F475596
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 373 | 1384 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300042005|Ga0439448_0048187|Ga0439448_0048187_111_1232 |
| Length | 373 |
| Sequence | LQRLPPSGHRRVTVRAAGFSALRSVTPKELFMRIPSLLPFLLALVAGTALAQKTPLLVYTALETDQLKAYQEGFNKVHPDIELKWVRDSTGVITAKLLAEKANPQADVVMGVAASSLALLGRNGMLEGYKPLNYDAIMKSYVDKNSPPLWWGMDVWGATICFNTVEAQKKNIPKPETWKDLLKPVYKNQIVMPNPASSGTGFFDVTAWLNLWGDDNGKGGGWKFMDGLHENIAQYTHSGSKPCNMAAAGEYVMGISFEYRANANKAKGAPIDLVFPKEGLGWDLEAFAIHKGTKHLDAAKKLADWASSKDAMLLYGKNFAITAQPGVAAPLPNVPKDYESRLVKMDFAWAADNRERILAEWTKRYNAKSEPKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 138 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 255 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 256 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 257 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 258 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 300 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 331 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 332 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 333 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 334 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 335 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 336 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 337 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 338 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 339 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 341 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 342 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 343 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 344 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 345 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 346 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 347 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 348 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 349 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 350 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 351 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 352 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 353 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 354 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 355 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 356 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 357 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 358 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 359 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 360 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 361 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 362 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 363 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 364 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 365 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 366 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 367 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 368 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 369 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 370 | 2941479691 | |||
| 371 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 372 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 373 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.52 |
| Metatranscriptomes | 0 |
| Isolates | 4.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.33 |
| Nodule | 1.01 |
| Rhizoplane | 0.87 |
| Rhizosphere | 71.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439448_0048187 | 3300042005 | Bacteria | 1391 |
| 2 | JGI25155J39150_1000121 | 3300002704 | Bacteria | 38491 |
| 3 | JGI25156J39149_1000100 | 3300002705 | Bacteria | 63565 |
| 4 | JGI25154J39366_1000121 | 3300002738 | Bacteria | 62887 |
| 5 | JGI25157J39369_1000130 | 3300002741 | Bacteria | 63360 |
| 6 | JGI25150J39212_1001519 | 3300002774 | Bacteria | 6391 |
| 7 | JGI25150J39212_1008535 | 3300002774 | Bacteria | 2000 |
| 8 | JGI25159J45721_1000190 | 3300002987 | Bacteria | 28606 |
| 9 | JGI25159J45721_1002986 | 3300002987 | Bacteria | 6144 |
| 10 | JGI25151J46595_10018837 | 3300003187 | Bacteria | 2951 |
| 11 | JGI25151J46595_10019083 | 3300003187 | Bacteria | 2923 |
| 12 | JGI25153J46596_10002339 | 3300003215 | Bacteria | 10998 |
| 13 | rootH1_10071182 | 3300003316 | Bacteria | 1986 |
| 14 | rootL2_10086437 | 3300003322 | Bacteria | 1653 |
| 15 | rootL2_10156818 | 3300003322 | Bacteria | 1335 |
| 16 | JGI25160J50197_1000345 | 3300003354 | Bacteria | 30950 |
| 17 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 18 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 19 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 20 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 21 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 22 | Ga0055526_1000020 | 3300003771 | Bacteria | 188230 |
| 23 | Ga0055526_1008255 | 3300003771 | Bacteria | 5230 |
| 24 | Ga0055526_1012497 | 3300003771 | Bacteria | 3695 |
| 25 | Ga0055526_1020106 | 3300003771 | Bacteria | 2395 |
| 26 | Ga0055537_1000183 | 3300003773 | Bacteria | 46516 |
| 27 | Ga0055537_1000254 | 3300003773 | Bacteria | 38945 |
| 28 | Ga0055537_1006677 | 3300003773 | Bacteria | 2888 |
| 29 | Ga0055524_1000101 | 3300003775 | Bacteria | 106527 |
| 30 | Ga0055524_1000471 | 3300003775 | Bacteria | 32322 |
| 31 | Ga0055536_1017457 | 3300003781 | Bacteria | 2348 |
| 32 | Ga0055534_1001095 | 3300003784 | Bacteria | 11537 |
| 33 | Ga0055534_1001577 | 3300003784 | Bacteria | 8856 |
| 34 | Ga0055528_1001026 | 3300003790 | Bacteria | 18496 |
| 35 | Ga0055530_10001334 | 3300003791 | Bacteria | 18475 |
| 36 | Ga0055540_1000099 | 3300003792 | Bacteria | 96187 |
| 37 | Ga0055531_10013122 | 3300003794 | Bacteria | 3844 |
| 38 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 39 | Ga0055543_1001205 | 3300004625 | Bacteria | 10864 |
| 40 | Ga0065715_10049973 | 3300005293 | Bacteria | 1219 |
| 41 | Ga0065707_10021263 | 3300005295 | Bacteria | 1443 |
| 42 | Ga0065707_10025584 | 3300005295 | Bacteria | 1763 |
| 43 | Ga0065707_10093320 | 3300005295 | Bacteria | 3643 |
| 44 | Ga0070658_10221720 | 3300005327 | Bacteria | 1599 |
| 45 | Ga0070676_10005475 | 3300005328 | Bacteria | 6762 |
| 46 | Ga0070676_10054864 | 3300005328 | Bacteria | 2350 |
| 47 | Ga0070676_10059423 | 3300005328 | Bacteria | 2267 |
| 48 | Ga0070683_100043020 | 3300005329 | Bacteria | 4161 |
| 49 | Ga0070690_100002075 | 3300005330 | Bacteria | 10702 |
| 50 | Ga0070690_100043091 | 3300005330 | Bacteria | 2860 |
| 51 | Ga0070670_100008340 | 3300005331 | Bacteria | 8832 |
| 52 | Ga0070670_100146042 | 3300005331 | Bacteria | 2046 |
| 53 | Ga0070670_100174832 | 3300005331 | Bacteria | 1863 |
| 54 | Ga0070670_100286220 | 3300005331 | Bacteria | 1439 |
| 55 | Ga0070666_10004654 | 3300005335 | Bacteria | 8378 |
| 56 | Ga0068868_100003547 | 3300005338 | Bacteria | 10876 |
| 57 | Ga0068868_100118838 | 3300005338 | Bacteria | 2155 |
| 58 | Ga0068868_100176798 | 3300005338 | Bacteria | 1769 |
| 59 | Ga0068868_100338209 | 3300005338 | Bacteria | 1286 |
| 60 | Ga0070660_100057090 | 3300005339 | Bacteria | 3023 |
| 61 | Ga0070689_100046642 | 3300005340 | Bacteria | 3339 |
| 62 | Ga0070691_10102727 | 3300005341 | Bacteria | 1421 |
| 63 | Ga0070661_100044865 | 3300005344 | Bacteria | 3230 |
| 64 | Ga0070692_10200717 | 3300005345 | Bacteria | 1168 |
| 65 | Ga0070668_100008228 | 3300005347 | Bacteria | 7744 |
| 66 | Ga0070668_100069906 | 3300005347 | Bacteria | 2732 |
| 67 | Ga0070669_100012786 | 3300005353 | Bacteria | 5959 |
| 68 | Ga0070669_100036817 | 3300005353 | Bacteria | 3547 |
| 69 | Ga0070669_100150414 | 3300005353 | Bacteria | 1802 |
| 70 | Ga0070675_100019717 | 3300005354 | Bacteria | 5377 |
| 71 | Ga0070675_100101870 | 3300005354 | Bacteria | 2419 |
| 72 | Ga0070675_100111346 | 3300005354 | Bacteria | 2316 |
| 73 | Ga0070675_100122376 | 3300005354 | Bacteria | 2211 |
| 74 | Ga0070675_100191275 | 3300005354 | Bacteria | 1773 |
| 75 | Ga0070675_100201967 | 3300005354 | Bacteria | 1725 |
| 76 | Ga0070671_100005362 | 3300005355 | Bacteria | 10225 |
| 77 | Ga0070671_100012210 | 3300005355 | Bacteria | 6909 |
| 78 | Ga0070671_100033723 | 3300005355 | Bacteria | 4236 |
| 79 | Ga0070671_100042851 | 3300005355 | Bacteria | 3763 |
| 80 | Ga0070671_100073624 | 3300005355 | Bacteria | 2853 |
| 81 | Ga0070671_100076416 | 3300005355 | Bacteria | 2798 |
| 82 | Ga0070674_100004474 | 3300005356 | Bacteria | 7976 |
| 83 | Ga0070674_100074001 | 3300005356 | Bacteria | 2416 |
| 84 | Ga0070674_100109658 | 3300005356 | Bacteria | 2024 |
| 85 | Ga0070674_100130689 | 3300005356 | Bacteria | 1871 |
| 86 | Ga0070673_100000694 | 3300005364 | Bacteria | 18557 |
| 87 | Ga0070673_100069049 | 3300005364 | Bacteria | 2831 |
| 88 | Ga0070673_100078150 | 3300005364 | Bacteria | 2676 |
| 89 | Ga0070673_100112208 | 3300005364 | Bacteria | 2263 |
| 90 | Ga0070673_100260087 | 3300005364 | Bacteria | 1516 |
| 91 | Ga0070688_100009318 | 3300005365 | Bacteria | 5365 |
| 92 | Ga0070688_100038186 | 3300005365 | Bacteria | 2931 |
| 93 | Ga0070659_100028990 | 3300005366 | Bacteria | 4277 |
| 94 | Ga0070667_100010648 | 3300005367 | Bacteria | 7595 |
| 95 | Ga0070667_100016789 | 3300005367 | Bacteria | 6057 |
| 96 | Ga0070667_100051232 | 3300005367 | Bacteria | 3480 |
| 97 | Ga0070667_100262524 | 3300005367 | Bacteria | 1547 |
| 98 | Ga0070701_10030791 | 3300005438 | Bacteria | 2657 |
| 99 | Ga0070701_10068255 | 3300005438 | Bacteria | 1894 |
| 100 | Ga0070701_10093623 | 3300005438 | Bacteria | 1651 |
| 101 | Ga0070705_100040144 | 3300005440 | Bacteria | 2660 |
| 102 | Ga0070694_100004656 | 3300005444 | Bacteria | 8251 |
| 103 | Ga0070694_100005264 | 3300005444 | Bacteria | 7820 |
| 104 | Ga0070708_100000315 | 3300005445 | Bacteria | 36417 |
| 105 | Ga0070708_100465395 | 3300005445 | Bacteria | 1193 |
| 106 | Ga0070663_100071966 | 3300005455 | Bacteria | 2517 |
| 107 | Ga0070678_100022799 | 3300005456 | Bacteria | 4158 |
| 108 | Ga0070678_100128903 | 3300005456 | Bacteria | 2007 |
| 109 | Ga0070678_100169129 | 3300005456 | Bacteria | 1778 |
| 110 | Ga0070678_100242948 | 3300005456 | Bacteria | 1506 |
| 111 | Ga0070662_100061938 | 3300005457 | Bacteria | 2732 |
| 112 | Ga0070681_10199563 | 3300005458 | Bacteria | 1919 |
| 113 | Ga0068867_100023179 | 3300005459 | Bacteria | 4443 |
| 114 | Ga0068867_100047316 | 3300005459 | Bacteria | 3162 |
| 115 | Ga0068867_100337972 | 3300005459 | Bacteria | 1253 |
| 116 | Ga0070685_10211923 | 3300005466 | Bacteria | 1265 |
| 117 | Ga0070706_100002711 | 3300005467 | Bacteria | 17718 |
| 118 | Ga0070707_100175814 | 3300005468 | Bacteria | 2087 |
| 119 | Ga0070707_100256972 | 3300005468 | Bacteria | 1700 |
| 120 | Ga0070698_100131622 | 3300005471 | Bacteria | 2457 |
| 121 | Ga0070698_100154513 | 3300005471 | Bacteria | 2240 |
| 122 | Ga0070684_100203051 | 3300005535 | Bacteria | 1806 |
| 123 | Ga0070684_100503726 | 3300005535 | Bacteria | 1121 |
| 124 | Ga0068853_100061096 | 3300005539 | Bacteria | 3259 |
| 125 | Ga0070672_100035426 | 3300005543 | Bacteria | 3794 |
| 126 | Ga0070672_100100188 | 3300005543 | Bacteria | 2349 |
| 127 | Ga0070672_100277629 | 3300005543 | Bacteria | 1416 |
| 128 | Ga0070672_100280430 | 3300005543 | Bacteria | 1409 |
| 129 | Ga0070686_100177796 | 3300005544 | Bacteria | 1510 |
| 130 | Ga0070695_100041780 | 3300005545 | Bacteria | 2908 |
| 131 | Ga0070696_100027522 | 3300005546 | Bacteria | 3874 |
| 132 | Ga0070693_100001479 | 3300005547 | Bacteria | 10573 |
| 133 | Ga0070693_100016391 | 3300005547 | Bacteria | 3835 |
| 134 | Ga0070665_100053512 | 3300005548 | Bacteria | 4048 |
| 135 | Ga0070665_100119200 | 3300005548 | Bacteria | 2641 |
| 136 | Ga0070665_100216738 | 3300005548 | Bacteria | 1915 |
| 137 | Ga0070704_100018982 | 3300005549 | Bacteria | 4411 |
| 138 | Ga0070704_100028056 | 3300005549 | Bacteria | 3740 |
| 139 | Ga0070704_100034749 | 3300005549 | Bacteria | 3421 |
| 140 | Ga0070704_100124000 | 3300005549 | Bacteria | 1990 |
| 141 | Ga0068855_100000046 | 3300005563 | Bacteria | 147225 |
| 142 | Ga0068855_100034097 | 3300005563 | Bacteria | 6073 |
| 143 | Ga0070664_100031391 | 3300005564 | Bacteria | 4438 |
| 144 | Ga0070664_100047904 | 3300005564 | Bacteria | 3612 |
| 145 | Ga0070664_100121069 | 3300005564 | Bacteria | 2291 |
| 146 | Ga0068857_100052496 | 3300005577 | Bacteria | 3617 |
| 147 | Ga0068857_100066359 | 3300005577 | Bacteria | 3211 |
| 148 | Ga0068857_100078704 | 3300005577 | Bacteria | 2942 |
| 149 | Ga0068854_100038067 | 3300005578 | Bacteria | 3380 |
| 150 | Ga0068854_100091832 | 3300005578 | Bacteria | 2260 |
| 151 | Ga0068856_100027043 | 3300005614 | Bacteria | 5596 |
| 152 | Ga0068856_100107861 | 3300005614 | Bacteria | 2781 |
| 153 | Ga0070702_100131219 | 3300005615 | Bacteria | 1583 |
| 154 | Ga0068852_100070416 | 3300005616 | Bacteria | 3068 |
| 155 | Ga0068852_100282928 | 3300005616 | Bacteria | 1599 |
| 156 | Ga0068852_100406297 | 3300005616 | Bacteria | 1340 |
| 157 | Ga0068859_100023632 | 3300005617 | Bacteria | 6169 |
| 158 | Ga0068859_100044579 | 3300005617 | Bacteria | 4457 |
| 159 | Ga0068864_100000351 | 3300005618 | Bacteria | 40447 |
| 160 | Ga0068864_100027130 | 3300005618 | Bacteria | 4833 |
| 161 | Ga0068864_100116200 | 3300005618 | Bacteria | 2387 |
| 162 | Ga0068866_10063236 | 3300005718 | Bacteria | 1929 |
| 163 | Ga0068866_10183807 | 3300005718 | Bacteria | 1237 |
| 164 | Ga0068861_100002726 | 3300005719 | Bacteria | 11573 |
| 165 | Ga0068851_10020708 | 3300005834 | Bacteria | 3187 |
| 166 | Ga0068851_10030875 | 3300005834 | Bacteria | 2659 |
| 167 | Ga0068851_10064987 | 3300005834 | Bacteria | 1876 |
| 168 | Ga0068851_10101875 | 3300005834 | Bacteria | 1525 |
| 169 | Ga0068851_10119175 | 3300005834 | Bacteria | 1417 |
| 170 | Ga0068863_100002991 | 3300005841 | Bacteria | 16705 |
| 171 | Ga0068863_100093690 | 3300005841 | Bacteria | 2850 |
| 172 | Ga0068858_100000729 | 3300005842 | Bacteria | 34410 |
| 173 | Ga0068858_100003527 | 3300005842 | Bacteria | 15491 |
| 174 | Ga0068858_100007317 | 3300005842 | Bacteria | 10689 |
| 175 | Ga0068858_100030103 | 3300005842 | Bacteria | 5041 |
| 176 | Ga0068858_100159500 | 3300005842 | Bacteria | 2124 |
| 177 | Ga0068858_100201199 | 3300005842 | Bacteria | 1884 |
| 178 | Ga0068860_100002318 | 3300005843 | Bacteria | 20001 |
| 179 | Ga0068860_100020683 | 3300005843 | Bacteria | 6375 |
| 180 | Ga0068860_100020950 | 3300005843 | Bacteria | 6335 |
| 181 | Ga0068860_100060223 | 3300005843 | Bacteria | 3608 |
| 182 | Ga0068860_100103009 | 3300005843 | Bacteria | 2724 |
| 183 | Ga0068860_100145922 | 3300005843 | Bacteria | 2277 |
| 184 | Ga0081455_10055091 | 3300005937 | Bacteria | 3384 |
| 185 | Ga0081455_10099808 | 3300005937 | Bacteria | 2334 |
| 186 | Ga0081539_10071773 | 3300005985 | Bacteria | 1853 |
| 187 | Ga0075365_10063964 | 3300006038 | Bacteria | 2463 |
| 188 | Ga0075363_100152511 | 3300006048 | Bacteria | 1305 |
| 189 | Ga0075364_10039346 | 3300006051 | Bacteria | 3065 |
| 190 | Ga0075364_10095096 | 3300006051 | Bacteria | 1980 |
| 191 | Ga0075432_10005083 | 3300006058 | Bacteria | 4481 |
| 192 | Ga0075362_10043772 | 3300006177 | Bacteria | 1983 |
| 193 | Ga0075367_10133118 | 3300006178 | Bacteria | 1538 |
| 194 | Ga0075366_10022146 | 3300006195 | Bacteria | 3695 |
| 195 | Ga0075366_10058455 | 3300006195 | Bacteria | 2290 |
| 196 | Ga0075366_10059689 | 3300006195 | Bacteria | 2265 |
| 197 | Ga0075366_10117996 | 3300006195 | Bacteria | 1598 |
| 198 | Ga0097621_100005396 | 3300006237 | Bacteria | 9010 |
| 199 | Ga0097621_100009828 | 3300006237 | Bacteria | 6964 |
| 200 | Ga0097621_100065188 | 3300006237 | Bacteria | 2997 |
| 201 | Ga0097621_100065508 | 3300006237 | Bacteria | 2990 |
| 202 | Ga0097621_100155137 | 3300006237 | Bacteria | 1965 |
| 203 | Ga0097621_100158974 | 3300006237 | Bacteria | 1941 |
| 204 | Ga0075370_10001530 | 3300006353 | Bacteria | 10118 |
| 205 | Ga0075370_10001898 | 3300006353 | Bacteria | 9394 |
| 206 | Ga0075370_10003975 | 3300006353 | Bacteria | 7105 |
| 207 | Ga0068871_100012921 | 3300006358 | Bacteria | 6183 |
| 208 | Ga0068871_100056592 | 3300006358 | Bacteria | 3188 |
| 209 | Ga0068871_100072962 | 3300006358 | Bacteria | 2828 |
| 210 | Ga0068871_100346266 | 3300006358 | Bacteria | 1313 |
| 211 | Ga0075428_100061865 | 3300006844 | Bacteria | 4099 |
| 212 | Ga0075428_100145137 | 3300006844 | Bacteria | 2579 |
| 213 | Ga0075428_100348057 | 3300006844 | Bacteria | 1591 |
| 214 | Ga0075430_100071766 | 3300006846 | Bacteria | 2904 |
| 215 | Ga0075430_100250233 | 3300006846 | Bacteria | 1468 |
| 216 | Ga0075431_100189735 | 3300006847 | Bacteria | 2106 |
| 217 | Ga0075433_10192723 | 3300006852 | Bacteria | 1813 |
| 218 | Ga0075429_100189647 | 3300006880 | Bacteria | 1801 |
| 219 | Ga0068865_100025960 | 3300006881 | Bacteria | 3859 |
| 220 | Ga0075436_100112267 | 3300006914 | Bacteria | 1903 |
| 221 | Ga0097620_100023632 | 3300006931 | Bacteria | 6169 |
| 222 | Ga0097620_100044579 | 3300006931 | Bacteria | 4457 |
| 223 | Ga0099826_10181283 | 3300006948 | Bacteria | 1171 |
| 224 | Ga0105240_10112430 | 3300009093 | Bacteria | 3292 |
| 225 | Ga0105240_10331093 | 3300009093 | Bacteria | 1733 |
| 226 | Ga0111539_10002368 | 3300009094 | Bacteria | 25057 |
| 227 | Ga0111539_10122371 | 3300009094 | Bacteria | 3049 |
| 228 | Ga0111539_10144487 | 3300009094 | Bacteria | 2785 |
| 229 | Ga0105245_10059808 | 3300009098 | Bacteria | 3431 |
| 230 | Ga0105245_10150428 | 3300009098 | Bacteria | 2200 |
| 231 | Ga0105243_10098763 | 3300009148 | Bacteria | 2419 |
| 232 | Ga0105243_10130233 | 3300009148 | Bacteria | 2133 |
| 233 | Ga0105241_10138049 | 3300009174 | Bacteria | 1982 |
| 234 | Ga0105241_10290324 | 3300009174 | Bacteria | 1400 |
| 235 | Ga0105242_10013179 | 3300009176 | Bacteria | 6381 |
| 236 | Ga0105242_10022167 | 3300009176 | Bacteria | 4991 |
| 237 | Ga0105242_10067299 | 3300009176 | Bacteria | 2961 |
| 238 | Ga0105242_10205197 | 3300009176 | Bacteria | 1753 |
| 239 | Ga0105248_10061085 | 3300009177 | Bacteria | 4230 |
| 240 | Ga0105248_10091165 | 3300009177 | Bacteria | 3433 |
| 241 | Ga0105248_10123781 | 3300009177 | Bacteria | 2917 |
| 242 | Ga0105248_10207135 | 3300009177 | Bacteria | 2210 |
| 243 | Ga0105237_10020547 | 3300009545 | Bacteria | 6805 |
| 244 | Ga0105238_10000917 | 3300009551 | Bacteria | 30127 |
| 245 | Ga0105238_10025045 | 3300009551 | Bacteria | 6082 |
| 246 | Ga0105238_10244185 | 3300009551 | Bacteria | 1773 |
| 247 | Ga0105249_10016622 | 3300009553 | Bacteria | 6531 |
| 248 | Ga0105249_10038399 | 3300009553 | Bacteria | 4345 |
| 249 | Ga0105249_10260785 | 3300009553 | Bacteria | 1722 |
| 250 | Ga0105239_10054317 | 3300010375 | Bacteria | 4393 |
| 251 | Ga0157373_10037647 | 3300013100 | Bacteria | 3467 |
| 252 | Ga0157371_10160387 | 3300013102 | Bacteria | 1606 |
| 253 | Ga0157369_10100400 | 3300013105 | Bacteria | 3085 |
| 254 | Ga0157374_10016933 | 3300013296 | Bacteria | 6416 |
| 255 | Ga0157378_10090108 | 3300013297 | Bacteria | 2787 |
| 256 | Ga0163162_10002191 | 3300013306 | Bacteria | 18337 |
| 257 | Ga0163162_10026458 | 3300013306 | Bacteria | 5732 |
| 258 | Ga0163162_10033724 | 3300013306 | Bacteria | 5088 |
| 259 | Ga0163162_10048294 | 3300013306 | Bacteria | 4264 |
| 260 | Ga0163162_10049807 | 3300013306 | Bacteria | 4199 |
| 261 | Ga0157372_10047788 | 3300013307 | Bacteria | 4756 |
| 262 | Ga0157375_10012843 | 3300013308 | Bacteria | 7438 |
| 263 | Ga0157375_10059291 | 3300013308 | Bacteria | 3791 |
| 264 | Ga0157375_10367720 | 3300013308 | Bacteria | 1604 |
| 265 | Ga0163163_10005668 | 3300014325 | Bacteria | 10830 |
| 266 | Ga0163163_10029776 | 3300014325 | Bacteria | 5253 |
| 267 | Ga0157380_10154758 | 3300014326 | Bacteria | 1986 |
| 268 | Ga0157380_10157950 | 3300014326 | Bacteria | 1967 |
| 269 | Ga0157377_10137467 | 3300014745 | Bacteria | 1499 |
| 270 | Ga0157379_10004055 | 3300014968 | Bacteria | 12495 |
| 271 | Ga0157379_10112884 | 3300014968 | Bacteria | 2442 |
| 272 | Ga0157379_10148229 | 3300014968 | Bacteria | 2116 |
| 273 | Ga0157376_10047037 | 3300014969 | Bacteria | 3561 |
| 274 | Ga0157376_10049589 | 3300014969 | Bacteria | 3478 |
| 275 | Ga0182006_1010159 | 3300015261 | Bacteria | 4195 |
| 276 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 277 | Ga0163161_10021414 | 3300017792 | Bacteria | 4544 |
| 278 | Ga0163161_10079810 | 3300017792 | Bacteria | 2407 |
| 279 | Ga0213872_10000309 | 3300021361 | Bacteria | 41727 |
| 280 | Ga0213872_10020490 | 3300021361 | Bacteria | 3048 |
| 281 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 282 | Ga0209436_107453 | 3300025208 | Bacteria | 2284 |
| 283 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 284 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 285 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 286 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 287 | Ga0207425_1000606 | 3300025245 | Bacteria | 20792 |
| 288 | Ga0207425_1014645 | 3300025245 | Bacteria | 1776 |
| 289 | Ga0209646_1000079 | 3300025246 | Bacteria | 207677 |
| 290 | Ga0209026_1000067 | 3300025250 | Bacteria | 207677 |
| 291 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 292 | Ga0209759_1000056 | 3300025256 | Bacteria | 207677 |
| 293 | Ga0209129_1007932 | 3300025258 | Bacteria | 3047 |
| 294 | Ga0209565_1000041 | 3300025263 | Bacteria | 251081 |
| 295 | Ga0209565_1000849 | 3300025263 | Bacteria | 17247 |
| 296 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 297 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 298 | Ga0209130_1000184 | 3300025284 | Bacteria | 87817 |
| 299 | Ga0207673_1007572 | 3300025290 | Bacteria | 1364 |
| 300 | Ga0209675_1000475 | 3300025291 | Bacteria | 30742 |
| 301 | Ga0209675_1000771 | 3300025291 | Bacteria | 21464 |
| 302 | Ga0209675_1007151 | 3300025291 | Bacteria | 4330 |
| 303 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 304 | Ga0209676_1003804 | 3300025292 | Bacteria | 8920 |
| 305 | Ga0209676_1004437 | 3300025292 | Bacteria | 7827 |
| 306 | Ga0209676_1004828 | 3300025292 | Bacteria | 7319 |
| 307 | Ga0209564_1001251 | 3300025295 | Bacteria | 28255 |
| 308 | Ga0209564_1001414 | 3300025295 | Bacteria | 24743 |
| 309 | Ga0209564_1006578 | 3300025295 | Bacteria | 6234 |
| 310 | Ga0209758_1001500 | 3300025297 | Bacteria | 27142 |
| 311 | Ga0209758_1006824 | 3300025297 | Bacteria | 8001 |
| 312 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 313 | Ga0209050_1003807 | 3300025298 | Bacteria | 10766 |
| 314 | Ga0209050_1004622 | 3300025298 | Bacteria | 9190 |
| 315 | Ga0209050_1013208 | 3300025298 | Bacteria | 3692 |
| 316 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 317 | Ga0209256_1037408 | 3300025299 | Bacteria | 1264 |
| 318 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 319 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 320 | Ga0209051_1003394 | 3300025303 | Bacteria | 10450 |
| 321 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 322 | Ga0207697_10003156 | 3300025315 | Bacteria | 8217 |
| 323 | Ga0207656_10018982 | 3300025321 | Bacteria | 2715 |
| 324 | Ga0207656_10019459 | 3300025321 | Bacteria | 2686 |
| 325 | Ga0207656_10057726 | 3300025321 | Bacteria | 1694 |
| 326 | Ga0207656_10087617 | 3300025321 | Bacteria | 1408 |
| 327 | Ga0207682_10012204 | 3300025893 | Bacteria | 3354 |
| 328 | Ga0207680_10002176 | 3300025903 | Bacteria | 9180 |
| 329 | Ga0207645_10013887 | 3300025907 | Bacteria | 5403 |
| 330 | Ga0207645_10040010 | 3300025907 | Bacteria | 3003 |
| 331 | Ga0207645_10087083 | 3300025907 | Bacteria | 2007 |
| 332 | Ga0207643_10059044 | 3300025908 | Bacteria | 2188 |
| 333 | Ga0207643_10081964 | 3300025908 | Bacteria | 1870 |
| 334 | Ga0207705_10221420 | 3300025909 | Bacteria | 1438 |
| 335 | Ga0207654_10162794 | 3300025911 | Bacteria | 1442 |
| 336 | Ga0207707_10165411 | 3300025912 | Bacteria | 1933 |
| 337 | Ga0207695_10001065 | 3300025913 | Bacteria | 48010 |
| 338 | Ga0207695_10012472 | 3300025913 | Bacteria | 10200 |
| 339 | Ga0207695_10081043 | 3300025913 | Bacteria | 3286 |
| 340 | Ga0207695_10127174 | 3300025913 | Bacteria | 2509 |
| 341 | Ga0207671_10011643 | 3300025914 | Bacteria | 7137 |
| 342 | Ga0207660_10171494 | 3300025917 | Bacteria | 1680 |
| 343 | Ga0207662_10091275 | 3300025918 | Bacteria | 1874 |
| 344 | Ga0207657_10087855 | 3300025919 | Bacteria | 2600 |
| 345 | Ga0207649_10001848 | 3300025920 | Bacteria | 12101 |
| 346 | Ga0207652_10020652 | 3300025921 | Bacteria | 5427 |
| 347 | Ga0207646_10102106 | 3300025922 | Bacteria | 2571 |
| 348 | Ga0207681_10060356 | 3300025923 | Bacteria | 2603 |
| 349 | Ga0207681_10132286 | 3300025923 | Bacteria | 1846 |
| 350 | Ga0207694_10000446 | 3300025924 | Bacteria | 38303 |
| 351 | Ga0207694_10021587 | 3300025924 | Bacteria | 4879 |
| 352 | Ga0207694_10084479 | 3300025924 | Bacteria | 2497 |
| 353 | Ga0207650_10000970 | 3300025925 | Bacteria | 21577 |
| 354 | Ga0207650_10007280 | 3300025925 | Bacteria | 7535 |
| 355 | Ga0207650_10021249 | 3300025925 | Bacteria | 4588 |
| 356 | Ga0207659_10000781 | 3300025926 | Bacteria | 18812 |
| 357 | Ga0207659_10005370 | 3300025926 | Bacteria | 7762 |
| 358 | Ga0207659_10017024 | 3300025926 | Bacteria | 4743 |
| 359 | Ga0207659_10022515 | 3300025926 | Bacteria | 4196 |
| 360 | Ga0207659_10063619 | 3300025926 | Bacteria | 2667 |
| 361 | Ga0207659_10184227 | 3300025926 | Bacteria | 1657 |
| 362 | Ga0207687_10067989 | 3300025927 | Bacteria | 2536 |
| 363 | Ga0207687_10145697 | 3300025927 | Bacteria | 1802 |
| 364 | Ga0207644_10000899 | 3300025931 | Bacteria | 18825 |
| 365 | Ga0207644_10003807 | 3300025931 | Bacteria | 9770 |
| 366 | Ga0207644_10013865 | 3300025931 | Bacteria | 5383 |
| 367 | Ga0207644_10041525 | 3300025931 | Bacteria | 3254 |
| 368 | Ga0207644_10162676 | 3300025931 | Bacteria | 1736 |
| 369 | Ga0207644_10332590 | 3300025931 | Bacteria | 1230 |
| 370 | Ga0207690_10011751 | 3300025932 | Bacteria | 5237 |
| 371 | Ga0207706_10095355 | 3300025933 | Bacteria | 2617 |
| 372 | Ga0207686_10001268 | 3300025934 | Bacteria | 14522 |
| 373 | Ga0207686_10003551 | 3300025934 | Bacteria | 8367 |
| 374 | Ga0207686_10006148 | 3300025934 | Bacteria | 6450 |
| 375 | Ga0207686_10006189 | 3300025934 | Bacteria | 6433 |
| 376 | Ga0207686_10096621 | 3300025934 | Bacteria | 1963 |
| 377 | Ga0207686_10120740 | 3300025934 | Bacteria | 1783 |
| 378 | Ga0207709_10029914 | 3300025935 | Bacteria | 3164 |
| 379 | Ga0207669_10010778 | 3300025937 | Bacteria | 4416 |
| 380 | Ga0207669_10019707 | 3300025937 | Bacteria | 3520 |
| 381 | Ga0207669_10121296 | 3300025937 | Bacteria | 1775 |
| 382 | Ga0207704_10032343 | 3300025938 | Bacteria | 2959 |
| 383 | Ga0207704_10138846 | 3300025938 | Bacteria | 1696 |
| 384 | Ga0207691_10000699 | 3300025940 | Bacteria | 33182 |
| 385 | Ga0207691_10002051 | 3300025940 | Bacteria | 19693 |
| 386 | Ga0207691_10013535 | 3300025940 | Bacteria | 7802 |
| 387 | Ga0207691_10043113 | 3300025940 | Bacteria | 4159 |
| 388 | Ga0207691_10062341 | 3300025940 | Bacteria | 3384 |
| 389 | Ga0207691_10077728 | 3300025940 | Bacteria | 2989 |
| 390 | Ga0207691_10091581 | 3300025940 | Bacteria | 2724 |
| 391 | Ga0207691_10130672 | 3300025940 | Bacteria | 2219 |
| 392 | Ga0207691_10286073 | 3300025940 | Bacteria | 1418 |
| 393 | Ga0207711_10088590 | 3300025941 | Bacteria | 2718 |
| 394 | Ga0207711_10131505 | 3300025941 | Bacteria | 2244 |
| 395 | Ga0207689_10008871 | 3300025942 | Bacteria | 8727 |
| 396 | Ga0207689_10012877 | 3300025942 | Bacteria | 7144 |
| 397 | Ga0207689_10043811 | 3300025942 | Bacteria | 3699 |
| 398 | Ga0207689_10062550 | 3300025942 | Bacteria | 3061 |
| 399 | Ga0207689_10066991 | 3300025942 | Bacteria | 2951 |
| 400 | Ga0207689_10093104 | 3300025942 | Bacteria | 2475 |
| 401 | Ga0207679_10015442 | 3300025945 | Bacteria | 5046 |
| 402 | Ga0207679_10185577 | 3300025945 | Bacteria | 1724 |
| 403 | Ga0207679_10241447 | 3300025945 | Bacteria | 1531 |
| 404 | Ga0207667_10000036 | 3300025949 | Bacteria | 297966 |
| 405 | Ga0207667_10053810 | 3300025949 | Bacteria | 4234 |
| 406 | Ga0207651_10005355 | 3300025960 | Bacteria | 6581 |
| 407 | Ga0207651_10074131 | 3300025960 | Bacteria | 2423 |
| 408 | Ga0207651_10180655 | 3300025960 | Bacteria | 1673 |
| 409 | Ga0207712_10073144 | 3300025961 | Bacteria | 2471 |
| 410 | Ga0207712_10240967 | 3300025961 | Bacteria | 1457 |
| 411 | Ga0207668_10006822 | 3300025972 | Bacteria | 6767 |
| 412 | Ga0207668_10161281 | 3300025972 | Bacteria | 1747 |
| 413 | Ga0207640_10021988 | 3300025981 | Bacteria | 3810 |
| 414 | Ga0207640_10103223 | 3300025981 | Bacteria | 2004 |
| 415 | Ga0207640_10234851 | 3300025981 | Bacteria | 1413 |
| 416 | Ga0207658_10022502 | 3300025986 | Bacteria | 4389 |
| 417 | Ga0207677_10008047 | 3300026023 | Bacteria | 5869 |
| 418 | Ga0207677_10014636 | 3300026023 | Bacteria | 4589 |
| 419 | Ga0207677_10125202 | 3300026023 | Bacteria | 1941 |
| 420 | Ga0207703_10002007 | 3300026035 | Bacteria | 17969 |
| 421 | Ga0207703_10017382 | 3300026035 | Bacteria | 5615 |
| 422 | Ga0207703_10030390 | 3300026035 | Bacteria | 4269 |
| 423 | Ga0207703_10077061 | 3300026035 | Bacteria | 2767 |
| 424 | Ga0207639_10091133 | 3300026041 | Bacteria | 2440 |
| 425 | Ga0207678_10024103 | 3300026067 | Bacteria | 5317 |
| 426 | Ga0207678_10074208 | 3300026067 | Bacteria | 2915 |
| 427 | Ga0207702_10014485 | 3300026078 | Bacteria | 6548 |
| 428 | Ga0207702_10042536 | 3300026078 | Bacteria | 3811 |
| 429 | Ga0207702_10143889 | 3300026078 | Bacteria | 2161 |
| 430 | Ga0207641_10028000 | 3300026088 | Bacteria | 4654 |
| 431 | Ga0207648_10000556 | 3300026089 | Bacteria | 41762 |
| 432 | Ga0207648_10027677 | 3300026089 | Bacteria | 5031 |
| 433 | Ga0207648_10071974 | 3300026089 | Bacteria | 3013 |
| 434 | Ga0207648_10143811 | 3300026089 | Bacteria | 2103 |
| 435 | Ga0207648_10283153 | 3300026089 | Bacteria | 1483 |
| 436 | Ga0207676_10002172 | 3300026095 | Bacteria | 14148 |
| 437 | Ga0207676_10047336 | 3300026095 | Bacteria | 3332 |
| 438 | Ga0207676_10051685 | 3300026095 | Bacteria | 3209 |
| 439 | Ga0207674_10022936 | 3300026116 | Bacteria | 6696 |
| 440 | Ga0207675_100002028 | 3300026118 | Bacteria | 20196 |
| 441 | Ga0207683_10019395 | 3300026121 | Bacteria | 5807 |
| 442 | Ga0207683_10086108 | 3300026121 | Bacteria | 2793 |
| 443 | Ga0207683_10251362 | 3300026121 | Bacteria | 1613 |
| 444 | Ga0207698_10176448 | 3300026142 | Bacteria | 1887 |
| 445 | Ga0209969_1011759 | 3300027360 | Bacteria | 1259 |
| 446 | Ga0209981_1008816 | 3300027378 | Bacteria | 1371 |
| 447 | Ga0209966_1018790 | 3300027695 | Bacteria | 1326 |
| 448 | Ga0207428_10015146 | 3300027907 | Bacteria | 6673 |
| 449 | Ga0207428_10038230 | 3300027907 | Bacteria | 3902 |
| 450 | Ga0268265_10133883 | 3300028380 | Bacteria | 2064 |
| 451 | Ga0268265_10134579 | 3300028380 | Bacteria | 2060 |
| 452 | Ga0268265_10219514 | 3300028380 | Bacteria | 1662 |
| 453 | Ga0268265_10357048 | 3300028380 | Bacteria | 1336 |
| 454 | Ga0268264_10017825 | 3300028381 | Bacteria | 5812 |
| 455 | Ga0268264_10018647 | 3300028381 | Bacteria | 5673 |
| 456 | Ga0268264_10146873 | 3300028381 | Bacteria | 2110 |
| 457 | Ga0307517_10009075 | 3300028786 | Bacteria | 14168 |
| 458 | Ga0307517_10047929 | 3300028786 | Bacteria | 4412 |
| 459 | Ga0307515_10000049 | 3300028794 | Bacteria | 278611 |
| 460 | Ga0307515_10000485 | 3300028794 | Bacteria | 94915 |
| 461 | Ga0307515_10028979 | 3300028794 | Bacteria | 9381 |
| 462 | Ga0307515_10040590 | 3300028794 | Bacteria | 7353 |
| 463 | Ga0307515_10116866 | 3300028794 | Bacteria | 3058 |
| 464 | Ga0265332_10003549 | 3300031238 | Bacteria | 7501 |
| 465 | Ga0265328_10072432 | 3300031239 | Bacteria | 1267 |
| 466 | Ga0307513_10002838 | 3300031456 | Bacteria | 23744 |
| 467 | Ga0307513_10004164 | 3300031456 | Bacteria | 19364 |
| 468 | Ga0307513_10105397 | 3300031456 | Bacteria | 2829 |
| 469 | Ga0307513_10151350 | 3300031456 | Bacteria | 2228 |
| 470 | Ga0307509_10000092 | 3300031507 | Bacteria | 124019 |
| 471 | Ga0307509_10002037 | 3300031507 | Bacteria | 33298 |
| 472 | Ga0307509_10042928 | 3300031507 | Bacteria | 4896 |
| 473 | Ga0307408_100002928 | 3300031548 | Bacteria | 11829 |
| 474 | Ga0307408_100012702 | 3300031548 | Bacteria | 5585 |
| 475 | Ga0307408_100033563 | 3300031548 | Bacteria | 3587 |
| 476 | Ga0307408_100054287 | 3300031548 | Bacteria | 2897 |
| 477 | Ga0307408_100134940 | 3300031548 | Bacteria | 1930 |
| 478 | Ga0307508_10001131 | 3300031616 | Bacteria | 30761 |
| 479 | Ga0307508_10003490 | 3300031616 | Bacteria | 15867 |
| 480 | Ga0307514_10000200 | 3300031649 | Bacteria | 167194 |
| 481 | Ga0307514_10000225 | 3300031649 | Bacteria | 151002 |
| 482 | Ga0265314_10001584 | 3300031711 | Bacteria | 25021 |
| 483 | Ga0307516_10000921 | 3300031730 | Bacteria | 40429 |
| 484 | Ga0307405_10020379 | 3300031731 | Bacteria | 3704 |
| 485 | Ga0307413_10034040 | 3300031824 | Bacteria | 2908 |
| 486 | Ga0307413_10035752 | 3300031824 | Bacteria | 2853 |
| 487 | Ga0307413_10136874 | 3300031824 | Bacteria | 1686 |
| 488 | Ga0307410_10019217 | 3300031852 | Bacteria | 4151 |
| 489 | Ga0307410_10022308 | 3300031852 | Bacteria | 3911 |
| 490 | Ga0307406_10003971 | 3300031901 | Bacteria | 8041 |
| 491 | Ga0307406_10010157 | 3300031901 | Bacteria | 5304 |
| 492 | Ga0307407_10064951 | 3300031903 | Bacteria | 2147 |
| 493 | Ga0307407_10141455 | 3300031903 | Bacteria | 1553 |
| 494 | Ga0307412_10000555 | 3300031911 | Bacteria | 22198 |
| 495 | Ga0307412_10066780 | 3300031911 | Bacteria | 2439 |
| 496 | Ga0307412_10084366 | 3300031911 | Bacteria | 2205 |
| 497 | Ga0307409_100000467 | 3300031995 | Bacteria | 17264 |
| 498 | Ga0307409_100465647 | 3300031995 | Bacteria | 1223 |
| 499 | Ga0307416_100106798 | 3300032002 | Bacteria | 2455 |
| 500 | Ga0307416_100120510 | 3300032002 | Bacteria | 2336 |
| 501 | Ga0307416_100144348 | 3300032002 | Bacteria | 2170 |
| 502 | Ga0307414_10071742 | 3300032004 | Bacteria | 2499 |
| 503 | Ga0307411_10005170 | 3300032005 | Bacteria | 6380 |
| 504 | Ga0307411_10021368 | 3300032005 | Bacteria | 3786 |
| 505 | Ga0307411_10051162 | 3300032005 | Bacteria | 2694 |
| 506 | Ga0307411_10116765 | 3300032005 | Bacteria | 1922 |
| 507 | Ga0307415_100009800 | 3300032126 | Bacteria | 5393 |
| 508 | Ga0307415_100235268 | 3300032126 | Bacteria | 1478 |
| 509 | Ga0307510_10001210 | 3300033180 | Bacteria | 27978 |
| 510 | Ga0373943_0148996 | 3300035170 | Bacteria | 1266 |
| 511 | Ga0373955_0194819 | 3300035172 | Bacteria | 1206 |
| 512 | Ga0373931_0040703 | 3300035691 | Bacteria | 2439 |
| 513 | Ga0373927_0032741 | 3300035695 | Bacteria | 3386 |
| 514 | Ga0373933_0243830 | 3300035724 | Bacteria | 1156 |
| 515 | Ga0373947_0027386 | 3300035725 | Bacteria | 3336 |
| 516 | Ga0373937_0494548 | 3300036401 | Bacteria | 1162 |
| 517 | Ga0373925_0010856 | 3300037068 | Bacteria | 6606 |
| 518 | Ga0373925_0027694 | 3300037068 | Bacteria | 4148 |
| 519 | Ga0373925_0224749 | 3300037068 | Bacteria | 1499 |
| 520 | Ga0395900_0089243 | 3300037418 | Bacteria | 3169 |
| 521 | Ga0395900_0131119 | 3300037418 | Bacteria | 2569 |
| 522 | Ga0395905_0000047 | 3300037471 | Bacteria | 237582 |
| 523 | Ga0395905_0001267 | 3300037471 | Bacteria | 31206 |
| 524 | Ga0395905_0003737 | 3300037471 | Bacteria | 16126 |
| 525 | Ga0395905_0016587 | 3300037471 | Bacteria | 7000 |
| 526 | Ga0395905_0020586 | 3300037471 | Bacteria | 6246 |
| 527 | Ga0436365_0761091 | 3300039437 | Bacteria | 1133 |
| 528 | Ga0436365_1311379 | 3300039437 | Bacteria | 4381 |
| 529 | Ga0436361_0236312 | 3300039447 | Bacteria | 14640 |
| 530 | Ga0436361_0545923 | 3300039447 | Bacteria | 57292 |
| 531 | Ga0436361_0782766 | 3300039447 | Bacteria | 5609 |
| 532 | Ga0439431_0002520 | 3300041997 | Bacteria | 4050 |
| 533 | Ga0450911_000410 | 3300042115 | Bacteria | 14168 |
| 534 | Ga0439435_0000488 | 3300042436 | Bacteria | 6305 |
| 535 | Ga0439460_0012015 | 3300042461 | Bacteria | 2239 |
| 536 | Ga0451577_0005487 | 3300042876 | Bacteria | 12985 |
| 537 | Ga0451577_0101670 | 3300042876 | Bacteria | 2568 |
| 538 | Ga0466969_0035807 | 3300044656 | Bacteria | 2509 |
| 539 | Ga0453683_0214985 | 3300044673 | Bacteria | 1222 |
| 540 | Ga0453684_0033003 | 3300044712 | Bacteria | 7226 |
| 541 | Ga0453684_0038319 | 3300044712 | Bacteria | 6556 |
| 542 | Ga0453684_0082011 | 3300044712 | Bacteria | 4019 |
| 543 | Ga0466971_0057708 | 3300044719 | Bacteria | 1752 |
| 544 | Ga0495592_0000413 | 3300046454 | Bacteria | 32677 |
| 545 | Ga0495629_0022966 | 3300046459 | Bacteria | 4446 |
| 546 | Ga0495580_0065960 | 3300046472 | Bacteria | 2535 |
| 547 | Ga0495580_0068885 | 3300046472 | Bacteria | 2473 |
| 548 | Ga0495607_0000386 | 3300046501 | Bacteria | 45031 |
| 549 | Ga0495608_0050822 | 3300046511 | Bacteria | 2750 |
| 550 | Ga0495632_0005226 | 3300046519 | Bacteria | 8651 |
| 551 | Ga0495632_0012832 | 3300046519 | Bacteria | 4809 |
| 552 | Ga0495666_0024170 | 3300046526 | Bacteria | 3003 |
| 553 | Ga0495652_0130108 | 3300046529 | Bacteria | 1994 |
| 554 | Ga0495654_0005706 | 3300046530 | Bacteria | 7177 |
| 555 | Ga0495654_0093560 | 3300046530 | Bacteria | 1392 |
| 556 | Ga0495621_0002601 | 3300046539 | Bacteria | 4874 |
| 557 | Ga0495597_0000116 | 3300046542 | Bacteria | 72210 |
| 558 | Ga0495645_0038509 | 3300046543 | Bacteria | 3487 |
| 559 | Ga0495633_0003149 | 3300046558 | Bacteria | 11172 |
| 560 | Ga0495668_0039347 | 3300046616 | Bacteria | 2640 |
| 561 | Ga0495634_0089188 | 3300046642 | Bacteria | 2005 |
| 562 | Ga0495599_0146676 | 3300046678 | Bacteria | 1462 |
| 563 | Ga0495647_0082743 | 3300046681 | Bacteria | 1304 |
| 564 | Ga0495658_0037329 | 3300046683 | Bacteria | 2685 |
| 565 | Ga0495658_0141810 | 3300046683 | Bacteria | 1470 |
| 566 | Ga0495658_0150575 | 3300046683 | Bacteria | 1429 |
| 567 | Ga0495669_0022259 | 3300046684 | Bacteria | 2753 |
| 568 | Ga0495613_0107558 | 3300046689 | Bacteria | 2012 |
| 569 | Ga0495636_0009989 | 3300047318 | Bacteria | 3741 |
| 570 | Ga0495674_0019794 | 3300047319 | Bacteria | 6241 |
| 571 | Ga0495687_001245 | 3300047443 | Bacteria | 24266 |
| 572 | Ga0495687_007634 | 3300047443 | Bacteria | 6335 |
| 573 | Ga0495681_0025029 | 3300047470 | Bacteria | 3129 |
| 574 | Ga0495686_0002020 | 3300047472 | Bacteria | 20040 |
| 575 | Ga0495593_0103305 | 3300047673 | Bacteria | 1460 |
| 576 | Ga0495615_0003944 | 3300048090 | Bacteria | 2539 |
| 577 | Ga0496108_0108107 | 3300048911 | Bacteria | 2376 |
| 578 | Ga0496108_0195632 | 3300048911 | Bacteria | 1753 |
| 579 | Ga0496108_0243596 | 3300048911 | Bacteria | 1564 |
| 580 | Ga0496109_0398109 | 3300048912 | Bacteria | 1301 |
| 581 | Ga0496113_0174977 | 3300048916 | Bacteria | 1701 |
| 582 | Ga0496116_0007062 | 3300048919 | Bacteria | 10056 |
| 583 | Ga0496116_0127692 | 3300048919 | Bacteria | 1456 |
| 584 | Ga0496118_0005733 | 3300048921 | Bacteria | 13970 |
| 585 | Ga0496118_0047398 | 3300048921 | Bacteria | 3330 |
| 586 | Ga0496119_0007271 | 3300048922 | Bacteria | 10017 |
| 587 | Ga0496120_0002111 | 3300048923 | Bacteria | 21276 |
| 588 | Ga0496121_0000127 | 3300048924 | Bacteria | 168545 |
| 589 | Ga0496121_0002444 | 3300048924 | Bacteria | 28404 |
| 590 | Ga0496122_0000573 | 3300048925 | Bacteria | 75439 |
| 591 | Ga0496122_0002372 | 3300048925 | Bacteria | 26975 |
| 592 | Ga0496123_0000108 | 3300048926 | Bacteria | 166102 |
| 593 | Ga0496123_0002762 | 3300048926 | Bacteria | 21000 |
| 594 | Ga0496123_0009770 | 3300048926 | Bacteria | 8575 |
| 595 | Ga0496124_0052937 | 3300048927 | Bacteria | 3445 |
| 596 | Ga0496124_0078600 | 3300048927 | Bacteria | 2718 |
| 597 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 598 | Ga0496125_0012601 | 3300048928 | Bacteria | 8377 |
| 599 | Ga0496125_0027391 | 3300048928 | Bacteria | 5166 |
| 600 | Ga0496125_0034967 | 3300048928 | Bacteria | 4419 |
| 601 | Ga0496126_0093146 | 3300048929 | Bacteria | 2646 |
| 602 | Ga0501033_0074063 | 3300049570 | Bacteria | 2500 |
| 603 | Ga0501034_0029758 | 3300049571 | Bacteria | 5552 |
| 604 | Ga0501036_0104223 | 3300049572 | Bacteria | 2399 |
| 605 | Ga0501046_0030512 | 3300049580 | Bacteria | 4375 |
| 606 | Ga0501048_0199312 | 3300049582 | Bacteria | 1419 |
| 607 | Ga0501048_0260631 | 3300049582 | Bacteria | 1232 |
| 608 | Ga0501076_0066908 | 3300049592 | Bacteria | 2869 |
| 609 | Ga0501235_021491 | 3300049669 | Bacteria | 1435 |
| 610 | Ga0501257_015645 | 3300049686 | Bacteria | 1754 |
| 611 | Ga0501079_0146853 | 3300049741 | Bacteria | 1838 |
| 612 | Ga0501045_0200445 | 3300049824 | Bacteria | 1487 |
| 613 | nmdc:mga03683_7427_c1 | 3300050489 | Bacteria | 3804 |
| 614 | nmdc:mga00v17_18949_c1 | 3300050491 | Bacteria | 3918 |
| 615 | nmdc:mga0k408_13244_c1 | 3300050493 | Bacteria | 4520 |
| 616 | nmdc:mga0k408_20974_c1 | 3300050493 | Bacteria | 3666 |
| 617 | nmdc:mga0k408_73943_c1 | 3300050493 | Bacteria | 1991 |
| 618 | nmdc:mga07m45_122280_c1 | 3300050496 | Bacteria | 1504 |
| 619 | nmdc:mga07m45_17054_c1 | 3300050496 | Bacteria | 3894 |
| 620 | nmdc:mga07m45_38373_c1 | 3300050496 | Bacteria | 2673 |
| 621 | nmdc:mga07m45_39965_c1 | 3300050496 | Bacteria | 2624 |
| 622 | nmdc:mga07m45_9523_c1 | 3300050496 | Bacteria | 5042 |
| 623 | nmdc:mga05p37_10060_c1 | 3300050507 | Bacteria | 11226 |
| 624 | nmdc:mga05p37_170371_c1 | 3300050507 | Bacteria | 2655 |
| 625 | nmdc:mga09592_101942_c1 | 3300050508 | Bacteria | 2459 |
| 626 | nmdc:mga0qj67_160894_c1 | 3300050509 | Bacteria | 1823 |
| 627 | nmdc:mga0qj67_33522_c1 | 3300050509 | Bacteria | 4007 |
| 628 | nmdc:mga0qj67_54326_c1 | 3300050509 | Bacteria | 3172 |
| 629 | nmdc:mga06r32_130038_c1 | 3300050510 | Bacteria | 2489 |
| 630 | nmdc:mga06r32_231916_c1 | 3300050510 | Bacteria | 1834 |
| 631 | nmdc:mga08y16_18948_c1 | 3300050511 | Bacteria | 7247 |
| 632 | nmdc:mga08y16_235643_c1 | 3300050511 | Bacteria | 1893 |
| 633 | nmdc:mga0n895_369939_c1 | 3300050512 | Bacteria | 1451 |
| 634 | nmdc:mga0n895_96729_c1 | 3300050512 | Bacteria | 1494 |
| 635 | nmdc:mga0a205_71671_c1 | 3300050515 | Bacteria | 3347 |
| 636 | nmdc:mga0sz30_22786_c1 | 3300050516 | Bacteria | 2544 |
| 637 | Ga0495601_0008116 | 3300053077 | Bacteria | 6191 |
| 638 | Ga0495612_0063127 | 3300053078 | Bacteria | 1536 |
| 639 | Ga0495595_0065371 | 3300053084 | Bacteria | 1711 |
| 640 | Ga0500644_0003026 | 3300053088 | Bacteria | 4170 |
| 641 | Ga0500644_0006672 | 3300053088 | Bacteria | 2969 |
| 642 | Ga0500644_0016547 | 3300053088 | Bacteria | 2124 |
| 643 | Ga0500583_0027257 | 3300053092 | Bacteria | 2465 |
| 644 | Ga0500651_0130431 | 3300053093 | Bacteria | 1521 |
| 645 | Ga0500650_0027497 | 3300053098 | Bacteria | 2560 |
| 646 | Ga0500562_017882 | 3300053108 | Bacteria | 1830 |
| 647 | Ga0500593_000168 | 3300053117 | Bacteria | 26386 |
| 648 | Ga0500594_0019549 | 3300053118 | Bacteria | 1680 |
| 649 | Ga0500652_029551 | 3300053131 | Bacteria | 2138 |
| 650 | Ga0500559_0000017 | 3300053136 | Bacteria | 143646 |
| 651 | Ga0500559_0009195 | 3300053136 | Bacteria | 4289 |
| 652 | Ga0500568_0023455 | 3300053139 | Bacteria | 2624 |
| 653 | Ga0500568_0028241 | 3300053139 | Bacteria | 2340 |
| 654 | Ga0500604_0012271 | 3300053151 | Bacteria | 2312 |
| 655 | Ga0500622_0002180 | 3300053156 | Bacteria | 14473 |
| 656 | Ga0500622_0014643 | 3300053156 | Bacteria | 4206 |
| 657 | Ga0500622_0080851 | 3300053156 | Bacteria | 1627 |
| 658 | Ga0500645_000333 | 3300053730 | Bacteria | 33591 |
| 659 | Ga0500645_003191 | 3300053730 | Bacteria | 6811 |
| 660 | Ga0500645_004530 | 3300053730 | Bacteria | 5302 |
| 661 | Ga0500661_000690 | 3300055283 | Bacteria | 6340 |
| 662 | 2511245435 | 2511231002 | Bacteria | 5042903 |
| 663 | 2514043261 | 2513237165 | Bacteria | 6771773 |
| 664 | 2587730741 | 2585428057 | Bacteria | 6737412 |
| 665 | 2599906249 | 2599185292 | Bacteria | 6290804 |
| 666 | 2643862032 | 2643221569 | Bacteria | 6064337 |
| 667 | 2643980924 | 2643221594 | Bacteria | 5811388 |
| 668 | 2644122378 | 2643221621 | Bacteria | 6212786 |
| 669 | 2644305167 | 2643221654 | Bacteria | 5273570 |
| 670 | 2739245110 | 2738543012 | Bacteria | 7115078 |
| 671 | 2739251337 | 2738543013 | Bacteria | 5618633 |
| 672 | 2809031750 | 2808606395 | Bacteria | 6020352 |
| 673 | 2816474520 | 2816332133 | Bacteria | 7249298 |
| 674 | 2839095770 | 2839094727 | Bacteria | 5534556 |
| 675 | 2842325542 | 2842324504 | Bacteria | 9364110 |
| 676 | 2842349821 | 2842348783 | Bacteria | 9002918 |
| 677 | 2842454942 | 2842454564 | Bacteria | 8730687 |
| 678 | 2842721726 | 2842718218 | Bacteria | 4560148 |
| 679 | 2842747813 | 2842747753 | Bacteria | 5578255 |
| 680 | 2857540709 | 2857537821 | Bacteria | 5248181 |
| 681 | 2857543297 | 2857542790 | Bacteria | 5326616 |
| 682 | 2857576937 | 2857576091 | Bacteria | 5465855 |
| 683 | 2858956584 | 2858950400 | Bacteria | 6783797 |
| 684 | 2901308732 | 2901300506 | Bacteria | 8463898 |
| 685 | 2904479389 | 2904479285 | Bacteria | 5073931 |
| 686 | 2904602527 | 2904601388 | Bacteria | 5884906 |
| 687 | 2928116428 | 2928115317 | Bacteria | 6477646 |
| 688 | 2932426022 | 2932422444 | Bacteria | 4678430 |
| 689 | 2941482233 | |||
| 690 | 2998346473 | 2998344455 | Bacteria | 4222996 |
| 691 | 644750160 | 644736347 | Bacteria | 6476522 |
| 692 | 8002394680 | 8002392321 | Bacteria | 4159911 |
| 693 | Ga0439448_0048187 | |||
| 694 | JGI25155J39150_1000121 | |||
| 695 | JGI25156J39149_1000100 | |||
| 696 | JGI25154J39366_1000121 | |||
| 697 | JGI25157J39369_1000130 | |||
| 698 | JGI25150J39212_1001519 | |||
| 699 | JGI25150J39212_1008535 | |||
| 700 | JGI25159J45721_1000190 | |||
| 701 | JGI25159J45721_1002986 | |||
| 702 | JGI25151J46595_10018837 | |||
| 703 | JGI25151J46595_10019083 | |||
| 704 | JGI25153J46596_10002339 | |||
| 705 | rootH1_10071182 | |||
| 706 | rootL2_10086437 | |||
| 707 | rootL2_10156818 | |||
| 708 | JGI25160J50197_1000345 | |||
| 709 | JGI25161J50226_1000007 | |||
| 710 | Ga0055538_1000002 | |||
| 711 | Ga0055539_1000002 | |||
| 712 | Ga0055533_1000004 | |||
| 713 | Ga0055525_1000002 | |||
| 714 | Ga0055526_1000020 | |||
| 715 | Ga0055526_1008255 | |||
| 716 | Ga0055526_1012497 | |||
| 717 | Ga0055526_1020106 | |||
| 718 | Ga0055537_1000183 | |||
| 719 | Ga0055537_1000254 | |||
| 720 | Ga0055537_1006677 | |||
| 721 | Ga0055524_1000101 | |||
| 722 | Ga0055524_1000471 | |||
| 723 | Ga0055536_1017457 | |||
| 724 | Ga0055534_1001095 | |||
| 725 | Ga0055534_1001577 | |||
| 726 | Ga0055528_1001026 | |||
| 727 | Ga0055530_10001334 | |||
| 728 | Ga0055540_1000099 | |||
| 729 | Ga0055531_10013122 | |||
| 730 | Ga0055541_1000002 | |||
| 731 | Ga0055543_1001205 | |||
| 732 | Ga0065715_10049973 | |||
| 733 | Ga0065707_10021263 | |||
| 734 | Ga0065707_10025584 | |||
| 735 | Ga0065707_10093320 | |||
| 736 | Ga0070658_10221720 | |||
| 737 | Ga0070676_10005475 | |||
| 738 | Ga0070676_10054864 | |||
| 739 | Ga0070676_10059423 | |||
| 740 | Ga0070683_100043020 | |||
| 741 | Ga0070690_100002075 | |||
| 742 | Ga0070690_100043091 | |||
| 743 | Ga0070670_100008340 | |||
| 744 | Ga0070670_100146042 | |||
| 745 | Ga0070670_100174832 | |||
| 746 | Ga0070670_100286220 | |||
| 747 | Ga0070666_10004654 | |||
| 748 | Ga0068868_100003547 | |||
| 749 | Ga0068868_100118838 | |||
| 750 | Ga0068868_100176798 | |||
| 751 | Ga0068868_100338209 | |||
| 752 | Ga0070660_100057090 | |||
| 753 | Ga0070689_100046642 | |||
| 754 | Ga0070691_10102727 | |||
| 755 | Ga0070661_100044865 | |||
| 756 | Ga0070692_10200717 | |||
| 757 | Ga0070668_100008228 | |||
| 758 | Ga0070668_100069906 | |||
| 759 | Ga0070669_100012786 | |||
| 760 | Ga0070669_100036817 | |||
| 761 | Ga0070669_100150414 | |||
| 762 | Ga0070675_100019717 | |||
| 763 | Ga0070675_100101870 | |||
| 764 | Ga0070675_100111346 | |||
| 765 | Ga0070675_100122376 | |||
| 766 | Ga0070675_100191275 | |||
| 767 | Ga0070675_100201967 | |||
| 768 | Ga0070671_100005362 | |||
| 769 | Ga0070671_100012210 | |||
| 770 | Ga0070671_100033723 | |||
| 771 | Ga0070671_100042851 | |||
| 772 | Ga0070671_100073624 | |||
| 773 | Ga0070671_100076416 | |||
| 774 | Ga0070674_100004474 | |||
| 775 | Ga0070674_100074001 | |||
| 776 | Ga0070674_100109658 | |||
| 777 | Ga0070674_100130689 | |||
| 778 | Ga0070673_100000694 | |||
| 779 | Ga0070673_100069049 | |||
| 780 | Ga0070673_100078150 | |||
| 781 | Ga0070673_100112208 | |||
| 782 | Ga0070673_100260087 | |||
| 783 | Ga0070688_100009318 | |||
| 784 | Ga0070688_100038186 | |||
| 785 | Ga0070659_100028990 | |||
| 786 | Ga0070667_100010648 | |||
| 787 | Ga0070667_100016789 | |||
| 788 | Ga0070667_100051232 | |||
| 789 | Ga0070667_100262524 | |||
| 790 | Ga0070701_10030791 | |||
| 791 | Ga0070701_10068255 | |||
| 792 | Ga0070701_10093623 | |||
| 793 | Ga0070705_100040144 | |||
| 794 | Ga0070694_100004656 | |||
| 795 | Ga0070694_100005264 | |||
| 796 | Ga0070708_100000315 | |||
| 797 | Ga0070708_100465395 | |||
| 798 | Ga0070663_100071966 | |||
| 799 | Ga0070678_100022799 | |||
| 800 | Ga0070678_100128903 | |||
| 801 | Ga0070678_100169129 | |||
| 802 | Ga0070678_100242948 | |||
| 803 | Ga0070662_100061938 | |||
| 804 | Ga0070681_10199563 | |||
| 805 | Ga0068867_100023179 | |||
| 806 | Ga0068867_100047316 | |||
| 807 | Ga0068867_100337972 | |||
| 808 | Ga0070685_10211923 | |||
| 809 | Ga0070706_100002711 | |||
| 810 | Ga0070707_100175814 | |||
| 811 | Ga0070707_100256972 | |||
| 812 | Ga0070698_100131622 | |||
| 813 | Ga0070698_100154513 | |||
| 814 | Ga0070684_100203051 | |||
| 815 | Ga0070684_100503726 | |||
| 816 | Ga0068853_100061096 | |||
| 817 | Ga0070672_100035426 | |||
| 818 | Ga0070672_100100188 | |||
| 819 | Ga0070672_100277629 | |||
| 820 | Ga0070672_100280430 | |||
| 821 | Ga0070686_100177796 | |||
| 822 | Ga0070695_100041780 | |||
| 823 | Ga0070696_100027522 | |||
| 824 | Ga0070693_100001479 | |||
| 825 | Ga0070693_100016391 | |||
| 826 | Ga0070665_100053512 | |||
| 827 | Ga0070665_100119200 | |||
| 828 | Ga0070665_100216738 | |||
| 829 | Ga0070704_100018982 | |||
| 830 | Ga0070704_100028056 | |||
| 831 | Ga0070704_100034749 | |||
| 832 | Ga0070704_100124000 | |||
| 833 | Ga0068855_100000046 | |||
| 834 | Ga0068855_100034097 | |||
| 835 | Ga0070664_100031391 | |||
| 836 | Ga0070664_100047904 | |||
| 837 | Ga0070664_100121069 | |||
| 838 | Ga0068857_100052496 | |||
| 839 | Ga0068857_100066359 | |||
| 840 | Ga0068857_100078704 | |||
| 841 | Ga0068854_100038067 | |||
| 842 | Ga0068854_100091832 | |||
| 843 | Ga0068856_100027043 | |||
| 844 | Ga0068856_100107861 | |||
| 845 | Ga0070702_100131219 | |||
| 846 | Ga0068852_100070416 | |||
| 847 | Ga0068852_100282928 | |||
| 848 | Ga0068852_100406297 | |||
| 849 | Ga0068859_100023632 | |||
| 850 | Ga0068859_100044579 | |||
| 851 | Ga0068864_100000351 | |||
| 852 | Ga0068864_100027130 | |||
| 853 | Ga0068864_100116200 | |||
| 854 | Ga0068866_10063236 | |||
| 855 | Ga0068866_10183807 | |||
| 856 | Ga0068861_100002726 | |||
| 857 | Ga0068851_10020708 | |||
| 858 | Ga0068851_10030875 | |||
| 859 | Ga0068851_10064987 | |||
| 860 | Ga0068851_10101875 | |||
| 861 | Ga0068851_10119175 | |||
| 862 | Ga0068863_100002991 | |||
| 863 | Ga0068863_100093690 | |||
| 864 | Ga0068858_100000729 | |||
| 865 | Ga0068858_100003527 | |||
| 866 | Ga0068858_100007317 | |||
| 867 | Ga0068858_100030103 | |||
| 868 | Ga0068858_100159500 | |||
| 869 | Ga0068858_100201199 | |||
| 870 | Ga0068860_100002318 | |||
| 871 | Ga0068860_100020683 | |||
| 872 | Ga0068860_100020950 | |||
| 873 | Ga0068860_100060223 | |||
| 874 | Ga0068860_100103009 | |||
| 875 | Ga0068860_100145922 | |||
| 876 | Ga0081455_10055091 | |||
| 877 | Ga0081455_10099808 | |||
| 878 | Ga0081539_10071773 | |||
| 879 | Ga0075365_10063964 | |||
| 880 | Ga0075363_100152511 | |||
| 881 | Ga0075364_10039346 | |||
| 882 | Ga0075364_10095096 | |||
| 883 | Ga0075432_10005083 | |||
| 884 | Ga0075362_10043772 | |||
| 885 | Ga0075367_10133118 | |||
| 886 | Ga0075366_10022146 | |||
| 887 | Ga0075366_10058455 | |||
| 888 | Ga0075366_10059689 | |||
| 889 | Ga0075366_10117996 | |||
| 890 | Ga0097621_100005396 | |||
| 891 | Ga0097621_100009828 | |||
| 892 | Ga0097621_100065188 | |||
| 893 | Ga0097621_100065508 | |||
| 894 | Ga0097621_100155137 | |||
| 895 | Ga0097621_100158974 | |||
| 896 | Ga0075370_10001530 | |||
| 897 | Ga0075370_10001898 | |||
| 898 | Ga0075370_10003975 | |||
| 899 | Ga0068871_100012921 | |||
| 900 | Ga0068871_100056592 | |||
| 901 | Ga0068871_100072962 | |||
| 902 | Ga0068871_100346266 | |||
| 903 | Ga0075428_100061865 | |||
| 904 | Ga0075428_100145137 | |||
| 905 | Ga0075428_100348057 | |||
| 906 | Ga0075430_100071766 | |||
| 907 | Ga0075430_100250233 | |||
| 908 | Ga0075431_100189735 | |||
| 909 | Ga0075433_10192723 | |||
| 910 | Ga0075429_100189647 | |||
| 911 | Ga0068865_100025960 | |||
| 912 | Ga0075436_100112267 | |||
| 913 | Ga0097620_100023632 | |||
| 914 | Ga0097620_100044579 | |||
| 915 | Ga0099826_10181283 | |||
| 916 | Ga0105240_10112430 | |||
| 917 | Ga0105240_10331093 | |||
| 918 | Ga0111539_10002368 | |||
| 919 | Ga0111539_10122371 | |||
| 920 | Ga0111539_10144487 | |||
| 921 | Ga0105245_10059808 | |||
| 922 | Ga0105245_10150428 | |||
| 923 | Ga0105243_10098763 | |||
| 924 | Ga0105243_10130233 | |||
| 925 | Ga0105241_10138049 | |||
| 926 | Ga0105241_10290324 | |||
| 927 | Ga0105242_10013179 | |||
| 928 | Ga0105242_10022167 | |||
| 929 | Ga0105242_10067299 | |||
| 930 | Ga0105242_10205197 | |||
| 931 | Ga0105248_10061085 | |||
| 932 | Ga0105248_10091165 | |||
| 933 | Ga0105248_10123781 | |||
| 934 | Ga0105248_10207135 | |||
| 935 | Ga0105237_10020547 | |||
| 936 | Ga0105238_10000917 | |||
| 937 | Ga0105238_10025045 | |||
| 938 | Ga0105238_10244185 | |||
| 939 | Ga0105249_10016622 | |||
| 940 | Ga0105249_10038399 | |||
| 941 | Ga0105249_10260785 | |||
| 942 | Ga0105239_10054317 | |||
| 943 | Ga0157373_10037647 | |||
| 944 | Ga0157371_10160387 | |||
| 945 | Ga0157369_10100400 | |||
| 946 | Ga0157374_10016933 | |||
| 947 | Ga0157378_10090108 | |||
| 948 | Ga0163162_10002191 | |||
| 949 | Ga0163162_10026458 | |||
| 950 | Ga0163162_10033724 | |||
| 951 | Ga0163162_10048294 | |||
| 952 | Ga0163162_10049807 | |||
| 953 | Ga0157372_10047788 | |||
| 954 | Ga0157375_10012843 | |||
| 955 | Ga0157375_10059291 | |||
| 956 | Ga0157375_10367720 | |||
| 957 | Ga0163163_10005668 | |||
| 958 | Ga0163163_10029776 | |||
| 959 | Ga0157380_10154758 | |||
| 960 | Ga0157380_10157950 | |||
| 961 | Ga0157377_10137467 | |||
| 962 | Ga0157379_10004055 | |||
| 963 | Ga0157379_10112884 | |||
| 964 | Ga0157379_10148229 | |||
| 965 | Ga0157376_10047037 | |||
| 966 | Ga0157376_10049589 | |||
| 967 | Ga0182006_1010159 | |||
| 968 | Ga0183362_10002 | |||
| 969 | Ga0163161_10021414 | |||
| 970 | Ga0163161_10079810 | |||
| 971 | Ga0213872_10000309 | |||
| 972 | Ga0213872_10020490 | |||
| 973 | Ga0209435_100008 | |||
| 974 | Ga0209436_107453 | |||
| 975 | Ga0209784_100002 | |||
| 976 | Ga0209566_100003 | |||
| 977 | Ga0209674_100004 | |||
| 978 | Ga0209563_100006 | |||
| 979 | Ga0207425_1000606 | |||
| 980 | Ga0207425_1014645 | |||
| 981 | Ga0209646_1000079 | |||
| 982 | Ga0209026_1000067 | |||
| 983 | Ga0209677_100003 | |||
| 984 | Ga0209759_1000056 | |||
| 985 | Ga0209129_1007932 | |||
| 986 | Ga0209565_1000041 | |||
| 987 | Ga0209565_1000849 | |||
| 988 | Ga0209673_1000012 | |||
| 989 | Ga0209130_1000014 | |||
| 990 | Ga0209130_1000184 | |||
| 991 | Ga0207673_1007572 | |||
| 992 | Ga0209675_1000475 | |||
| 993 | Ga0209675_1000771 | |||
| 994 | Ga0209675_1007151 | |||
| 995 | Ga0209676_1000013 | |||
| 996 | Ga0209676_1003804 | |||
| 997 | Ga0209676_1004437 | |||
| 998 | Ga0209676_1004828 | |||
| 999 | Ga0209564_1001251 | |||
| 1000 | Ga0209564_1001414 | |||
| 1001 | Ga0209564_1006578 | |||
| 1002 | Ga0209758_1001500 | |||
| 1003 | Ga0209758_1006824 | |||
| 1004 | Ga0209050_1000008 | |||
| 1005 | Ga0209050_1003807 | |||
| 1006 | Ga0209050_1004622 | |||
| 1007 | Ga0209050_1013208 | |||
| 1008 | Ga0209256_1000003 | |||
| 1009 | Ga0209256_1037408 | |||
| 1010 | Ga0207426_1000091 | |||
| 1011 | Ga0209051_1000005 | |||
| 1012 | Ga0209051_1003394 | |||
| 1013 | Ga0209257_1000048 | |||
| 1014 | Ga0207697_10003156 | |||
| 1015 | Ga0207656_10018982 | |||
| 1016 | Ga0207656_10019459 | |||
| 1017 | Ga0207656_10057726 | |||
| 1018 | Ga0207656_10087617 | |||
| 1019 | Ga0207682_10012204 | |||
| 1020 | Ga0207680_10002176 | |||
| 1021 | Ga0207645_10013887 | |||
| 1022 | Ga0207645_10040010 | |||
| 1023 | Ga0207645_10087083 | |||
| 1024 | Ga0207643_10059044 | |||
| 1025 | Ga0207643_10081964 | |||
| 1026 | Ga0207705_10221420 | |||
| 1027 | Ga0207654_10162794 | |||
| 1028 | Ga0207707_10165411 | |||
| 1029 | Ga0207695_10001065 | |||
| 1030 | Ga0207695_10012472 | |||
| 1031 | Ga0207695_10081043 | |||
| 1032 | Ga0207695_10127174 | |||
| 1033 | Ga0207671_10011643 | |||
| 1034 | Ga0207660_10171494 | |||
| 1035 | Ga0207662_10091275 | |||
| 1036 | Ga0207657_10087855 | |||
| 1037 | Ga0207649_10001848 | |||
| 1038 | Ga0207652_10020652 | |||
| 1039 | Ga0207646_10102106 | |||
| 1040 | Ga0207681_10060356 | |||
| 1041 | Ga0207681_10132286 | |||
| 1042 | Ga0207694_10000446 | |||
| 1043 | Ga0207694_10021587 | |||
| 1044 | Ga0207694_10084479 | |||
| 1045 | Ga0207650_10000970 | |||
| 1046 | Ga0207650_10007280 | |||
| 1047 | Ga0207650_10021249 | |||
| 1048 | Ga0207659_10000781 | |||
| 1049 | Ga0207659_10005370 | |||
| 1050 | Ga0207659_10017024 | |||
| 1051 | Ga0207659_10022515 | |||
| 1052 | Ga0207659_10063619 | |||
| 1053 | Ga0207659_10184227 | |||
| 1054 | Ga0207687_10067989 | |||
| 1055 | Ga0207687_10145697 | |||
| 1056 | Ga0207644_10000899 | |||
| 1057 | Ga0207644_10003807 | |||
| 1058 | Ga0207644_10013865 | |||
| 1059 | Ga0207644_10041525 | |||
| 1060 | Ga0207644_10162676 | |||
| 1061 | Ga0207644_10332590 | |||
| 1062 | Ga0207690_10011751 | |||
| 1063 | Ga0207706_10095355 | |||
| 1064 | Ga0207686_10001268 | |||
| 1065 | Ga0207686_10003551 | |||
| 1066 | Ga0207686_10006148 | |||
| 1067 | Ga0207686_10006189 | |||
| 1068 | Ga0207686_10096621 | |||
| 1069 | Ga0207686_10120740 | |||
| 1070 | Ga0207709_10029914 | |||
| 1071 | Ga0207669_10010778 | |||
| 1072 | Ga0207669_10019707 | |||
| 1073 | Ga0207669_10121296 | |||
| 1074 | Ga0207704_10032343 | |||
| 1075 | Ga0207704_10138846 | |||
| 1076 | Ga0207691_10000699 | |||
| 1077 | Ga0207691_10002051 | |||
| 1078 | Ga0207691_10013535 | |||
| 1079 | Ga0207691_10043113 | |||
| 1080 | Ga0207691_10062341 | |||
| 1081 | Ga0207691_10077728 | |||
| 1082 | Ga0207691_10091581 | |||
| 1083 | Ga0207691_10130672 | |||
| 1084 | Ga0207691_10286073 | |||
| 1085 | Ga0207711_10088590 | |||
| 1086 | Ga0207711_10131505 | |||
| 1087 | Ga0207689_10008871 | |||
| 1088 | Ga0207689_10012877 | |||
| 1089 | Ga0207689_10043811 | |||
| 1090 | Ga0207689_10062550 | |||
| 1091 | Ga0207689_10066991 | |||
| 1092 | Ga0207689_10093104 | |||
| 1093 | Ga0207679_10015442 | |||
| 1094 | Ga0207679_10185577 | |||
| 1095 | Ga0207679_10241447 | |||
| 1096 | Ga0207667_10000036 | |||
| 1097 | Ga0207667_10053810 | |||
| 1098 | Ga0207651_10005355 | |||
| 1099 | Ga0207651_10074131 | |||
| 1100 | Ga0207651_10180655 | |||
| 1101 | Ga0207712_10073144 | |||
| 1102 | Ga0207712_10240967 | |||
| 1103 | Ga0207668_10006822 | |||
| 1104 | Ga0207668_10161281 | |||
| 1105 | Ga0207640_10021988 | |||
| 1106 | Ga0207640_10103223 | |||
| 1107 | Ga0207640_10234851 | |||
| 1108 | Ga0207658_10022502 | |||
| 1109 | Ga0207677_10008047 | |||
| 1110 | Ga0207677_10014636 | |||
| 1111 | Ga0207677_10125202 | |||
| 1112 | Ga0207703_10002007 | |||
| 1113 | Ga0207703_10017382 | |||
| 1114 | Ga0207703_10030390 | |||
| 1115 | Ga0207703_10077061 | |||
| 1116 | Ga0207639_10091133 | |||
| 1117 | Ga0207678_10024103 | |||
| 1118 | Ga0207678_10074208 | |||
| 1119 | Ga0207702_10014485 | |||
| 1120 | Ga0207702_10042536 | |||
| 1121 | Ga0207702_10143889 | |||
| 1122 | Ga0207641_10028000 | |||
| 1123 | Ga0207648_10000556 | |||
| 1124 | Ga0207648_10027677 | |||
| 1125 | Ga0207648_10071974 | |||
| 1126 | Ga0207648_10143811 | |||
| 1127 | Ga0207648_10283153 | |||
| 1128 | Ga0207676_10002172 | |||
| 1129 | Ga0207676_10047336 | |||
| 1130 | Ga0207676_10051685 | |||
| 1131 | Ga0207674_10022936 | |||
| 1132 | Ga0207675_100002028 | |||
| 1133 | Ga0207683_10019395 | |||
| 1134 | Ga0207683_10086108 | |||
| 1135 | Ga0207683_10251362 | |||
| 1136 | Ga0207698_10176448 | |||
| 1137 | Ga0209969_1011759 | |||
| 1138 | Ga0209981_1008816 | |||
| 1139 | Ga0209966_1018790 | |||
| 1140 | Ga0207428_10015146 | |||
| 1141 | Ga0207428_10038230 | |||
| 1142 | Ga0268265_10133883 | |||
| 1143 | Ga0268265_10134579 | |||
| 1144 | Ga0268265_10219514 | |||
| 1145 | Ga0268265_10357048 | |||
| 1146 | Ga0268264_10017825 | |||
| 1147 | Ga0268264_10018647 | |||
| 1148 | Ga0268264_10146873 | |||
| 1149 | Ga0307517_10009075 | |||
| 1150 | Ga0307517_10047929 | |||
| 1151 | Ga0307515_10000049 | |||
| 1152 | Ga0307515_10000485 | |||
| 1153 | Ga0307515_10028979 | |||
| 1154 | Ga0307515_10040590 | |||
| 1155 | Ga0307515_10116866 | |||
| 1156 | Ga0265332_10003549 | |||
| 1157 | Ga0265328_10072432 | |||
| 1158 | Ga0307513_10002838 | |||
| 1159 | Ga0307513_10004164 | |||
| 1160 | Ga0307513_10105397 | |||
| 1161 | Ga0307513_10151350 | |||
| 1162 | Ga0307509_10000092 | |||
| 1163 | Ga0307509_10002037 | |||
| 1164 | Ga0307509_10042928 | |||
| 1165 | Ga0307408_100002928 | |||
| 1166 | Ga0307408_100012702 | |||
| 1167 | Ga0307408_100033563 | |||
| 1168 | Ga0307408_100054287 | |||
| 1169 | Ga0307408_100134940 | |||
| 1170 | Ga0307508_10001131 | |||
| 1171 | Ga0307508_10003490 | |||
| 1172 | Ga0307514_10000200 | |||
| 1173 | Ga0307514_10000225 | |||
| 1174 | Ga0265314_10001584 | |||
| 1175 | Ga0307516_10000921 | |||
| 1176 | Ga0307405_10020379 | |||
| 1177 | Ga0307413_10034040 | |||
| 1178 | Ga0307413_10035752 | |||
| 1179 | Ga0307413_10136874 | |||
| 1180 | Ga0307410_10019217 | |||
| 1181 | Ga0307410_10022308 | |||
| 1182 | Ga0307406_10003971 | |||
| 1183 | Ga0307406_10010157 | |||
| 1184 | Ga0307407_10064951 | |||
| 1185 | Ga0307407_10141455 | |||
| 1186 | Ga0307412_10000555 | |||
| 1187 | Ga0307412_10066780 | |||
| 1188 | Ga0307412_10084366 | |||
| 1189 | Ga0307409_100000467 | |||
| 1190 | Ga0307409_100465647 | |||
| 1191 | Ga0307416_100106798 | |||
| 1192 | Ga0307416_100120510 | |||
| 1193 | Ga0307416_100144348 | |||
| 1194 | Ga0307414_10071742 | |||
| 1195 | Ga0307411_10005170 | |||
| 1196 | Ga0307411_10021368 | |||
| 1197 | Ga0307411_10051162 | |||
| 1198 | Ga0307411_10116765 | |||
| 1199 | Ga0307415_100009800 | |||
| 1200 | Ga0307415_100235268 | |||
| 1201 | Ga0307510_10001210 | |||
| 1202 | Ga0373943_0148996 | |||
| 1203 | Ga0373955_0194819 | |||
| 1204 | Ga0373931_0040703 | |||
| 1205 | Ga0373927_0032741 | |||
| 1206 | Ga0373933_0243830 | |||
| 1207 | Ga0373947_0027386 | |||
| 1208 | Ga0373937_0494548 | |||
| 1209 | Ga0373925_0010856 | |||
| 1210 | Ga0373925_0027694 | |||
| 1211 | Ga0373925_0224749 | |||
| 1212 | Ga0395900_0089243 | |||
| 1213 | Ga0395900_0131119 | |||
| 1214 | Ga0395905_0000047 | |||
| 1215 | Ga0395905_0001267 | |||
| 1216 | Ga0395905_0003737 | |||
| 1217 | Ga0395905_0016587 | |||
| 1218 | Ga0395905_0020586 | |||
| 1219 | Ga0436365_0761091 | |||
| 1220 | Ga0436365_1311379 | |||
| 1221 | Ga0436361_0236312 | |||
| 1222 | Ga0436361_0545923 | |||
| 1223 | Ga0436361_0782766 | |||
| 1224 | Ga0439431_0002520 | |||
| 1225 | Ga0450911_000410 | |||
| 1226 | Ga0439435_0000488 | |||
| 1227 | Ga0439460_0012015 | |||
| 1228 | Ga0451577_0005487 | |||
| 1229 | Ga0451577_0101670 | |||
| 1230 | Ga0466969_0035807 | |||
| 1231 | Ga0453683_0214985 | |||
| 1232 | Ga0453684_0033003 | |||
| 1233 | Ga0453684_0038319 | |||
| 1234 | Ga0453684_0082011 | |||
| 1235 | Ga0466971_0057708 | |||
| 1236 | Ga0495592_0000413 | |||
| 1237 | Ga0495629_0022966 | |||
| 1238 | Ga0495580_0065960 | |||
| 1239 | Ga0495580_0068885 | |||
| 1240 | Ga0495607_0000386 | |||
| 1241 | Ga0495608_0050822 | |||
| 1242 | Ga0495632_0005226 | |||
| 1243 | Ga0495632_0012832 | |||
| 1244 | Ga0495666_0024170 | |||
| 1245 | Ga0495652_0130108 | |||
| 1246 | Ga0495654_0005706 | |||
| 1247 | Ga0495654_0093560 | |||
| 1248 | Ga0495621_0002601 | |||
| 1249 | Ga0495597_0000116 | |||
| 1250 | Ga0495645_0038509 | |||
| 1251 | Ga0495633_0003149 | |||
| 1252 | Ga0495668_0039347 | |||
| 1253 | Ga0495634_0089188 | |||
| 1254 | Ga0495599_0146676 | |||
| 1255 | Ga0495647_0082743 | |||
| 1256 | Ga0495658_0037329 | |||
| 1257 | Ga0495658_0141810 | |||
| 1258 | Ga0495658_0150575 | |||
| 1259 | Ga0495669_0022259 | |||
| 1260 | Ga0495613_0107558 | |||
| 1261 | Ga0495636_0009989 | |||
| 1262 | Ga0495674_0019794 | |||
| 1263 | Ga0495687_001245 | |||
| 1264 | Ga0495687_007634 | |||
| 1265 | Ga0495681_0025029 | |||
| 1266 | Ga0495686_0002020 | |||
| 1267 | Ga0495593_0103305 | |||
| 1268 | Ga0495615_0003944 | |||
| 1269 | Ga0496108_0108107 | |||
| 1270 | Ga0496108_0195632 | |||
| 1271 | Ga0496108_0243596 | |||
| 1272 | Ga0496109_0398109 | |||
| 1273 | Ga0496113_0174977 | |||
| 1274 | Ga0496116_0007062 | |||
| 1275 | Ga0496116_0127692 | |||
| 1276 | Ga0496118_0005733 | |||
| 1277 | Ga0496118_0047398 | |||
| 1278 | Ga0496119_0007271 | |||
| 1279 | Ga0496120_0002111 | |||
| 1280 | Ga0496121_0000127 | |||
| 1281 | Ga0496121_0002444 | |||
| 1282 | Ga0496122_0000573 | |||
| 1283 | Ga0496122_0002372 | |||
| 1284 | Ga0496123_0000108 | |||
| 1285 | Ga0496123_0002762 | |||
| 1286 | Ga0496123_0009770 | |||
| 1287 | Ga0496124_0052937 | |||
| 1288 | Ga0496124_0078600 | |||
| 1289 | Ga0496125_0000011 | |||
| 1290 | Ga0496125_0012601 | |||
| 1291 | Ga0496125_0027391 | |||
| 1292 | Ga0496125_0034967 | |||
| 1293 | Ga0496126_0093146 | |||
| 1294 | Ga0501033_0074063 | |||
| 1295 | Ga0501034_0029758 | |||
| 1296 | Ga0501036_0104223 | |||
| 1297 | Ga0501046_0030512 | |||
| 1298 | Ga0501048_0199312 | |||
| 1299 | Ga0501048_0260631 | |||
| 1300 | Ga0501076_0066908 | |||
| 1301 | Ga0501235_021491 | |||
| 1302 | Ga0501257_015645 | |||
| 1303 | Ga0501079_0146853 | |||
| 1304 | Ga0501045_0200445 | |||
| 1305 | nmdc:mga03683_7427_c1 | |||
| 1306 | nmdc:mga00v17_18949_c1 | |||
| 1307 | nmdc:mga0k408_13244_c1 | |||
| 1308 | nmdc:mga0k408_20974_c1 | |||
| 1309 | nmdc:mga0k408_73943_c1 | |||
| 1310 | nmdc:mga07m45_122280_c1 | |||
| 1311 | nmdc:mga07m45_17054_c1 | |||
| 1312 | nmdc:mga07m45_38373_c1 | |||
| 1313 | nmdc:mga07m45_39965_c1 | |||
| 1314 | nmdc:mga07m45_9523_c1 | |||
| 1315 | nmdc:mga05p37_10060_c1 | |||
| 1316 | nmdc:mga05p37_170371_c1 | |||
| 1317 | nmdc:mga09592_101942_c1 | |||
| 1318 | nmdc:mga0qj67_160894_c1 | |||
| 1319 | nmdc:mga0qj67_33522_c1 | |||
| 1320 | nmdc:mga0qj67_54326_c1 | |||
| 1321 | nmdc:mga06r32_130038_c1 | |||
| 1322 | nmdc:mga06r32_231916_c1 | |||
| 1323 | nmdc:mga08y16_18948_c1 | |||
| 1324 | nmdc:mga08y16_235643_c1 | |||
| 1325 | nmdc:mga0n895_369939_c1 | |||
| 1326 | nmdc:mga0n895_96729_c1 | |||
| 1327 | nmdc:mga0a205_71671_c1 | |||
| 1328 | nmdc:mga0sz30_22786_c1 | |||
| 1329 | Ga0495601_0008116 | |||
| 1330 | Ga0495612_0063127 | |||
| 1331 | Ga0495595_0065371 | |||
| 1332 | Ga0500644_0003026 | |||
| 1333 | Ga0500644_0006672 | |||
| 1334 | Ga0500644_0016547 | |||
| 1335 | Ga0500583_0027257 | |||
| 1336 | Ga0500651_0130431 | |||
| 1337 | Ga0500650_0027497 | |||
| 1338 | Ga0500562_017882 | |||
| 1339 | Ga0500593_000168 | |||
| 1340 | Ga0500594_0019549 | |||
| 1341 | Ga0500652_029551 | |||
| 1342 | Ga0500559_0000017 | |||
| 1343 | Ga0500559_0009195 | |||
| 1344 | Ga0500568_0023455 | |||
| 1345 | Ga0500568_0028241 | |||
| 1346 | Ga0500604_0012271 | |||
| 1347 | Ga0500622_0002180 | |||
| 1348 | Ga0500622_0014643 | |||
| 1349 | Ga0500622_0080851 | |||
| 1350 | Ga0500645_000333 | |||
| 1351 | Ga0500645_003191 | |||
| 1352 | Ga0500645_004530 | |||
| 1353 | Ga0500661_000690 | |||
| 1354 | 2511245435 | |||
| 1355 | 2514043261 | |||
| 1356 | 2587730741 | |||
| 1357 | 2599906249 | |||
| 1358 | 2643862032 | |||
| 1359 | 2643980924 | |||
| 1360 | 2644122378 | |||
| 1361 | 2644305167 | |||
| 1362 | 2739245110 | |||
| 1363 | 2739251337 | |||
| 1364 | 2809031750 | |||
| 1365 | 2816474520 | |||
| 1366 | 2839095770 | |||
| 1367 | 2842325542 | |||
| 1368 | 2842349821 | |||
| 1369 | 2842454942 | |||
| 1370 | 2842721726 | |||
| 1371 | 2842747813 | |||
| 1372 | 2857540709 | |||
| 1373 | 2857543297 | |||
| 1374 | 2857576937 | |||
| 1375 | 2858956584 | |||
| 1376 | 2901308732 | |||
| 1377 | 2904479389 | |||
| 1378 | 2904602527 | |||
| 1379 | 2928116428 | |||
| 1380 | 2932426022 | |||
| 1381 | 2941482233 | |||
| 1382 | 2998346473 | |||
| 1383 | 644750160 | |||
| 1384 | 8002394680 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r74-assembly4.cif.gz_D | structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) | 0.9151 | 34 | 348 |
| 4r74-assembly4.cif.gz_D | structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) | 0.9014 | 34 | 348 |
| 6wce-assembly1.cif.gz_A | structure of the periplasmic binding protein p5pa | 0.8959 | 34 | 346 |
| 6wce-assembly1.cif.gz_A | structure of the periplasmic binding protein p5pa | 0.8905 | 34 | 346 |
| 7tav-assembly5.cif.gz_E | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8413 | 33 | 299 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xvyA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8875 | 37 | 133 | 3.40.190.10 |
| 4r74A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8864 | 141 | 348 | 3.40.190.10 |
| 4r74A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8699 | 141 | 348 | 3.40.190.10 |
| af_Q2G1D9_30_309_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8509 | 37 | 328 | 3.40.190.10 |
| 3c9hA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8486 | 35 | 131 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y5EC47-F1-model_v4 | Putative 2-aminoethylphosphonate ABC transporter substrate-binding protein | 0.9876 | 30 | 353 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 |
| AF-A0A0R2TF58-F1-model_v4 | Phosphonate ABC transporter substrate-binding protein | 0.9848 | 55 | 353 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 GO:0046872 |
| AF-A0A645J1K5-F1-model_v4 | Uncharacterized protein | 0.9826 | 206 | 353 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 |
| AF-A0A0R2TF58-F1-model_v4 | Phosphonate ABC transporter substrate-binding protein | 0.9782 | 55 | 353 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 GO:0046872 |
| AF-A0A158M7S7-F1-model_v4 | Putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein | 0.978 | 33 | 282 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 |