
154 Ga0068852_100070416 3300005616 Bacteria 3068
155 Ga0068852_100282928 3300005616 Bacteria 1599
156 Ga0068852_100406297 3300005616 Bacteria 1340
157 Ga0068859_100023632 3300005617 Bacteria 6169
158 Ga0068859_100044579 3300005617 Bacteria 4457
159 Ga0068864_100000351 3300005618 Bacteria 40447
160 Ga0068864_100027130 3300005618 Bacteria 4833
161 Ga0068864_100116200 3300005618 Bacteria 2387
162 Ga0068866_10063236 3300005718 Bacteria 1929
163 Ga0068866_10183807 3300005718 Bacteria 1237
164 Ga0068861_100002726 3300005719 Bacteria 11573
165 Ga0068851_10020708 3300005834 Bacteria 3187
166 Ga0068851_10030875 3300005834 Bacteria 2659
167 Ga0068851_10064987 3300005834 Bacteria 1876
168 Ga0068851_10101875 3300005834 Bacteria 1525
169 Ga0068851_10119175 3300005834 Bacteria 1417
170 Ga0068863_100002991 3300005841 Bacteria 16705
171 Ga0068863_100093690 3300005841 Bacteria 2850
172 Ga0068858_100000729 3300005842 Bacteria 34410
173 Ga0068858_100003527 3300005842 Bacteria 15491
174 Ga0068858_100007317 3300005842 Bacteria 10689
175 Ga0068858_100030103 3300005842 Bacteria 5041
176 Ga0068858_100159500 3300005842 Bacteria 2124
177 Ga0068858_100201199 3300005842 Bacteria 1884
178 Ga0068860_100002318 3300005843 Bacteria 20001
179 Ga0068860_100020683 3300005843 Bacteria 6375
180 Ga0068860_100020950 3300005843 Bacteria 6335
181 Ga0068860_100060223 3300005843 Bacteria 3608
182 Ga0068860_100103009 3300005843 Bacteria 2724
183 Ga0068860_100145922 3300005843 Bacteria 2277
184 Ga0081455_10055091 3300005937 Bacteria 3384
185 Ga0081455_10099808 3300005937 Bacteria 2334
186 Ga0081539_10071773 3300005985 Bacteria 1853
187 Ga0075365_10063964 3300006038 Bacteria 2463
188 Ga0075363_100152511 3300006048 Bacteria 1305
189 Ga0075364_10039346 3300006051 Bacteria 3065
190 Ga0075364_10095096 3300006051 Bacteria 1980
191 Ga0075432_10005083 3300006058 Bacteria 4481
192 Ga0075362_10043772 3300006177 Bacteria 1983
193 Ga0075367_10133118 3300006178 Bacteria 1538
194 Ga0075366_10022146 3300006195 Bacteria 3695
195 Ga0075366_10058455 3300006195 Bacteria 2290
196 Ga0075366_10059689 3300006195 Bacteria 2265
197 Ga0075366_10117996 3300006195 Bacteria 1598
198 Ga0097621_100005396 3300006237 Bacteria 9010
199 Ga0097621_100009828 3300006237 Bacteria 6964
200 Ga0097621_100065188 3300006237 Bacteria 2997
201 Ga0097621_100065508 3300006237 Bacteria 2990
202 Ga0097621_100155137 3300006237 Bacteria 1965
203 Ga0097621_100158974 3300006237 Bacteria 1941
204 Ga0075370_10001530 3300006353 Bacteria 10118
205 Ga0075370_10001898 3300006353 Bacteria 9394
206 Ga0075370_10003975 3300006353 Bacteria 7105
207 Ga0068871_100012921 3300006358 Bacteria 6183
208 Ga0068871_100056592 3300006358 Bacteria 3188
209 Ga0068871_100072962 3300006358 Bacteria 2828
210 Ga0068871_100346266 3300006358 Bacteria 1313
211 Ga0075428_100061865 3300006844 Bacteria 4099
212 Ga0075428_100145137 3300006844 Bacteria 2579
213 Ga0075428_100348057 3300006844 Bacteria 1591
214 Ga0075430_100071766 3300006846 Bacteria 2904
215 Ga0075430_100250233 3300006846 Bacteria 1468
216 Ga0075431_100189735 3300006847 Bacteria 2106
217 Ga0075433_10192723 3300006852 Bacteria 1813
218 Ga0075429_100189647 3300006880 Bacteria 1801
219 Ga0068865_100025960 3300006881 Bacteria 3859
220 Ga0075436_100112267 3300006914 Bacteria 1903
221 Ga0097620_100023632 3300006931 Bacteria 6169
222 Ga0097620_100044579 3300006931 Bacteria 4457
223 Ga0099826_10181283 3300006948 Bacteria 1171
224 Ga0105240_10112430 3300009093 Bacteria 3292
225 Ga0105240_10331093 3300009093 Bacteria 1733
226 Ga0111539_10002368 3300009094 Bacteria 25057
227 Ga0111539_10122371 3300009094 Bacteria 3049
228 Ga0111539_10144487 3300009094 Bacteria 2785
229 Ga0105245_10059808 3300009098 Bacteria 3431
230 Ga0105245_10150428 3300009098 Bacteria 2200
231 Ga0105243_10098763 3300009148 Bacteria 2419
232 Ga0105243_10130233 3300009148 Bacteria 2133
233 Ga0105241_10138049 3300009174 Bacteria 1982
234 Ga0105241_10290324 3300009174 Bacteria 1400
235 Ga0105242_10013179 3300009176 Bacteria 6381
236 Ga0105242_10022167 3300009176 Bacteria 4991
237 Ga0105242_10067299 3300009176 Bacteria 2961
238 Ga0105242_10205197 3300009176 Bacteria 1753
239 Ga0105248_10061085 3300009177 Bacteria 4230
240 Ga0105248_10091165 3300009177 Bacteria 3433
241 Ga0105248_10123781 3300009177 Bacteria 2917
242 Ga0105248_10207135 3300009177 Bacteria 2210
243 Ga0105237_10020547 3300009545 Bacteria 6805
244 Ga0105238_10000917 3300009551 Bacteria 30127
245 Ga0105238_10025045 3300009551 Bacteria 6082
246 Ga0105238_10244185 3300009551 Bacteria 1773
247 Ga0105249_10016622 3300009553 Bacteria 6531
248 Ga0105249_10038399 3300009553 Bacteria 4345
249 Ga0105249_10260785 3300009553 Bacteria 1722
250 Ga0105239_10054317 3300010375 Bacteria 4393
251 Ga0157373_10037647 3300013100 Bacteria 3467
252 Ga0157371_10160387 3300013102 Bacteria 1606
253 Ga0157369_10100400 3300013105 Bacteria 3085
254 Ga0157374_10016933 3300013296 Bacteria 6416
255 Ga0157378_10090108 3300013297 Bacteria 2787
256 Ga0163162_10002191 3300013306 Bacteria 18337
257 Ga0163162_10026458 3300013306 Bacteria 5732
258 Ga0163162_10033724 3300013306 Bacteria 5088
259 Ga0163162_10048294 3300013306 Bacteria 4264
260 Ga0163162_10049807 3300013306 Bacteria 4199
261 Ga0157372_10047788 3300013307 Bacteria 4756
262 Ga0157375_10012843 3300013308 Bacteria 7438
263 Ga0157375_10059291 3300013308 Bacteria 3791
264 Ga0157375_10367720 3300013308 Bacteria 1604
265 Ga0163163_10005668 3300014325 Bacteria 10830
266 Ga0163163_10029776 3300014325 Bacteria 5253
267 Ga0157380_10154758 3300014326 Bacteria 1986
268 Ga0157380_10157950 3300014326 Bacteria 1967
269 Ga0157377_10137467 3300014745 Bacteria 1499
270 Ga0157379_10004055 3300014968 Bacteria 12495
271 Ga0157379_10112884 3300014968 Bacteria 2442
272 Ga0157379_10148229 3300014968 Bacteria 2116
273 Ga0157376_10047037 3300014969 Bacteria 3561
274 Ga0157376_10049589 3300014969 Bacteria 3478
275 Ga0182006_1010159 3300015261 Bacteria 4195
276 Ga0183362_10002 3300015683 Bacteria 1432711
277 Ga0163161_10021414 3300017792 Bacteria 4544
278 Ga0163161_10079810 3300017792 Bacteria 2407
279 Ga0213872_10000309 3300021361 Bacteria 41727
280 Ga0213872_10020490 3300021361 Bacteria 3048
281 Ga0209435_100008 3300025206 Bacteria 503644
282 Ga0209436_107453 3300025208 Bacteria 2284
283 Ga0209784_100002 3300025224 Bacteria 1753105
284 Ga0209566_100003 3300025225 Bacteria 1753105
285 Ga0209674_100004 3300025226 Bacteria 1753105
286 Ga0209563_100006 3300025230 Bacteria 1753105
287 Ga0207425_1000606 3300025245 Bacteria 20792
288 Ga0207425_1014645 3300025245 Bacteria 1776
289 Ga0209646_1000079 3300025246 Bacteria 207677
290 Ga0209026_1000067 3300025250 Bacteria 207677
291 Ga0209677_100003 3300025253 Bacteria 1753105
292 Ga0209759_1000056 3300025256 Bacteria 207677
293 Ga0209129_1007932 3300025258 Bacteria 3047
294 Ga0209565_1000041 3300025263 Bacteria 251081
295 Ga0209565_1000849 3300025263 Bacteria 17247
296 Ga0209673_1000012 3300025273 Bacteria 579480
297 Ga0209130_1000014 3300025284 Bacteria 412039
298 Ga0209130_1000184 3300025284 Bacteria 87817
299 Ga0207673_1007572 3300025290 Bacteria 1364
300 Ga0209675_1000475 3300025291 Bacteria 30742
301 Ga0209675_1000771 3300025291 Bacteria 21464
302 Ga0209675_1007151 3300025291 Bacteria 4330
303 Ga0209676_1000013 3300025292 Bacteria 816080
304 Ga0209676_1003804 3300025292 Bacteria 8920
305 Ga0209676_1004437 3300025292 Bacteria 7827
306 Ga0209676_1004828 3300025292 Bacteria 7319
307 Ga0209564_1001251 3300025295 Bacteria 28255
308 Ga0209564_1001414 3300025295 Bacteria 24743
309 Ga0209564_1006578 3300025295 Bacteria 6234
310 Ga0209758_1001500 3300025297 Bacteria 27142
311 Ga0209758_1006824 3300025297 Bacteria 8001
312 Ga0209050_1000008 3300025298 Bacteria 1144179
313 Ga0209050_1003807 3300025298 Bacteria 10766
314 Ga0209050_1004622 3300025298 Bacteria 9190
315 Ga0209050_1013208 3300025298 Bacteria 3692
316 Ga0209256_1000003 3300025299 Bacteria 1661127
317 Ga0209256_1037408 3300025299 Bacteria 1264
318 Ga0207426_1000091 3300025302 Bacteria 280561
319 Ga0209051_1000005 3300025303 Bacteria 1142353
320 Ga0209051_1003394 3300025303 Bacteria 10450
321 Ga0209257_1000048 3300025304 Bacteria 455536
322 Ga0207697_10003156 3300025315 Bacteria 8217
323 Ga0207656_10018982 3300025321 Bacteria 2715
324 Ga0207656_10019459 3300025321 Bacteria 2686
325 Ga0207656_10057726 3300025321 Bacteria 1694
326 Ga0207656_10087617 3300025321 Bacteria 1408
327 Ga0207682_10012204 3300025893 Bacteria 3354
328 Ga0207680_10002176 3300025903 Bacteria 9180
329 Ga0207645_10013887 3300025907 Bacteria 5403
330 Ga0207645_10040010 3300025907 Bacteria 3003
331 Ga0207645_10087083 3300025907 Bacteria 2007
332 Ga0207643_10059044 3300025908 Bacteria 2188
333 Ga0207643_10081964 3300025908 Bacteria 1870
334 Ga0207705_10221420 3300025909 Bacteria 1438
335 Ga0207654_10162794 3300025911 Bacteria 1442
336 Ga0207707_10165411 3300025912 Bacteria 1933
337 Ga0207695_10001065 3300025913 Bacteria 48010
338 Ga0207695_10012472 3300025913 Bacteria 10200
339 Ga0207695_10081043 3300025913 Bacteria 3286
340 Ga0207695_10127174 3300025913 Bacteria 2509
341 Ga0207671_10011643 3300025914 Bacteria 7137
342 Ga0207660_10171494 3300025917 Bacteria 1680
343 Ga0207662_10091275 3300025918 Bacteria 1874
344 Ga0207657_10087855 3300025919 Bacteria 2600
345 Ga0207649_10001848 3300025920 Bacteria 12101
346 Ga0207652_10020652 3300025921 Bacteria 5427
347 Ga0207646_10102106 3300025922 Bacteria 2571
348 Ga0207681_10060356 3300025923 Bacteria 2603
349 Ga0207681_10132286 3300025923 Bacteria 1846
350 Ga0207694_10000446 3300025924 Bacteria 38303
351 Ga0207694_10021587 3300025924 Bacteria 4879
352 Ga0207694_10084479 3300025924 Bacteria 2497
353 Ga0207650_10000970 3300025925 Bacteria 21577
354 Ga0207650_10007280 3300025925 Bacteria 7535
355 Ga0207650_10021249 3300025925 Bacteria 4588
356 Ga0207659_10000781 3300025926 Bacteria 18812
357 Ga0207659_10005370 3300025926 Bacteria 7762
358 Ga0207659_10017024 3300025926 Bacteria 4743
359 Ga0207659_10022515 3300025926 Bacteria 4196
360 Ga0207659_10063619 3300025926 Bacteria 2667
361 Ga0207659_10184227 3300025926 Bacteria 1657
362 Ga0207687_10067989 3300025927 Bacteria 2536
363 Ga0207687_10145697 3300025927 Bacteria 1802
364 Ga0207644_10000899 3300025931 Bacteria 18825
365 Ga0207644_10003807 3300025931 Bacteria 9770
366 Ga0207644_10013865 3300025931 Bacteria 5383
367 Ga0207644_10041525 3300025931 Bacteria 3254
368 Ga0207644_10162676 3300025931 Bacteria 1736
369 Ga0207644_10332590 3300025931 Bacteria 1230
370 Ga0207690_10011751 3300025932 Bacteria 5237
371 Ga0207706_10095355 3300025933 Bacteria 2617
372 Ga0207686_10001268 3300025934 Bacteria 14522
373 Ga0207686_10003551 3300025934 Bacteria 8367
374 Ga0207686_10006148 3300025934 Bacteria 6450
375 Ga0207686_10006189 3300025934 Bacteria 6433
376 Ga0207686_10096621 3300025934 Bacteria 1963
377 Ga0207686_10120740 3300025934 Bacteria 1783
378 Ga0207709_10029914 3300025935 Bacteria 3164
379 Ga0207669_10010778 3300025937 Bacteria 4416
380 Ga0207669_10019707 3300025937 Bacteria 3520
381 Ga0207669_10121296 3300025937 Bacteria 1775
382 Ga0207704_10032343 3300025938 Bacteria 2959
383 Ga0207704_10138846 3300025938 Bacteria 1696
384 Ga0207691_10000699 3300025940 Bacteria 33182
385 Ga0207691_10002051 3300025940 Bacteria 19693
386 Ga0207691_10013535 3300025940 Bacteria 7802
387 Ga0207691_10043113 3300025940 Bacteria 4159
388 Ga0207691_10062341 3300025940 Bacteria 3384
389 Ga0207691_10077728 3300025940 Bacteria 2989
390 Ga0207691_10091581 3300025940 Bacteria 2724
391 Ga0207691_10130672 3300025940 Bacteria 2219
392 Ga0207691_10286073 3300025940 Bacteria 1418
393 Ga0207711_10088590 3300025941 Bacteria 2718
394 Ga0207711_10131505 3300025941 Bacteria 2244
395 Ga0207689_10008871 3300025942 Bacteria 8727
396 Ga0207689_10012877 3300025942 Bacteria 7144
397 Ga0207689_10043811 3300025942 Bacteria 3699
398 Ga0207689_10062550 3300025942 Bacteria 3061
399 Ga0207689_10066991 3300025942 Bacteria 2951
400 Ga0207689_10093104 3300025942 Bacteria 2475
401 Ga0207679_10015442 3300025945 Bacteria 5046
402 Ga0207679_10185577 3300025945 Bacteria 1724
403 Ga0207679_10241447 3300025945 Bacteria 1531
404 Ga0207667_10000036 3300025949 Bacteria 297966
405 Ga0207667_10053810 3300025949 Bacteria 4234
406 Ga0207651_10005355 3300025960 Bacteria 6581
407 Ga0207651_10074131 3300025960 Bacteria 2423
408 Ga0207651_10180655 3300025960 Bacteria 1673
409 Ga0207712_10073144 3300025961 Bacteria 2471
410 Ga0207712_10240967 3300025961 Bacteria 1457
411 Ga0207668_10006822 3300025972 Bacteria 6767
412 Ga0207668_10161281 3300025972 Bacteria 1747
413 Ga0207640_10021988 3300025981 Bacteria 3810
414 Ga0207640_10103223 3300025981 Bacteria 2004
415 Ga0207640_10234851 3300025981 Bacteria 1413
416 Ga0207658_10022502 3300025986 Bacteria 4389
417 Ga0207677_10008047 3300026023 Bacteria 5869
418 Ga0207677_10014636 3300026023 Bacteria 4589
419 Ga0207677_10125202 3300026023 Bacteria 1941
420 Ga0207703_10002007 3300026035 Bacteria 17969
421 Ga0207703_10017382 3300026035 Bacteria 5615
422 Ga0207703_10030390 3300026035 Bacteria 4269
423 Ga0207703_10077061 3300026035 Bacteria 2767
424 Ga0207639_10091133 3300026041 Bacteria 2440
425 Ga0207678_10024103 3300026067 Bacteria 5317
426 Ga0207678_10074208 3300026067 Bacteria 2915
427 Ga0207702_10014485 3300026078 Bacteria 6548
428 Ga0207702_10042536 3300026078 Bacteria 3811
429 Ga0207702_10143889 3300026078 Bacteria 2161
430 Ga0207641_10028000 3300026088 Bacteria 4654
431 Ga0207648_10000556 3300026089 Bacteria 41762
432 Ga0207648_10027677 3300026089 Bacteria 5031
433 Ga0207648_10071974 3300026089 Bacteria 3013
434 Ga0207648_10143811 3300026089 Bacteria 2103
435 Ga0207648_10283153 3300026089 Bacteria 1483
436 Ga0207676_10002172 3300026095 Bacteria 14148
437 Ga0207676_10047336 3300026095 Bacteria 3332
438 Ga0207676_10051685 3300026095 Bacteria 3209
439 Ga0207674_10022936 3300026116 Bacteria 6696
440 Ga0207675_100002028 3300026118 Bacteria 20196
441 Ga0207683_10019395 3300026121 Bacteria 5807
442 Ga0207683_10086108 3300026121 Bacteria 2793
443 Ga0207683_10251362 3300026121 Bacteria 1613
444 Ga0207698_10176448 3300026142 Bacteria 1887
445 Ga0209969_1011759 3300027360 Bacteria 1259
446 Ga0209981_1008816 3300027378 Bacteria 1371
447 Ga0209966_1018790 3300027695 Bacteria 1326
448 Ga0207428_10015146 3300027907 Bacteria 6673
449 Ga0207428_10038230 3300027907 Bacteria 3902
450 Ga0268265_10133883 3300028380 Bacteria 2064
451 Ga0268265_10134579 3300028380 Bacteria 2060
452 Ga0268265_10219514 3300028380 Bacteria 1662
453 Ga0268265_10357048 3300028380 Bacteria 1336
454 Ga0268264_10017825 3300028381 Bacteria 5812
455 Ga0268264_10018647 3300028381 Bacteria 5673
456 Ga0268264_10146873 3300028381 Bacteria 2110
457 Ga0307517_10009075 3300028786 Bacteria 14168
458 Ga0307517_10047929 3300028786 Bacteria 4412
459 Ga0307515_10000049 3300028794 Bacteria 278611
460 Ga0307515_10000485 3300028794 Bacteria 94915
461 Ga0307515_10028979 3300028794 Bacteria 9381
462 Ga0307515_10040590 3300028794 Bacteria 7353
463 Ga0307515_10116866 3300028794 Bacteria 3058
464 Ga0265332_10003549 3300031238 Bacteria 7501
465 Ga0265328_10072432 3300031239 Bacteria 1267
466 Ga0307513_10002838 3300031456 Bacteria 23744
467 Ga0307513_10004164 3300031456 Bacteria 19364
468 Ga0307513_10105397 3300031456 Bacteria 2829
469 Ga0307513_10151350 3300031456 Bacteria 2228
470 Ga0307509_10000092 3300031507 Bacteria 124019
471 Ga0307509_10002037 3300031507 Bacteria 33298
472 Ga0307509_10042928 3300031507 Bacteria 4896
473 Ga0307408_100002928 3300031548 Bacteria 11829
474 Ga0307408_100012702 3300031548 Bacteria 5585
475 Ga0307408_100033563 3300031548 Bacteria 3587
476 Ga0307408_100054287 3300031548 Bacteria 2897
477 Ga0307408_100134940 3300031548 Bacteria 1930
478 Ga0307508_10001131 3300031616 Bacteria 30761
479 Ga0307508_10003490 3300031616 Bacteria 15867
480 Ga0307514_10000200 3300031649 Bacteria 167194
481 Ga0307514_10000225 3300031649 Bacteria 151002
482 Ga0265314_10001584 3300031711 Bacteria 25021
483 Ga0307516_10000921 3300031730 Bacteria 40429
484 Ga0307405_10020379 3300031731 Bacteria 3704
485 Ga0307413_10034040 3300031824 Bacteria 2908
486 Ga0307413_10035752 3300031824 Bacteria 2853
487 Ga0307413_10136874 3300031824 Bacteria 1686
488 Ga0307410_10019217 3300031852 Bacteria 4151
489 Ga0307410_10022308 3300031852 Bacteria 3911
490 Ga0307406_10003971 3300031901 Bacteria 8041
491 Ga0307406_10010157 3300031901 Bacteria 5304
492 Ga0307407_10064951 3300031903 Bacteria 2147
493 Ga0307407_10141455 3300031903 Bacteria 1553
494 Ga0307412_10000555 3300031911 Bacteria 22198
495 Ga0307412_10066780 3300031911 Bacteria 2439
496 Ga0307412_10084366 3300031911 Bacteria 2205
497 Ga0307409_100000467 3300031995 Bacteria 17264
498 Ga0307409_100465647 3300031995 Bacteria 1223
499 Ga0307416_100106798 3300032002 Bacteria 2455
500 Ga0307416_100120510 3300032002 Bacteria 2336
501 Ga0307416_100144348 3300032002 Bacteria 2170
502 Ga0307414_10071742 3300032004 Bacteria 2499
503 Ga0307411_10005170 3300032005 Bacteria 6380
504 Ga0307411_10021368 3300032005 Bacteria 3786
505 Ga0307411_10051162 3300032005 Bacteria 2694
506 Ga0307411_10116765 3300032005 Bacteria 1922
507 Ga0307415_100009800 3300032126 Bacteria 5393
508 Ga0307415_100235268 3300032126 Bacteria 1478
509 Ga0307510_10001210 3300033180 Bacteria 27978
510 Ga0373943_0148996 3300035170 Bacteria 1266
511 Ga0373955_0194819 3300035172 Bacteria 1206
512 Ga0373931_0040703 3300035691 Bacteria 2439
513 Ga0373927_0032741 3300035695 Bacteria 3386
514 Ga0373933_0243830 3300035724 Bacteria 1156
515 Ga0373947_0027386 3300035725 Bacteria 3336
516 Ga0373937_0494548 3300036401 Bacteria 1162
517 Ga0373925_0010856 3300037068 Bacteria 6606
518 Ga0373925_0027694 3300037068 Bacteria 4148
519 Ga0373925_0224749 3300037068 Bacteria 1499
520 Ga0395900_0089243 3300037418 Bacteria 3169
521 Ga0395900_0131119 3300037418 Bacteria 2569
522 Ga0395905_0000047 3300037471 Bacteria 237582
523 Ga0395905_0001267 3300037471 Bacteria 31206
524 Ga0395905_0003737 3300037471 Bacteria 16126
525 Ga0395905_0016587 3300037471 Bacteria 7000
526 Ga0395905_0020586 3300037471 Bacteria 6246
527 Ga0436365_0761091 3300039437 Bacteria 1133
528 Ga0436365_1311379 3300039437 Bacteria 4381
529 Ga0436361_0236312 3300039447 Bacteria 14640
530 Ga0436361_0545923 3300039447 Bacteria 57292
531 Ga0436361_0782766 3300039447 Bacteria 5609
532 Ga0439431_0002520 3300041997 Bacteria 4050
533 Ga0450911_000410 3300042115 Bacteria 14168
534 Ga0439435_0000488 3300042436 Bacteria 6305
535 Ga0439460_0012015 3300042461 Bacteria 2239
536 Ga0451577_0005487 3300042876 Bacteria 12985
537 Ga0451577_0101670 3300042876 Bacteria 2568
538 Ga0466969_0035807 3300044656 Bacteria 2509
539 Ga0453683_0214985 3300044673 Bacteria 1222
540 Ga0453684_0033003 3300044712 Bacteria 7226
541 Ga0453684_0038319 3300044712 Bacteria 6556
542 Ga0453684_0082011 3300044712 Bacteria 4019
543 Ga0466971_0057708 3300044719 Bacteria 1752
544 Ga0495592_0000413 3300046454 Bacteria 32677
545 Ga0495629_0022966 3300046459 Bacteria 4446
546 Ga0495580_0065960 3300046472 Bacteria 2535
547 Ga0495580_0068885 3300046472 Bacteria 2473
548 Ga0495607_0000386 3300046501 Bacteria 45031
549 Ga0495608_0050822 3300046511 Bacteria 2750
550 Ga0495632_0005226 3300046519 Bacteria 8651
551 Ga0495632_0012832 3300046519 Bacteria 4809
552 Ga0495666_0024170 3300046526 Bacteria 3003
553 Ga0495652_0130108 3300046529 Bacteria 1994
554 Ga0495654_0005706 3300046530 Bacteria 7177
555 Ga0495654_0093560 3300046530 Bacteria 1392
556 Ga0495621_0002601 3300046539 Bacteria 4874
557 Ga0495597_0000116 3300046542 Bacteria 72210
558 Ga0495645_0038509 3300046543 Bacteria 3487
559 Ga0495633_0003149 3300046558 Bacteria 11172
560 Ga0495668_0039347 3300046616 Bacteria 2640
561 Ga0495634_0089188 3300046642 Bacteria 2005
562 Ga0495599_0146676 3300046678 Bacteria 1462
563 Ga0495647_0082743 3300046681 Bacteria 1304
564 Ga0495658_0037329 3300046683 Bacteria 2685
565 Ga0495658_0141810 3300046683 Bacteria 1470
566 Ga0495658_0150575 3300046683 Bacteria 1429
567 Ga0495669_0022259 3300046684 Bacteria 2753
568 Ga0495613_0107558 3300046689 Bacteria 2012
569 Ga0495636_0009989 3300047318 Bacteria 3741
570 Ga0495674_0019794 3300047319 Bacteria 6241
571 Ga0495687_001245 3300047443 Bacteria 24266
572 Ga0495687_007634 3300047443 Bacteria 6335
573 Ga0495681_0025029 3300047470 Bacteria 3129
574 Ga0495686_0002020 3300047472 Bacteria 20040
575 Ga0495593_0103305 3300047673 Bacteria 1460
576 Ga0495615_0003944 3300048090 Bacteria 2539
577 Ga0496108_0108107 3300048911 Bacteria 2376
578 Ga0496108_0195632 3300048911 Bacteria 1753
579 Ga0496108_0243596 3300048911 Bacteria 1564
580 Ga0496109_0398109 3300048912 Bacteria 1301
581 Ga0496113_0174977 3300048916 Bacteria 1701
582 Ga0496116_0007062 3300048919 Bacteria 10056
583 Ga0496116_0127692 3300048919 Bacteria 1456
584 Ga0496118_0005733 3300048921 Bacteria 13970
585 Ga0496118_0047398 3300048921 Bacteria 3330
586 Ga0496119_0007271 3300048922 Bacteria 10017
587 Ga0496120_0002111 3300048923 Bacteria 21276
588 Ga0496121_0000127 3300048924 Bacteria 168545
589 Ga0496121_0002444 3300048924 Bacteria 28404
590 Ga0496122_0000573 3300048925 Bacteria 75439
591 Ga0496122_0002372 3300048925 Bacteria 26975
592 Ga0496123_0000108 3300048926 Bacteria 166102
593 Ga0496123_0002762 3300048926 Bacteria 21000
594 Ga0496123_0009770 3300048926 Bacteria 8575
595 Ga0496124_0052937 3300048927 Bacteria 3445
596 Ga0496124_0078600 3300048927 Bacteria 2718
597 Ga0496125_0000011 3300048928 Bacteria 655895
598 Ga0496125_0012601 3300048928 Bacteria 8377
599 Ga0496125_0027391 3300048928 Bacteria 5166
600 Ga0496125_0034967 3300048928 Bacteria 4419
601 Ga0496126_0093146 3300048929 Bacteria 2646
602 Ga0501033_0074063 3300049570 Bacteria 2500
603 Ga0501034_0029758 3300049571 Bacteria 5552
604 Ga0501036_0104223 3300049572 Bacteria 2399
605 Ga0501046_0030512 3300049580 Bacteria 4375
606 Ga0501048_0199312 3300049582 Bacteria 1419
607 Ga0501048_0260631 3300049582 Bacteria 1232
608 Ga0501076_0066908 3300049592 Bacteria 2869
609 Ga0501235_021491 3300049669 Bacteria 1435
610 Ga0501257_015645 3300049686 Bacteria 1754
611 Ga0501079_0146853 3300049741 Bacteria 1838
612 Ga0501045_0200445 3300049824 Bacteria 1487
613 nmdc:mga03683_7427_c1 3300050489 Bacteria 3804
614 nmdc:mga00v17_18949_c1 3300050491 Bacteria 3918
615 nmdc:mga0k408_13244_c1 3300050493 Bacteria 4520
616 nmdc:mga0k408_20974_c1 3300050493 Bacteria 3666
617 nmdc:mga0k408_73943_c1 3300050493 Bacteria 1991
618 nmdc:mga07m45_122280_c1 3300050496 Bacteria 1504
619 nmdc:mga07m45_17054_c1 3300050496 Bacteria 3894
620 nmdc:mga07m45_38373_c1 3300050496 Bacteria 2673
621 nmdc:mga07m45_39965_c1 3300050496 Bacteria 2624
622 nmdc:mga07m45_9523_c1 3300050496 Bacteria 5042
623 nmdc:mga05p37_10060_c1 3300050507 Bacteria 11226
624 nmdc:mga05p37_170371_c1 3300050507 Bacteria 2655
625 nmdc:mga09592_101942_c1 3300050508 Bacteria 2459
626 nmdc:mga0qj67_160894_c1 3300050509 Bacteria 1823
627 nmdc:mga0qj67_33522_c1 3300050509 Bacteria 4007
628 nmdc:mga0qj67_54326_c1 3300050509 Bacteria 3172
629 nmdc:mga06r32_130038_c1 3300050510 Bacteria 2489
630 nmdc:mga06r32_231916_c1 3300050510 Bacteria 1834
631 nmdc:mga08y16_18948_c1 3300050511 Bacteria 7247
632 nmdc:mga08y16_235643_c1 3300050511 Bacteria 1893
633 nmdc:mga0n895_369939_c1 3300050512 Bacteria 1451
634 nmdc:mga0n895_96729_c1 3300050512 Bacteria 1494
635 nmdc:mga0a205_71671_c1 3300050515 Bacteria 3347
636 nmdc:mga0sz30_22786_c1 3300050516 Bacteria 2544
637 Ga0495601_0008116 3300053077 Bacteria 6191
638 Ga0495612_0063127 3300053078 Bacteria 1536
639 Ga0495595_0065371 3300053084 Bacteria 1711
640 Ga0500644_0003026 3300053088 Bacteria 4170
641 Ga0500644_0006672 3300053088 Bacteria 2969
642 Ga0500644_0016547 3300053088 Bacteria 2124
643 Ga0500583_0027257 3300053092 Bacteria 2465
644 Ga0500651_0130431 3300053093 Bacteria 1521
645 Ga0500650_0027497 3300053098 Bacteria 2560
646 Ga0500562_017882 3300053108 Bacteria 1830
647 Ga0500593_000168 3300053117 Bacteria 26386
648 Ga0500594_0019549 3300053118 Bacteria 1680
649 Ga0500652_029551 3300053131 Bacteria 2138
650 Ga0500559_0000017 3300053136 Bacteria 143646
651 Ga0500559_0009195 3300053136 Bacteria 4289
652 Ga0500568_0023455 3300053139 Bacteria 2624
653 Ga0500568_0028241 3300053139 Bacteria 2340
654 Ga0500604_0012271 3300053151 Bacteria 2312
655 Ga0500622_0002180 3300053156 Bacteria 14473
656 Ga0500622_0014643 3300053156 Bacteria 4206
657 Ga0500622_0080851 3300053156 Bacteria 1627
658 Ga0500645_000333 3300053730 Bacteria 33591
659 Ga0500645_003191 3300053730 Bacteria 6811
660 Ga0500645_004530 3300053730 Bacteria 5302
661 Ga0500661_000690 3300055283 Bacteria 6340
662 2511245435 2511231002 Bacteria 5042903
663 2514043261 2513237165 Bacteria 6771773
664 2587730741 2585428057 Bacteria 6737412
665 2599906249 2599185292 Bacteria 6290804
666 2643862032 2643221569 Bacteria 6064337
667 2643980924 2643221594 Bacteria 5811388
668 2644122378 2643221621 Bacteria 6212786
669 2644305167 2643221654 Bacteria 5273570
670 2739245110 2738543012 Bacteria 7115078
671 2739251337 2738543013 Bacteria 5618633
672 2809031750 2808606395 Bacteria 6020352
673 2816474520 2816332133 Bacteria 7249298
674 2839095770 2839094727 Bacteria 5534556
675 2842325542 2842324504 Bacteria 9364110
676 2842349821 2842348783 Bacteria 9002918
677 2842454942 2842454564 Bacteria 8730687
678 2842721726 2842718218 Bacteria 4560148
679 2842747813 2842747753 Bacteria 5578255
680 2857540709 2857537821 Bacteria 5248181
681 2857543297 2857542790 Bacteria 5326616
682 2857576937 2857576091 Bacteria 5465855
683 2858956584 2858950400 Bacteria 6783797
684 2901308732 2901300506 Bacteria 8463898
685 2904479389 2904479285 Bacteria 5073931
686 2904602527 2904601388 Bacteria 5884906
687 2928116428 2928115317 Bacteria 6477646
688 2932426022 2932422444 Bacteria 4678430
689 2941482233
690 2998346473 2998344455 Bacteria 4222996
691 644750160 644736347 Bacteria 6476522
692 8002394680 8002392321 Bacteria 4159911
693 Ga0439448_0048187
694 JGI25155J39150_1000121
695 JGI25156J39149_1000100
696 JGI25154J39366_1000121
697 JGI25157J39369_1000130
698 JGI25150J39212_1001519
699 JGI25150J39212_1008535
700 JGI25159J45721_1000190
701 JGI25159J45721_1002986
702 JGI25151J46595_10018837
703 JGI25151J46595_10019083
704 JGI25153J46596_10002339
705 rootH1_10071182
706 rootL2_10086437
707 rootL2_10156818
708 JGI25160J50197_1000345
709 JGI25161J50226_1000007
710 Ga0055538_1000002
711 Ga0055539_1000002
712 Ga0055533_1000004
713 Ga0055525_1000002
714 Ga0055526_1000020
715 Ga0055526_1008255
716 Ga0055526_1012497
717 Ga0055526_1020106
718 Ga0055537_1000183
719 Ga0055537_1000254
720 Ga0055537_1006677
721 Ga0055524_1000101
722 Ga0055524_1000471
723 Ga0055536_1017457
724 Ga0055534_1001095
725 Ga0055534_1001577
726 Ga0055528_1001026
727 Ga0055530_10001334
728 Ga0055540_1000099
729 Ga0055531_10013122
730 Ga0055541_1000002
731 Ga0055543_1001205
732 Ga0065715_10049973
733 Ga0065707_10021263
734 Ga0065707_10025584
735 Ga0065707_10093320
736 Ga0070658_10221720
737 Ga0070676_10005475
738 Ga0070676_10054864
739 Ga0070676_10059423
740 Ga0070683_100043020
741 Ga0070690_100002075
742 Ga0070690_100043091
743 Ga0070670_100008340
744 Ga0070670_100146042
745 Ga0070670_100174832
746 Ga0070670_100286220
747 Ga0070666_10004654
748 Ga0068868_100003547
749 Ga0068868_100118838
750 Ga0068868_100176798
751 Ga0068868_100338209
752 Ga0070660_100057090
753 Ga0070689_100046642
754 Ga0070691_10102727
755 Ga0070661_100044865
756 Ga0070692_10200717
757 Ga0070668_100008228
758 Ga0070668_100069906
759 Ga0070669_100012786
760 Ga0070669_100036817
761 Ga0070669_100150414
762 Ga0070675_100019717
763 Ga0070675_100101870
764 Ga0070675_100111346
765 Ga0070675_100122376
766 Ga0070675_100191275
767 Ga0070675_100201967
768 Ga0070671_100005362
769 Ga0070671_100012210
770 Ga0070671_100033723
771 Ga0070671_100042851
772 Ga0070671_100073624
773 Ga0070671_100076416
774 Ga0070674_100004474
775 Ga0070674_100074001
776 Ga0070674_100109658
777 Ga0070674_100130689
778 Ga0070673_100000694
779 Ga0070673_100069049
780 Ga0070673_100078150
781 Ga0070673_100112208
782 Ga0070673_100260087
783 Ga0070688_100009318
784 Ga0070688_100038186
785 Ga0070659_100028990
786 Ga0070667_100010648
787 Ga0070667_100016789
788 Ga0070667_100051232
789 Ga0070667_100262524
790 Ga0070701_10030791
791 Ga0070701_10068255
792 Ga0070701_10093623
793 Ga0070705_100040144
794 Ga0070694_100004656
795 Ga0070694_100005264
796 Ga0070708_100000315
797 Ga0070708_100465395
798 Ga0070663_100071966
799 Ga0070678_100022799
800 Ga0070678_100128903
801 Ga0070678_100169129
802 Ga0070678_100242948
803 Ga0070662_100061938
804 Ga0070681_10199563
805 Ga0068867_100023179
806 Ga0068867_100047316
807 Ga0068867_100337972
808 Ga0070685_10211923
809 Ga0070706_100002711
810 Ga0070707_100175814
811 Ga0070707_100256972
812 Ga0070698_100131622
813 Ga0070698_100154513
814 Ga0070684_100203051
815 Ga0070684_100503726
816 Ga0068853_100061096
817 Ga0070672_100035426
818 Ga0070672_100100188
819 Ga0070672_100277629
820 Ga0070672_100280430
821 Ga0070686_100177796
822 Ga0070695_100041780
823 Ga0070696_100027522
824 Ga0070693_100001479
825 Ga0070693_100016391
826 Ga0070665_100053512
827 Ga0070665_100119200
828 Ga0070665_100216738
829 Ga0070704_100018982
830 Ga0070704_100028056
831 Ga0070704_100034749
832 Ga0070704_100124000
833 Ga0068855_100000046
834 Ga0068855_100034097
835 Ga0070664_100031391
836 Ga0070664_100047904
837 Ga0070664_100121069
838 Ga0068857_100052496
839 Ga0068857_100066359
840 Ga0068857_100078704
841 Ga0068854_100038067
842 Ga0068854_100091832
843 Ga0068856_100027043
844 Ga0068856_100107861
845 Ga0070702_100131219
846 Ga0068852_100070416
847 Ga0068852_100282928
848 Ga0068852_100406297
849 Ga0068859_100023632
850 Ga0068859_100044579
851 Ga0068864_100000351
852 Ga0068864_100027130
853 Ga0068864_100116200
854 Ga0068866_10063236
855 Ga0068866_10183807
856 Ga0068861_100002726
857 Ga0068851_10020708
858 Ga0068851_10030875
859 Ga0068851_10064987
860 Ga0068851_10101875
861 Ga0068851_10119175
862 Ga0068863_100002991
863 Ga0068863_100093690
864 Ga0068858_100000729
865 Ga0068858_100003527
866 Ga0068858_100007317
867 Ga0068858_100030103
868 Ga0068858_100159500
869 Ga0068858_100201199
870 Ga0068860_100002318
871 Ga0068860_100020683
872 Ga0068860_100020950
873 Ga0068860_100060223
874 Ga0068860_100103009
875 Ga0068860_100145922
876 Ga0081455_10055091
877 Ga0081455_10099808
878 Ga0081539_10071773
879 Ga0075365_10063964
880 Ga0075363_100152511
881 Ga0075364_10039346
882 Ga0075364_10095096
883 Ga0075432_10005083
884 Ga0075362_10043772
885 Ga0075367_10133118
886 Ga0075366_10022146
887 Ga0075366_10058455
888 Ga0075366_10059689
889 Ga0075366_10117996
890 Ga0097621_100005396
891 Ga0097621_100009828
892 Ga0097621_100065188
893 Ga0097621_100065508
894 Ga0097621_100155137
895 Ga0097621_100158974
896 Ga0075370_10001530
897 Ga0075370_10001898
898 Ga0075370_10003975
899 Ga0068871_100012921
900 Ga0068871_100056592
901 Ga0068871_100072962
902 Ga0068871_100346266
903 Ga0075428_100061865
904 Ga0075428_100145137
905 Ga0075428_100348057
906 Ga0075430_100071766
907 Ga0075430_100250233
908 Ga0075431_100189735
909 Ga0075433_10192723
910 Ga0075429_100189647
911 Ga0068865_100025960
912 Ga0075436_100112267
913 Ga0097620_100023632
914 Ga0097620_100044579
915 Ga0099826_10181283
916 Ga0105240_10112430
917 Ga0105240_10331093
918 Ga0111539_10002368
919 Ga0111539_10122371
920 Ga0111539_10144487
921 Ga0105245_10059808
922 Ga0105245_10150428
923 Ga0105243_10098763
924 Ga0105243_10130233
925 Ga0105241_10138049
926 Ga0105241_10290324
927 Ga0105242_10013179
928 Ga0105242_10022167
929 Ga0105242_10067299
930 Ga0105242_10205197
931 Ga0105248_10061085
932 Ga0105248_10091165
933 Ga0105248_10123781
934 Ga0105248_10207135
935 Ga0105237_10020547
936 Ga0105238_10000917
937 Ga0105238_10025045
938 Ga0105238_10244185
939 Ga0105249_10016622
940 Ga0105249_10038399
941 Ga0105249_10260785
942 Ga0105239_10054317
943 Ga0157373_10037647
944 Ga0157371_10160387
945 Ga0157369_10100400
946 Ga0157374_10016933
947 Ga0157378_10090108
948 Ga0163162_10002191
949 Ga0163162_10026458
950 Ga0163162_10033724
951 Ga0163162_10048294
952 Ga0163162_10049807
953 Ga0157372_10047788
954 Ga0157375_10012843
955 Ga0157375_10059291
956 Ga0157375_10367720
957 Ga0163163_10005668
958 Ga0163163_10029776
959 Ga0157380_10154758
960 Ga0157380_10157950
961 Ga0157377_10137467
962 Ga0157379_10004055
963 Ga0157379_10112884
964 Ga0157379_10148229
965 Ga0157376_10047037
966 Ga0157376_10049589
967 Ga0182006_1010159
968 Ga0183362_10002
969 Ga0163161_10021414
970 Ga0163161_10079810
971 Ga0213872_10000309
972 Ga0213872_10020490
973 Ga0209435_100008
974 Ga0209436_107453
975 Ga0209784_100002
976 Ga0209566_100003
977 Ga0209674_100004
978 Ga0209563_100006
979 Ga0207425_1000606
980 Ga0207425_1014645
981 Ga0209646_1000079
982 Ga0209026_1000067
983 Ga0209677_100003
984 Ga0209759_1000056
985 Ga0209129_1007932
986 Ga0209565_1000041
987 Ga0209565_1000849
988 Ga0209673_1000012
989 Ga0209130_1000014
990 Ga0209130_1000184
991 Ga0207673_1007572
992 Ga0209675_1000475
993 Ga0209675_1000771
994 Ga0209675_1007151
995 Ga0209676_1000013
996 Ga0209676_1003804
997 Ga0209676_1004437
998 Ga0209676_1004828
999 Ga0209564_1001251
1000 Ga0209564_1001414
1001 Ga0209564_1006578
1002 Ga0209758_1001500
1003 Ga0209758_1006824
1004 Ga0209050_1000008
1005 Ga0209050_1003807
1006 Ga0209050_1004622
1007 Ga0209050_1013208
1008 Ga0209256_1000003
1009 Ga0209256_1037408
1010 Ga0207426_1000091
1011 Ga0209051_1000005
1012 Ga0209051_1003394
1013 Ga0209257_1000048
1014 Ga0207697_10003156
1015 Ga0207656_10018982
1016 Ga0207656_10019459
1017 Ga0207656_10057726
1018 Ga0207656_10087617
1019 Ga0207682_10012204
1020 Ga0207680_10002176
1021 Ga0207645_10013887
1022 Ga0207645_10040010
1023 Ga0207645_10087083
1024 Ga0207643_10059044
1025 Ga0207643_10081964
1026 Ga0207705_10221420
1027 Ga0207654_10162794
1028 Ga0207707_10165411
1029 Ga0207695_10001065
1030 Ga0207695_10012472
1031 Ga0207695_10081043
1032 Ga0207695_10127174
1033 Ga0207671_10011643
1034 Ga0207660_10171494
1035 Ga0207662_10091275
1036 Ga0207657_10087855
1037 Ga0207649_10001848
1038 Ga0207652_10020652
1039 Ga0207646_10102106
1040 Ga0207681_10060356
1041 Ga0207681_10132286
1042 Ga0207694_10000446
1043 Ga0207694_10021587
1044 Ga0207694_10084479
1045 Ga0207650_10000970
1046 Ga0207650_10007280
1047 Ga0207650_10021249
1048 Ga0207659_10000781
1049 Ga0207659_10005370
1050 Ga0207659_10017024
1051 Ga0207659_10022515
1052 Ga0207659_10063619
1053 Ga0207659_10184227
1054 Ga0207687_10067989
1055 Ga0207687_10145697
1056 Ga0207644_10000899
1057 Ga0207644_10003807
1058 Ga0207644_10013865
1059 Ga0207644_10041525
1060 Ga0207644_10162676
1061 Ga0207644_10332590
1062 Ga0207690_10011751
1063 Ga0207706_10095355
1064 Ga0207686_10001268
1065 Ga0207686_10003551
1066 Ga0207686_10006148
1067 Ga0207686_10006189
1068 Ga0207686_10096621
1069 Ga0207686_10120740
1070 Ga0207709_10029914
1071 Ga0207669_10010778
1072 Ga0207669_10019707
1073 Ga0207669_10121296
1074 Ga0207704_10032343
1075 Ga0207704_10138846
1076 Ga0207691_10000699
1077 Ga0207691_10002051
1078 Ga0207691_10013535
1079 Ga0207691_10043113
1080 Ga0207691_10062341
1081 Ga0207691_10077728
1082 Ga0207691_10091581
1083 Ga0207691_10130672
1084 Ga0207691_10286073
1085 Ga0207711_10088590
1086 Ga0207711_10131505
1087 Ga0207689_10008871
1088 Ga0207689_10012877
1089 Ga0207689_10043811
1090 Ga0207689_10062550
1091 Ga0207689_10066991
1092 Ga0207689_10093104
1093 Ga0207679_10015442
1094 Ga0207679_10185577
1095 Ga0207679_10241447
1096 Ga0207667_10000036
1097 Ga0207667_10053810
1098 Ga0207651_10005355
1099 Ga0207651_10074131
1100 Ga0207651_10180655
1101 Ga0207712_10073144
1102 Ga0207712_10240967
1103 Ga0207668_10006822
1104 Ga0207668_10161281
1105 Ga0207640_10021988
1106 Ga0207640_10103223
1107 Ga0207640_10234851
1108 Ga0207658_10022502
1109 Ga0207677_10008047
1110 Ga0207677_10014636
1111 Ga0207677_10125202
1112 Ga0207703_10002007
1113 Ga0207703_10017382
1114 Ga0207703_10030390
1115 Ga0207703_10077061
1116 Ga0207639_10091133
1117 Ga0207678_10024103
1118 Ga0207678_10074208
1119 Ga0207702_10014485
1120 Ga0207702_10042536
1121 Ga0207702_10143889
1122 Ga0207641_10028000
1123 Ga0207648_10000556
1124 Ga0207648_10027677
1125 Ga0207648_10071974
1126 Ga0207648_10143811
1127 Ga0207648_10283153
1128 Ga0207676_10002172
1129 Ga0207676_10047336
1130 Ga0207676_10051685
1131 Ga0207674_10022936
1132 Ga0207675_100002028
1133 Ga0207683_10019395
1134 Ga0207683_10086108
1135 Ga0207683_10251362
1136 Ga0207698_10176448
1137 Ga0209969_1011759
1138 Ga0209981_1008816
1139 Ga0209966_1018790
1140 Ga0207428_10015146
1141 Ga0207428_10038230
1142 Ga0268265_10133883
1143 Ga0268265_10134579
1144 Ga0268265_10219514
1145 Ga0268265_10357048
1146 Ga0268264_10017825
1147 Ga0268264_10018647
1148 Ga0268264_10146873
1149 Ga0307517_10009075
1150 Ga0307517_10047929
1151 Ga0307515_10000049
1152 Ga0307515_10000485
1153 Ga0307515_10028979
1154 Ga0307515_10040590
1155 Ga0307515_10116866
1156 Ga0265332_10003549
1157 Ga0265328_10072432
1158 Ga0307513_10002838
1159 Ga0307513_10004164
1160 Ga0307513_10105397
1161 Ga0307513_10151350
1162 Ga0307509_10000092
1163 Ga0307509_10002037
1164 Ga0307509_10042928
1165 Ga0307408_100002928
1166 Ga0307408_100012702
1167 Ga0307408_100033563
1168 Ga0307408_100054287
1169 Ga0307408_100134940
1170 Ga0307508_10001131
1171 Ga0307508_10003490
1172 Ga0307514_10000200
1173 Ga0307514_10000225
1174 Ga0265314_10001584
1175 Ga0307516_10000921
1176 Ga0307405_10020379
1177 Ga0307413_10034040
1178 Ga0307413_10035752
1179 Ga0307413_10136874
1180 Ga0307410_10019217
1181 Ga0307410_10022308
1182 Ga0307406_10003971
1183 Ga0307406_10010157
1184 Ga0307407_10064951
1185 Ga0307407_10141455
1186 Ga0307412_10000555
1187 Ga0307412_10066780
1188 Ga0307412_10084366
1189 Ga0307409_100000467
1190 Ga0307409_100465647
1191 Ga0307416_100106798
1192 Ga0307416_100120510
1193 Ga0307416_100144348
1194 Ga0307414_10071742
1195 Ga0307411_10005170
1196 Ga0307411_10021368
1197 Ga0307411_10051162
1198 Ga0307411_10116765
1199 Ga0307415_100009800
1200 Ga0307415_100235268
1201 Ga0307510_10001210
1202 Ga0373943_0148996
1203 Ga0373955_0194819
1204 Ga0373931_0040703
1205 Ga0373927_0032741
1206 Ga0373933_0243830
1207 Ga0373947_0027386
1208 Ga0373937_0494548
1209 Ga0373925_0010856
1210 Ga0373925_0027694
1211 Ga0373925_0224749
1212 Ga0395900_0089243
1213 Ga0395900_0131119
1214 Ga0395905_0000047
1215 Ga0395905_0001267
1216 Ga0395905_0003737
1217 Ga0395905_0016587
1218 Ga0395905_0020586
1219 Ga0436365_0761091
1220 Ga0436365_1311379
1221 Ga0436361_0236312
1222 Ga0436361_0545923
1223 Ga0436361_0782766
1224 Ga0439431_0002520
1225 Ga0450911_000410
1226 Ga0439435_0000488
1227 Ga0439460_0012015
1228 Ga0451577_0005487
1229 Ga0451577_0101670
1230 Ga0466969_0035807
1231 Ga0453683_0214985
1232 Ga0453684_0033003
1233 Ga0453684_0038319
1234 Ga0453684_0082011
1235 Ga0466971_0057708
1236 Ga0495592_0000413
1237 Ga0495629_0022966
1238 Ga0495580_0065960
1239 Ga0495580_0068885
1240 Ga0495607_0000386
1241 Ga0495608_0050822
1242 Ga0495632_0005226
1243 Ga0495632_0012832
1244 Ga0495666_0024170
1245 Ga0495652_0130108
1246 Ga0495654_0005706
1247 Ga0495654_0093560
1248 Ga0495621_0002601
1249 Ga0495597_0000116
1250 Ga0495645_0038509
1251 Ga0495633_0003149
1252 Ga0495668_0039347
1253 Ga0495634_0089188
1254 Ga0495599_0146676
1255 Ga0495647_0082743
1256 Ga0495658_0037329
1257 Ga0495658_0141810
1258 Ga0495658_0150575
1259 Ga0495669_0022259
1260 Ga0495613_0107558
1261 Ga0495636_0009989
1262 Ga0495674_0019794
1263 Ga0495687_001245
1264 Ga0495687_007634
1265 Ga0495681_0025029
1266 Ga0495686_0002020
1267 Ga0495593_0103305
1268 Ga0495615_0003944
1269 Ga0496108_0108107
1270 Ga0496108_0195632
1271 Ga0496108_0243596
1272 Ga0496109_0398109
1273 Ga0496113_0174977
1274 Ga0496116_0007062
1275 Ga0496116_0127692
1276 Ga0496118_0005733
1277 Ga0496118_0047398
1278 Ga0496119_0007271
1279 Ga0496120_0002111
1280 Ga0496121_0000127
1281 Ga0496121_0002444
1282 Ga0496122_0000573
1283 Ga0496122_0002372
1284 Ga0496123_0000108
1285 Ga0496123_0002762
1286 Ga0496123_0009770
1287 Ga0496124_0052937
1288 Ga0496124_0078600
1289 Ga0496125_0000011
1290 Ga0496125_0012601
1291 Ga0496125_0027391
1292 Ga0496125_0034967
1293 Ga0496126_0093146
1294 Ga0501033_0074063
1295 Ga0501034_0029758
1296 Ga0501036_0104223
1297 Ga0501046_0030512
1298 Ga0501048_0199312
1299 Ga0501048_0260631
1300 Ga0501076_0066908
1301 Ga0501235_021491
1302 Ga0501257_015645
1303 Ga0501079_0146853
1304 Ga0501045_0200445
1305 nmdc:mga03683_7427_c1
1306 nmdc:mga00v17_18949_c1
1307 nmdc:mga0k408_13244_c1
1308 nmdc:mga0k408_20974_c1
1309 nmdc:mga0k408_73943_c1
1310 nmdc:mga07m45_122280_c1
1311 nmdc:mga07m45_17054_c1
1312 nmdc:mga07m45_38373_c1
1313 nmdc:mga07m45_39965_c1
1314 nmdc:mga07m45_9523_c1
1315 nmdc:mga05p37_10060_c1
1316 nmdc:mga05p37_170371_c1
1317 nmdc:mga09592_101942_c1
1318 nmdc:mga0qj67_160894_c1
1319 nmdc:mga0qj67_33522_c1
1320 nmdc:mga0qj67_54326_c1
1321 nmdc:mga06r32_130038_c1
1322 nmdc:mga06r32_231916_c1
1323 nmdc:mga08y16_18948_c1
1324 nmdc:mga08y16_235643_c1
1325 nmdc:mga0n895_369939_c1
1326 nmdc:mga0n895_96729_c1
1327 nmdc:mga0a205_71671_c1
1328 nmdc:mga0sz30_22786_c1
1329 Ga0495601_0008116
1330 Ga0495612_0063127
1331 Ga0495595_0065371
1332 Ga0500644_0003026
1333 Ga0500644_0006672
1334 Ga0500644_0016547
1335 Ga0500583_0027257
1336 Ga0500651_0130431
1337 Ga0500650_0027497
1338 Ga0500562_017882
1339 Ga0500593_000168
1340 Ga0500594_0019549
1341 Ga0500652_029551
1342 Ga0500559_0000017
1343 Ga0500559_0009195
1344 Ga0500568_0023455
1345 Ga0500568_0028241
1346 Ga0500604_0012271
1347 Ga0500622_0002180
1348 Ga0500622_0014643
1349 Ga0500622_0080851
1350 Ga0500645_000333
1351 Ga0500645_003191
1352 Ga0500645_004530
1353 Ga0500661_000690
1354 2511245435
1355 2514043261
1356 2587730741
1357 2599906249
1358 2643862032
1359 2643980924
1360 2644122378
1361 2644305167
1362 2739245110
1363 2739251337
1364 2809031750
1365 2816474520
1366 2839095770
1367 2842325542
1368 2842349821
1369 2842454942
1370 2842721726
1371 2842747813
1372 2857540709
1373 2857543297
1374 2857576937
1375 2858956584
1376 2901308732
1377 2904479389
1378 2904602527
1379 2928116428
1380 2932426022
1381 2941482233
1382 2998346473
1383 644750160
1384 8002394680

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

56

317

0.84

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

103

348

0.81

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

60

313

0.8

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

69

341

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.9151 34 348
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.9014 34 348
6wce-assembly1.cif.gz_A structure of the periplasmic binding protein p5pa 0.8959 34 346
6wce-assembly1.cif.gz_A structure of the periplasmic binding protein p5pa 0.8905 34 346
7tav-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8413 33 299
ID Description Score Start End Superfamily
1xvyA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8875 37 133 3.40.190.10
4r74A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8864 141 348 3.40.190.10
4r74A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8699 141 348 3.40.190.10
af_Q2G1D9_30_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8509 37 328 3.40.190.10
3c9hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8486 35 131 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1Y5EC47-F1-model_v4 Putative 2-aminoethylphosphonate ABC transporter substrate-binding protein 0.9876 30 353 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A0R2TF58-F1-model_v4 Phosphonate ABC transporter substrate-binding protein 0.9848 55 353 GO:0015888
GO:0030288
GO:0030975
GO:0030976
GO:0046872
AF-A0A645J1K5-F1-model_v4 Uncharacterized protein 0.9826 206 353 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A0R2TF58-F1-model_v4 Phosphonate ABC transporter substrate-binding protein 0.9782 55 353 GO:0015888
GO:0030288
GO:0030975
GO:0030976
GO:0046872
AF-A0A158M7S7-F1-model_v4 Putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein 0.978 33 282 GO:0015888
GO:0030288
GO:0030975
GO:0030976

Map