F475600

General Info

Members Datasets Scaffolds Average Seq Length
692 223 1384 101

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0043018|Ga0466963_0043018_2542_2910
Length 122
Sequence VPAALAATASPRARKIRQEHSPVPRRVKDFIDISEYTSLDDLLRYLQTIRDNLPPEHQAELKIRGDDVFGRRLTISYFREQTPEEVELESKYAGGEGDGAGIEELRRKLDDVPFKLGKANNG

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
211 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
212 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
213 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
214 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
215 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
216 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
217 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
218 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.03
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 13.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0043018 3300044694 Bacteria 2968
2 JGI24741J21665_1056146 3300001915 Bacteria 580
3 JGI24740J21852_10007592 3300001979 Bacteria 4393
4 JGI24740J21852_10029334 3300001979 Bacteria 1807
5 JGI24740J21852_10034017 3300001979 Bacteria 1610
6 JGI24739J22299_10010235 3300001989 Unclassified 3482
7 JGI24739J22299_10024823 3300001989 Bacteria 2111
8 JGI24737J22298_10002912 3300001990 Bacteria 6068
9 JGI24737J22298_10038282 3300001990 Bacteria 1477
10 JGI24737J22298_10100364 3300001990 Unclassified 857
11 JGI24735J21928_10001758 3300002067 Bacteria 7627
12 JGI24735J21928_10006762 3300002067 Bacteria 3762
13 JGI24735J21928_10033775 3300002067 Bacteria 1510
14 JGI24738J21930_10003267 3300002075 Bacteria 4124
15 JGI24744J21845_10021924 3300002077 Bacteria 1255
16 Ga0058861_11914832 3300004800 Bacteria 1338
17 Ga0070658_10000260 3300005327 Bacteria 46341
18 Ga0070658_10024702 3300005327 Bacteria 4818
19 Ga0070658_10043350 3300005327 Bacteria 3634
20 Ga0070658_10078788 3300005327 Bacteria 2705
21 Ga0070658_10171654 3300005327 Bacteria 1822
22 Ga0070658_10236024 3300005327 Bacteria 1549
23 Ga0070658_10705686 3300005327 Unclassified 876
24 Ga0070658_10748224 3300005327 Bacteria 849
25 Ga0070658_11298884 3300005327 Bacteria 632
26 Ga0070676_10002568 3300005328 Bacteria 9333
27 Ga0070676_10412647 3300005328 Unclassified 942
28 Ga0070683_100001172 3300005329 Bacteria 19853
29 Ga0070683_100012475 3300005329 Bacteria 7385
30 Ga0070683_100111552 3300005329 Bacteria 2580
31 Ga0070683_101121766 3300005329 Unclassified 756
32 Ga0070670_100010245 3300005331 Bacteria 7999
33 Ga0070670_100064552 3300005331 Bacteria 3142
34 Ga0070670_100363360 3300005331 Bacteria 1273
35 Ga0070677_10180360 3300005333 Bacteria 1005
36 Ga0068869_100562963 3300005334 Unclassified 959
37 Ga0070666_10000864 3300005335 Bacteria 18346
38 Ga0070666_10135869 3300005335 Unclassified 1711
39 Ga0070666_10239679 3300005335 Bacteria 1282
40 Ga0070666_10301882 3300005335 Bacteria 1140
41 Ga0070680_100000214 3300005336 Bacteria 38156
42 Ga0070680_100027032 3300005336 Bacteria 4593
43 Ga0070682_100019972 3300005337 Bacteria 3936
44 Ga0070682_100644203 3300005337 Bacteria 843
45 Ga0070682_101409916 3300005337 Bacteria 596
46 Ga0068868_100328218 3300005338 Unclassified 1305
47 Ga0068868_100606152 3300005338 Bacteria 971
48 Ga0070660_100001733 3300005339 Bacteria 14956
49 Ga0070660_100021310 3300005339 Bacteria 4777
50 Ga0070660_100038076 3300005339 Bacteria 3649
51 Ga0070660_100081440 3300005339 Bacteria 2541
52 Ga0070660_100101972 3300005339 Bacteria 2275
53 Ga0070660_100107407 3300005339 Unclassified 2217
54 Ga0070660_100153259 3300005339 Bacteria 1854
55 Ga0070660_100205320 3300005339 Bacteria 1599
56 Ga0070660_100694660 3300005339 Bacteria 853
57 Ga0070660_101055252 3300005339 Unclassified 687
58 Ga0070661_100000439 3300005344 Bacteria 31883
59 Ga0070661_100018920 3300005344 Bacteria 4904
60 Ga0070661_100020858 3300005344 Bacteria 4676
61 Ga0070661_100026201 3300005344 Bacteria 4191
62 Ga0070661_100040458 3300005344 Bacteria 3401
63 Ga0070661_100229713 3300005344 Bacteria 1426
64 Ga0070661_100512044 3300005344 Bacteria 962
65 Ga0070661_101032082 3300005344 Bacteria 683
66 Ga0070692_10017805 3300005345 Bacteria 3405
67 Ga0070692_10031193 3300005345 Bacteria 2670
68 Ga0070692_10116101 3300005345 Unclassified 1487
69 Ga0070692_10248434 3300005345 Bacteria 1064
70 Ga0070668_100004008 3300005347 Bacteria 10899
71 Ga0070668_101434494 3300005347 Bacteria 630
72 Ga0070669_100037495 3300005353 Bacteria 3516
73 Ga0070675_100072110 3300005354 Bacteria 2867
74 Ga0070671_100000784 3300005355 Bacteria 22894
75 Ga0070671_100012814 3300005355 Bacteria 6761
76 Ga0070671_100068639 3300005355 Bacteria 2957
77 Ga0070671_100142164 3300005355 Bacteria 2025
78 Ga0070674_100005793 3300005356 Bacteria 7174
79 Ga0070674_100086130 3300005356 Bacteria 2256
80 Ga0070673_100037720 3300005364 Bacteria 3684
81 Ga0070673_100055112 3300005364 Bacteria 3132
82 Ga0070673_100083707 3300005364 Plasmid 2592
83 Ga0070673_100459247 3300005364 Bacteria 1147
84 Ga0070673_102169712 3300005364 Unclassified 528
85 Ga0070688_100085699 3300005365 Bacteria 2048
86 Ga0070659_100005599 3300005366 Bacteria 9029
87 Ga0070659_100005975 3300005366 Bacteria 8778
88 Ga0070659_100073487 3300005366 Bacteria 2722
89 Ga0070659_100124166 3300005366 Bacteria 2093
90 Ga0070659_100159847 3300005366 Bacteria 1842
91 Ga0070659_100313686 3300005366 Bacteria 1310
92 Ga0070659_100475485 3300005366 Bacteria 1063
93 Ga0070659_100576789 3300005366 Bacteria 965
94 Ga0070659_101105870 3300005366 Unclassified 699
95 Ga0070667_100001684 3300005367 Bacteria 19770
96 Ga0070667_100013350 3300005367 Bacteria 6787
97 Ga0070667_100013632 3300005367 Bacteria 6717
98 Ga0070667_100058886 3300005367 Bacteria 3248
99 Ga0070667_100091684 3300005367 Bacteria 2613
100 Ga0070667_102050648 3300005367 Bacteria 539
101 Ga0070714_100046518 3300005435 Bacteria 3682
102 Ga0070701_10404375 3300005438 Bacteria 866
103 Ga0070663_100008528 3300005455 Bacteria 6310
104 Ga0070663_100024189 3300005455 Bacteria 4084
105 Ga0070663_100146829 3300005455 Bacteria 1805
106 Ga0070663_100167096 3300005455 Unclassified 1698
107 Ga0070678_100011788 3300005456 Bacteria 5407
108 Ga0070678_100324221 3300005456 Bacteria 1316
109 Ga0070662_100000010 3300005457 Bacteria 142717
110 Ga0070662_100087213 3300005457 Bacteria 2336
111 Ga0070662_100331600 3300005457 Bacteria 1243
112 Ga0070681_10019376 3300005458 Bacteria 6808
113 Ga0070681_10026025 3300005458 Bacteria 5882
114 Ga0070681_10034270 3300005458 Bacteria 5098
115 Ga0070681_10171352 3300005458 Unclassified 2092
116 Ga0070681_10286775 3300005458 Bacteria 1557
117 Ga0068867_100003113 3300005459 Bacteria 11699
118 Ga0068867_100063241 3300005459 Bacteria 2750
119 Ga0068867_100227806 3300005459 Bacteria 1505
120 Ga0070679_100017859 3300005530 Bacteria 6871
121 Ga0070684_100027404 3300005535 Bacteria 4808
122 Ga0070684_100071731 3300005535 Bacteria 3048
123 Ga0070684_100393628 3300005535 Bacteria 1277
124 Ga0068853_100000396 3300005539 Bacteria 29782
125 Ga0068853_100014321 3300005539 Bacteria 6490
126 Ga0068853_100026371 3300005539 Bacteria 4879
127 Ga0068853_100091650 3300005539 Unclassified 2673
128 Ga0068853_100139597 3300005539 Bacteria 2175
129 Ga0068853_100167676 3300005539 Bacteria 1985
130 Ga0068853_100235055 3300005539 Unclassified 1678
131 Ga0068853_100327611 3300005539 Bacteria 1421
132 Ga0068853_100858050 3300005539 Unclassified 871
133 Ga0068853_100910431 3300005539 Bacteria 845
134 Ga0068853_100959959 3300005539 Bacteria 822
135 Ga0068853_101077255 3300005539 Bacteria 775
136 Ga0070672_100179674 3300005543 Bacteria 1763
137 Ga0070686_100223552 3300005544 Bacteria 1362
138 Ga0070696_100984244 3300005546 Bacteria 704
139 Ga0070693_100013906 3300005547 Bacteria 4110
140 Ga0070693_100035509 3300005547 Bacteria 2766
141 Ga0070693_100045846 3300005547 Unclassified 2480
142 Ga0070693_100372343 3300005547 Bacteria 983
143 Ga0070665_100007327 3300005548 Bacteria 11223
144 Ga0070665_100085915 3300005548 Bacteria 3152
145 Ga0070665_100147652 3300005548 Unclassified 2354
146 Ga0070665_101583643 3300005548 Unclassified 663
147 Ga0070665_102469784 3300005548 Unclassified 521
148 Ga0068855_100001099 3300005563 Bacteria 33610
149 Ga0068855_100044654 3300005563 Bacteria 5244
150 Ga0068855_100091421 3300005563 Unclassified 3510
151 Ga0070664_100000921 3300005564 Bacteria 22951
152 Ga0070664_100013075 3300005564 Bacteria 6755
153 Ga0070664_100055690 3300005564 Bacteria 3358
154 Ga0070664_100061111 3300005564 Unclassified 3210
155 Ga0070664_100133747 3300005564 Bacteria 2179
156 Ga0070664_100178669 3300005564 Bacteria 1886
157 Ga0070664_100179476 3300005564 Bacteria 1881
158 Ga0070664_102026156 3300005564 Unclassified 546
159 Ga0070664_102149389 3300005564 Bacteria 530
160 Ga0068857_100026615 3300005577 Bacteria 5098
161 Ga0068857_100073146 3300005577 Bacteria 3053
162 Ga0068857_100177567 3300005577 Bacteria 1937
163 Ga0068857_101011143 3300005577 Bacteria 800
164 Ga0068854_100009588 3300005578 Bacteria 6249
165 Ga0068854_100010204 3300005578 Bacteria 6087
166 Ga0068854_100016771 3300005578 Bacteria 4888
167 Ga0068854_100145833 3300005578 Bacteria 1821
168 Ga0068854_100170163 3300005578 Bacteria 1695
169 Ga0068854_101864313 3300005578 Unclassified 552
170 Ga0068856_100000101 3300005614 Bacteria 82391
171 Ga0068856_100033309 3300005614 Bacteria 5044
172 Ga0068856_100334805 3300005614 Bacteria 1531
173 Ga0068852_100001412 3300005616 Bacteria 16199
174 Ga0068852_100007223 3300005616 Bacteria 8100
175 Ga0068852_100035192 3300005616 Bacteria 4174
176 Ga0068852_100275409 3300005616 Unclassified 1621
177 Ga0068852_100459070 3300005616 Bacteria 1262
178 Ga0068852_100500669 3300005616 Bacteria 1210
179 Ga0068852_101531064 3300005616 Unclassified 689
180 Ga0068864_100000982 3300005618 Bacteria 23872
181 Ga0068864_100021264 3300005618 Bacteria 5436
182 Ga0068866_10055476 3300005718 Bacteria 2035
183 Ga0068866_10564240 3300005718 Unclassified 763
184 Ga0068851_10020076 3300005834 Bacteria 3232
185 Ga0068851_10033999 3300005834 Bacteria 2543
186 Ga0068851_10040800 3300005834 Bacteria 2333
187 Ga0068851_10062533 3300005834 Bacteria 1910
188 Ga0068851_10087220 3300005834 Bacteria 1638
189 Ga0068851_10201824 3300005834 Bacteria 1110
190 Ga0068870_10083615 3300005840 Bacteria 1770
191 Ga0068863_100014521 3300005841 Bacteria 7583
192 Ga0068863_100116328 3300005841 Bacteria 2548
193 Ga0068858_100002704 3300005842 Bacteria 17877
194 Ga0068858_100021499 3300005842 Bacteria 6028
195 Ga0068858_100152745 3300005842 Bacteria 2171
196 Ga0068860_100977532 3300005843 Bacteria 864
197 Ga0068860_101102420 3300005843 Bacteria 813
198 Ga0068860_101132591 3300005843 Bacteria 802
199 Ga0068862_100027985 3300005844 Bacteria 4747
200 Ga0068862_102113199 3300005844 Unclassified 574
201 Ga0081540_1175812 3300005983 Unclassified 808
202 Ga0081539_10429838 3300005985 Bacteria 548
203 Ga0070712_100365795 3300006175 Bacteria 1184
204 Ga0097621_100085009 3300006237 Bacteria 2638
205 Ga0097621_100153141 3300006237 Bacteria 1978
206 Ga0068871_100148596 3300006358 Bacteria 1997
207 Ga0068871_100232985 3300006358 Bacteria 1599
208 Ga0068871_100258015 3300006358 Bacteria 1520
209 Ga0068871_101530424 3300006358 Unclassified 631
210 Ga0068865_100067416 3300006881 Bacteria 2528
211 Ga0068865_100257443 3300006881 Bacteria 1380
212 Ga0075435_100276988 3300007076 Unclassified 1432
213 Ga0105240_10023057 3300009093 Bacteria 8243
214 Ga0105245_10723017 3300009098 Bacteria 1030
215 Ga0105241_10016068 3300009174 Bacteria 5488
216 Ga0105241_10135201 3300009174 Bacteria 2001
217 Ga0105248_10000518 3300009177 Bacteria 43806
218 Ga0105248_10000673 3300009177 Bacteria 38736
219 Ga0105248_10000724 3300009177 Bacteria 37195
220 Ga0105248_10063469 3300009177 Bacteria 4146
221 Ga0105248_10130710 3300009177 Bacteria 2833
222 Ga0105248_10257477 3300009177 Bacteria 1965
223 Ga0105237_10042163 3300009545 Bacteria 4603
224 Ga0105237_10784995 3300009545 Bacteria 959
225 Ga0105238_10020941 3300009551 Bacteria 6661
226 Ga0105238_10044679 3300009551 Bacteria 4478
227 Ga0105238_10192825 3300009551 Bacteria 2013
228 Ga0105238_10557477 3300009551 Bacteria 1151
229 Ga0105238_10916921 3300009551 Bacteria 895
230 Ga0105239_10648469 3300010375 Bacteria 1206
231 Ga0157373_10002321 3300013100 Bacteria 14423
232 Ga0157373_10049402 3300013100 Bacteria 2998
233 Ga0157373_10060121 3300013100 Unclassified 2692
234 Ga0157373_10075863 3300013100 Bacteria 2372
235 Ga0157373_10293020 3300013100 Bacteria 1154
236 Ga0157371_10003868 3300013102 Bacteria 13346
237 Ga0157371_10050668 3300013102 Bacteria 2951
238 Ga0157371_10235089 3300013102 Bacteria 1318
239 Ga0157371_10656123 3300013102 Unclassified 783
240 Ga0157371_11301389 3300013102 Unclassified 562
241 Ga0157370_10025144 3300013104 Bacteria 5895
242 Ga0157370_10048689 3300013104 Bacteria 4060
243 Ga0157370_10060529 3300013104 Bacteria 3595
244 Ga0157370_10072201 3300013104 Bacteria 3257
245 Ga0157370_10109241 3300013104 Bacteria 2586
246 Ga0157370_10205276 3300013104 Unclassified 1827
247 Ga0157370_11133714 3300013104 Bacteria 706
248 Ga0157369_10087549 3300013105 Bacteria 3325
249 Ga0157369_10093052 3300013105 Bacteria 3218
250 Ga0157369_10173701 3300013105 Bacteria 2269
251 Ga0157369_10330291 3300013105 Bacteria 1584
252 Ga0157369_10433752 3300013105 Bacteria 1361
253 Ga0157369_10618442 3300013105 Bacteria 1118
254 Ga0157374_10009179 3300013296 Bacteria 8480
255 Ga0157374_10097007 3300013296 Bacteria 2820
256 Ga0157378_10815449 3300013297 Unclassified 960
257 Ga0157378_11982417 3300013297 Unclassified 632
258 Ga0163162_10575489 3300013306 Unclassified 1253
259 Ga0157372_10005550 3300013307 Bacteria 13406
260 Ga0157372_10241476 3300013307 Bacteria 2096
261 Ga0157372_12410668 3300013307 Unclassified 604
262 Ga0157375_11022171 3300013308 Bacteria 965
263 Ga0163163_10000580 3300014325 Bacteria 32211
264 Ga0182008_10033273 3300014497 Bacteria 2586
265 Ga0182008_10436077 3300014497 Bacteria 710
266 Ga0157377_10740515 3300014745 Unclassified 718
267 Ga0157379_10136416 3300014968 Bacteria 2211
268 Ga0157379_10413054 3300014968 Unclassified 1242
269 Ga0157379_10511376 3300014968 Bacteria 1114
270 Ga0163161_10948065 3300017792 Unclassified 732
271 Ga0197907_11447562 3300020069 Bacteria 1124
272 Ga0206355_1219541 3300020076 Bacteria 1019
273 Ga0206352_11361757 3300020078 Bacteria 658
274 Ga0213876_10007572 3300021384 Bacteria 5897
275 Ga0213876_10077295 3300021384 Bacteria 1758
276 Ga0207697_10007515 3300025315 Bacteria 4853
277 Ga0207697_10255981 3300025315 Unclassified 775
278 Ga0207656_10008312 3300025321 Bacteria 3815
279 Ga0207656_10043671 3300025321 Bacteria 1912
280 Ga0207656_10063472 3300025321 Unclassified 1626
281 Ga0207656_10081600 3300025321 Unclassified 1454
282 Ga0207656_10290036 3300025321 Bacteria 808
283 Ga0207682_10247661 3300025893 Unclassified 829
284 Ga0207642_10084165 3300025899 Bacteria 1553
285 Ga0207642_10454260 3300025899 Unclassified 777
286 Ga0207710_10496543 3300025900 Bacteria 633
287 Ga0207688_10027931 3300025901 Bacteria 3104
288 Ga0207680_10010218 3300025903 Bacteria 4689
289 Ga0207680_10026577 3300025903 Bacteria 3210
290 Ga0207680_10215957 3300025903 Bacteria 1313
291 Ga0207680_10219417 3300025903 Bacteria 1303
292 Ga0207680_10321119 3300025903 Bacteria 1083
293 Ga0207680_10950320 3300025903 Bacteria 616
294 Ga0207647_10006317 3300025904 Bacteria 8624
295 Ga0207647_10078895 3300025904 Unclassified 1977
296 Ga0207647_10103807 3300025904 Bacteria 1685
297 Ga0207647_10307197 3300025904 Bacteria 902
298 Ga0207647_10501598 3300025904 Bacteria 677
299 Ga0207699_10136677 3300025906 Bacteria 1606
300 Ga0207645_10008871 3300025907 Bacteria 6981
301 Ga0207645_10854764 3300025907 Unclassified 618
302 Ga0207705_10000113 3300025909 Bacteria 90567
303 Ga0207705_10020922 3300025909 Bacteria 4667
304 Ga0207705_10029641 3300025909 Bacteria 3901
305 Ga0207705_10046426 3300025909 Unclassified 3121
306 Ga0207705_10063680 3300025909 Bacteria 2664
307 Ga0207705_10112608 3300025909 Unclassified 2012
308 Ga0207705_10301795 3300025909 Bacteria 1228
309 Ga0207705_10310498 3300025909 Bacteria 1210
310 Ga0207705_10349022 3300025909 Bacteria 1140
311 Ga0207705_10373604 3300025909 Unclassified 1101
312 Ga0207705_10666171 3300025909 Unclassified 809
313 Ga0207654_10047001 3300025911 Bacteria 2464
314 Ga0207707_10021840 3300025912 Bacteria 5593
315 Ga0207707_10077946 3300025912 Unclassified 2893
316 Ga0207707_10116300 3300025912 Bacteria 2337
317 Ga0207707_10459711 3300025912 Bacteria 1089
318 Ga0207707_10702746 3300025912 Bacteria 849
319 Ga0207707_10760445 3300025912 Bacteria 810
320 Ga0207695_10056940 3300025913 Bacteria 4065
321 Ga0207695_10359435 3300025913 Bacteria 1343
322 Ga0207671_10586634 3300025914 Bacteria 888
323 Ga0207693_10422831 3300025915 Bacteria 1041
324 Ga0207660_10001468 3300025917 Bacteria 15862
325 Ga0207660_10007711 3300025917 Bacteria 6967
326 Ga0207657_10000026 3300025919 Bacteria 143118
327 Ga0207657_10001248 3300025919 Bacteria 27180
328 Ga0207657_10003075 3300025919 Bacteria 17857
329 Ga0207657_10009815 3300025919 Bacteria 9591
330 Ga0207657_10025391 3300025919 Bacteria 5465
331 Ga0207657_10044126 3300025919 Bacteria 3921
332 Ga0207657_10091460 3300025919 Bacteria 2537
333 Ga0207657_10150346 3300025919 Unclassified 1897
334 Ga0207657_10164079 3300025919 Bacteria 1803
335 Ga0207657_10316232 3300025919 Bacteria 1235
336 Ga0207657_10487905 3300025919 Viruses 966
337 Ga0207657_11041132 3300025919 Unclassified 627
338 Ga0207649_10000228 3300025920 Bacteria 45916
339 Ga0207649_10000594 3300025920 Bacteria 24526
340 Ga0207649_10022562 3300025920 Bacteria 3637
341 Ga0207649_10059296 3300025920 Unclassified 2401
342 Ga0207649_10070942 3300025920 Bacteria 2223
343 Ga0207649_10197325 3300025920 Bacteria 1419
344 Ga0207649_10322526 3300025920 Bacteria 1135
345 Ga0207649_10559481 3300025920 Bacteria 876
346 Ga0207649_10952175 3300025920 Bacteria 674
347 Ga0207652_10073056 3300025921 Unclassified 2983
348 Ga0207652_10095305 3300025921 Bacteria 2621
349 Ga0207652_10204701 3300025921 Bacteria 1776
350 Ga0207681_10033601 3300025923 Bacteria 3364
351 Ga0207694_10000667 3300025924 Bacteria 30806
352 Ga0207694_10092833 3300025924 Bacteria 2383
353 Ga0207694_10290436 3300025924 Bacteria 1345
354 Ga0207694_10368631 3300025924 Bacteria 1191
355 Ga0207694_10714804 3300025924 Bacteria 845
356 Ga0207694_11281496 3300025924 Bacteria 620
357 Ga0207650_10012852 3300025925 Bacteria 5785
358 Ga0207650_10026411 3300025925 Bacteria 4142
359 Ga0207650_10067719 3300025925 Plasmid 2679
360 Ga0207650_10790390 3300025925 Bacteria 804
361 Ga0207659_10064372 3300025926 Bacteria 2653
362 Ga0207664_10020145 3300025929 Bacteria 4939
363 Ga0207644_10000308 3300025931 Bacteria 31770
364 Ga0207644_10009075 3300025931 Bacteria 6521
365 Ga0207644_10032758 3300025931 Bacteria 3628
366 Ga0207644_10040854 3300025931 Bacteria 3279
367 Ga0207644_10141940 3300025931 Bacteria 1850
368 Ga0207690_10000036 3300025932 Bacteria 143853
369 Ga0207690_10001936 3300025932 Bacteria 12689
370 Ga0207690_10041673 3300025932 Unclassified 3010
371 Ga0207690_10053132 3300025932 Bacteria 2717
372 Ga0207690_10200985 3300025932 Bacteria 1513
373 Ga0207690_10319381 3300025932 Bacteria 1220
374 Ga0207690_10333952 3300025932 Bacteria 1194
375 Ga0207690_10380162 3300025932 Bacteria 1122
376 Ga0207690_10420198 3300025932 Bacteria 1069
377 Ga0207690_10586290 3300025932 Bacteria 909
378 Ga0207690_10882984 3300025932 Bacteria 741
379 Ga0207690_11602250 3300025932 Bacteria 544
380 Ga0207706_10000031 3300025933 Bacteria 143109
381 Ga0207706_10004389 3300025933 Bacteria 13261
382 Ga0207706_10005019 3300025933 Bacteria 12357
383 Ga0207706_10588416 3300025933 Bacteria 956
384 Ga0207706_11042412 3300025933 Unclassified 686
385 Ga0207706_11692912 3300025933 Bacteria 509
386 Ga0207669_10001404 3300025937 Bacteria 10240
387 Ga0207669_10016515 3300025937 Bacteria 3753
388 Ga0207704_10017402 3300025938 Bacteria 3725
389 Ga0207704_10031702 3300025938 Bacteria 2981
390 Ga0207704_10056453 3300025938 Bacteria 2406
391 Ga0207704_10511774 3300025938 Bacteria 969
392 Ga0207691_10240229 3300025940 Bacteria 1566
393 Ga0207711_10000876 3300025941 Bacteria 29060
394 Ga0207711_10002871 3300025941 Bacteria 15108
395 Ga0207711_10005792 3300025941 Bacteria 10439
396 Ga0207711_10030921 3300025941 Bacteria 4516
397 Ga0207711_10031665 3300025941 Bacteria 4466
398 Ga0207711_10172328 3300025941 Bacteria 1964
399 Ga0207711_10178635 3300025941 Bacteria 1929
400 Ga0207711_10263254 3300025941 Bacteria 1585
401 Ga0207689_10313355 3300025942 Unclassified 1301
402 Ga0207661_10053660 3300025944 Bacteria 3226
403 Ga0207661_10061129 3300025944 Bacteria 3042
404 Ga0207661_10092705 3300025944 Bacteria 2519
405 Ga0207679_10000093 3300025945 Bacteria 78331
406 Ga0207679_10166606 3300025945 Bacteria 1810
407 Ga0207679_10173321 3300025945 Bacteria 1778
408 Ga0207679_10314966 3300025945 Bacteria 1353
409 Ga0207667_10003819 3300025949 Bacteria 18527
410 Ga0207667_10043268 3300025949 Bacteria 4780
411 Ga0207667_10233423 3300025949 Bacteria 1883
412 Ga0207667_10769592 3300025949 Bacteria 961
413 Ga0207651_10026836 3300025960 Bacteria 3606
414 Ga0207651_10040263 3300025960 Bacteria 3089
415 Ga0207651_10053811 3300025960 Bacteria 2754
416 Ga0207668_10001346 3300025972 Bacteria 14556
417 Ga0207640_10015159 3300025981 Bacteria 4456
418 Ga0207640_10021403 3300025981 Bacteria 3854
419 Ga0207640_10023328 3300025981 Bacteria 3717
420 Ga0207640_10029070 3300025981 Bacteria 3387
421 Ga0207640_11133096 3300025981 Bacteria 693
422 Ga0207658_10019953 3300025986 Bacteria 4639
423 Ga0207658_10023451 3300025986 Bacteria 4307
424 Ga0207658_10188382 3300025986 Bacteria 1713
425 Ga0207658_10424090 3300025986 Bacteria 1173
426 Ga0207658_10945030 3300025986 Bacteria 786
427 Ga0207677_10259078 3300026023 Unclassified 1417
428 Ga0207677_10283921 3300026023 Bacteria 1360
429 Ga0207677_12002480 3300026023 Bacteria 538
430 Ga0207703_10008434 3300026035 Bacteria 8145
431 Ga0207703_10028711 3300026035 Bacteria 4388
432 Ga0207703_10042846 3300026035 Bacteria 3631
433 Ga0207703_10272253 3300026035 Bacteria 1534
434 Ga0207703_11941265 3300026035 Unclassified 565
435 Ga0207639_10000727 3300026041 Bacteria 22478
436 Ga0207639_10001448 3300026041 Bacteria 15976
437 Ga0207639_10017154 3300026041 Bacteria 5131
438 Ga0207639_10051214 3300026041 Bacteria 3140
439 Ga0207639_10104464 3300026041 Bacteria 2297
440 Ga0207639_10152247 3300026041 Unclassified 1938
441 Ga0207639_10682577 3300026041 Bacteria 952
442 Ga0207639_11175820 3300026041 Unclassified 720
443 Ga0207639_11257458 3300026041 Bacteria 695
444 Ga0207678_10001448 3300026067 Bacteria 21804
445 Ga0207678_10023346 3300026067 Bacteria 5409
446 Ga0207678_10052053 3300026067 Bacteria 3533
447 Ga0207678_10178682 3300026067 Bacteria 1812
448 Ga0207678_10205648 3300026067 Bacteria 1684
449 Ga0207678_11093055 3300026067 Unclassified 706
450 Ga0207702_10000353 3300026078 Bacteria 52560
451 Ga0207702_10063315 3300026078 Bacteria 3162
452 Ga0207702_10136619 3300026078 Bacteria 2213
453 Ga0207702_10189964 3300026078 Bacteria 1897
454 Ga0207702_10289897 3300026078 Bacteria 1550
455 Ga0207702_10348033 3300026078 Bacteria 1417
456 Ga0207641_10029107 3300026088 Bacteria 4567
457 Ga0207641_10070206 3300026088 Bacteria 3010
458 Ga0207648_10002517 3300026089 Bacteria 19666
459 Ga0207648_10002532 3300026089 Bacteria 19611
460 Ga0207648_10003033 3300026089 Bacteria 17744
461 Ga0207648_10079457 3300026089 Bacteria 2861
462 Ga0207676_10003014 3300026095 Bacteria 12011
463 Ga0207676_10052345 3300026095 Bacteria 3191
464 Ga0207674_10009710 3300026116 Bacteria 10969
465 Ga0207674_10010984 3300026116 Bacteria 10191
466 Ga0207674_10061004 3300026116 Bacteria 3811
467 Ga0207674_10759014 3300026116 Bacteria 936
468 Ga0207683_10001784 3300026121 Bacteria 19038
469 Ga0207683_10025873 3300026121 Bacteria 5064
470 Ga0207683_10422327 3300026121 Bacteria 1228
471 Ga0207698_10022382 3300026142 Bacteria 4390
472 Ga0207698_10026599 3300026142 Bacteria 4094
473 Ga0207698_10037848 3300026142 Bacteria 3557
474 Ga0207698_10078276 3300026142 Bacteria 2654
475 Ga0207698_10372037 3300026142 Bacteria 1357
476 Ga0207698_10377756 3300026142 Bacteria 1347
477 Ga0207698_10586850 3300026142 Bacteria 1097
478 Ga0207698_11471793 3300026142 Bacteria 696
479 Ga0268266_10112328 3300028379 Bacteria 2415
480 Ga0268266_10181519 3300028379 Unclassified 1916
481 Ga0268265_10021496 3300028380 Bacteria 4521
482 Ga0268264_10754301 3300028381 Unclassified 970
483 Ga0268264_10781898 3300028381 Bacteria 953
484 Ga0268264_10898061 3300028381 Unclassified 889
485 Ga0268264_11254466 3300028381 Bacteria 751
486 Ga0316182_1147984 3300030745 Bacteria 1053
487 Ga0307405_10006914 3300031731 Bacteria 5628
488 Ga0307410_10403787 3300031852 Bacteria 1104
489 Ga0307406_10109115 3300031901 Bacteria 1901
490 Ga0307407_10401366 3300031903 Bacteria 983
491 Ga0307412_10101073 3300031911 Bacteria 2039
492 Ga0307409_100117710 3300031995 Bacteria 2242
493 Ga0307409_101205040 3300031995 Bacteria 780
494 Ga0307409_101541312 3300031995 Bacteria 692
495 Ga0307416_100496710 3300032002 Bacteria 1284
496 Ga0307416_101223854 3300032002 Bacteria 856
497 Ga0307414_10164943 3300032004 Bacteria 1764
498 Ga0307414_10627750 3300032004 Bacteria 966
499 Ga0307411_10684366 3300032005 Bacteria 891
500 Ga0307415_100082053 3300032126 Bacteria 2305
501 Ga0307415_100578754 3300032126 Bacteria 995
502 Ga0373952_0011893 3300035092 Unclassified 1704
503 Ga0373923_0097512 3300035111 Bacteria 1293
504 Ga0373956_0172970 3300035119 Bacteria 1020
505 Ga0373957_0095064 3300035120 Bacteria 1188
506 Ga0373960_0128111 3300035121 Bacteria 848
507 Ga0373955_0002343 3300035172 Bacteria 8255
508 Ga0373955_0274251 3300035172 Bacteria 1014
509 Ga0373931_0354869 3300035691 Bacteria 919
510 Ga0373937_0013140 3300036401 Bacteria 7291
511 Ga0395899_0004600 3300037312 Bacteria 10752
512 Ga0395899_0014790 3300037312 Bacteria 5957
513 Ga0395899_0017932 3300037312 Bacteria 5386
514 Ga0395899_0064251 3300037312 Bacteria 2698
515 Ga0395899_0102221 3300037312 Unclassified 2068
516 Ga0395899_0218382 3300037312 Bacteria 1321
517 Ga0395899_0225299 3300037312 Bacteria 1297
518 Ga0395899_0267180 3300037312 Bacteria 1168
519 Ga0395899_0311399 3300037312 Unclassified 1063
520 Ga0395899_0329435 3300037312 Bacteria 1026
521 Ga0395899_0432149 3300037312 Bacteria 865
522 Ga0395900_0003611 3300037418 Bacteria 16628
523 Ga0395900_0031436 3300037418 Bacteria 5454
524 Ga0395900_0032873 3300037418 Bacteria 5336
525 Ga0395900_0040036 3300037418 Bacteria 4829
526 Ga0395900_0041198 3300037418 Bacteria 4762
527 Ga0395900_0066071 3300037418 Bacteria 3717
528 Ga0395900_0069973 3300037418 Bacteria 3607
529 Ga0395900_0132052 3300037418 Bacteria 2558
530 Ga0395900_0144575 3300037418 Bacteria 2433
531 Ga0395900_0205123 3300037418 Bacteria 1992
532 Ga0395900_0252045 3300037418 Bacteria 1766
533 Ga0395900_0277526 3300037418 Bacteria 1669
534 Ga0395900_0288595 3300037418 Bacteria 1630
535 Ga0395900_0362525 3300037418 Bacteria 1420
536 Ga0395900_0511275 3300037418 Bacteria 1150
537 Ga0395900_0514192 3300037418 Bacteria 1146
538 Ga0395900_0677585 3300037418 Bacteria 966
539 Ga0395900_0700756 3300037418 Bacteria 946
540 Ga0395900_0748487 3300037418 Bacteria 908
541 Ga0395900_0833726 3300037418 Bacteria 848
542 Ga0395900_0942143 3300037418 Bacteria 785
543 Ga0395900_1316940 3300037418 Unclassified 636
544 Ga0395898_0003569 3300037466 Bacteria 17341
545 Ga0395898_0009177 3300037466 Bacteria 10412
546 Ga0395898_0071242 3300037466 Bacteria 3359
547 Ga0395898_0077070 3300037466 Bacteria 3218
548 Ga0395898_0107334 3300037466 Bacteria 2677
549 Ga0395898_0152050 3300037466 Bacteria 2214
550 Ga0395898_0220043 3300037466 Bacteria 1811
551 Ga0395898_0240546 3300037466 Bacteria 1726
552 Ga0395898_0250645 3300037466 Bacteria 1688
553 Ga0395898_0440367 3300037466 Bacteria 1241
554 Ga0395898_0610635 3300037466 Bacteria 1033
555 Ga0395898_0873978 3300037466 Bacteria 838
556 Ga0395905_0000191 3300037471 Bacteria 97191
557 Ga0395905_0002447 3300037471 Bacteria 20569
558 Ga0395905_0013731 3300037471 Bacteria 7752
559 Ga0395905_0031483 3300037471 Bacteria 4994
560 Ga0395905_0054180 3300037471 Bacteria 3753
561 Ga0395905_0060368 3300037471 Bacteria 3545
562 Ga0395905_0067641 3300037471 Bacteria 3346
563 Ga0395905_0078554 3300037471 Bacteria 3092
564 Ga0395905_0081790 3300037471 Bacteria 3027
565 Ga0395905_0082285 3300037471 Unclassified 3017
566 Ga0395905_0109692 3300037471 Bacteria 2591
567 Ga0395905_0117138 3300037471 Bacteria 2503
568 Ga0395905_0159871 3300037471 Bacteria 2117
569 Ga0395905_0162449 3300037471 Bacteria 2099
570 Ga0395905_0178318 3300037471 Unclassified 1995
571 Ga0395905_0187715 3300037471 Bacteria 1940
572 Ga0395905_0488813 3300037471 Bacteria 1130
573 Ga0395905_0520103 3300037471 Bacteria 1090
574 Ga0395905_0543848 3300037471 Bacteria 1062
575 Ga0395905_0605565 3300037471 Bacteria 997
576 Ga0395905_1304921 3300037471 Bacteria 630
577 Ga0395905_1352869 3300037471 Bacteria 616
578 Ga0395901_0001581 3300038443 Bacteria 23545
579 Ga0395901_0025952 3300038443 Bacteria 6016
580 Ga0395901_0026564 3300038443 Bacteria 5945
581 Ga0395901_0037591 3300038443 Bacteria 5007
582 Ga0395901_0101039 3300038443 Bacteria 3026
583 Ga0395901_0125582 3300038443 Bacteria 2696
584 Ga0395901_0303404 3300038443 Bacteria 1655
585 Ga0395901_0470307 3300038443 Bacteria 1283
586 Ga0395901_0474177 3300038443 Unclassified 1277
587 Ga0395901_0638345 3300038443 Bacteria 1069
588 Ga0395901_0638383 3300038443 Bacteria 1069
589 Ga0395901_0653713 3300038443 Bacteria 1054
590 Ga0395901_0826067 3300038443 Bacteria 914
591 Ga0395901_1029428 3300038443 Bacteria 798
592 Ga0395901_1303924 3300038443 Unclassified 688
593 Ga0395901_1416658 3300038443 Bacteria 653
594 Ga0436365_0254469 3300039437 Bacteria 683
595 Ga0436365_1911625 3300039437 Bacteria 11812
596 Ga0436363_0541496 3300039450 Bacteria 1181
597 Ga0439448_0228197 3300042005 Bacteria 655
598 Ga0439458_0140476 3300042157 Bacteria 643
599 Ga0466965_0052167 3300044683 Bacteria 2031
600 Ga0466966_0129648 3300044684 Bacteria 1545
601 Ga0466961_0027941 3300044693 Bacteria 3627
602 Ga0466963_0026855 3300044694 Bacteria 3683
603 Ga0466963_0320143 3300044694 Bacteria 1091
604 Ga0466963_0443050 3300044694 Unclassified 916
605 Ga0466963_0844004 3300044694 Bacteria 646
606 Ga0466963_0879215 3300044694 Unclassified 632
607 Ga0466964_0058225 3300044706 Bacteria 1601
608 Ga0466971_0013808 3300044719 Bacteria 3551
609 Ga0466971_0191878 3300044719 Bacteria 963
610 Ga0466970_0184802 3300044765 Bacteria 1157
611 Ga0466957_0002246 3300044842 Bacteria 10361
612 Ga0466957_0371225 3300044842 Bacteria 974
613 Ga0466957_0911466 3300044842 Bacteria 628
614 Ga0466960_0396848 3300044901 Unclassified 794
615 Ga0466960_0689348 3300044901 Bacteria 612
616 Ga0466958_0005858 3300045836 Bacteria 6652
617 Ga0466958_0793265 3300045836 Bacteria 617
618 Ga0466967_0012901 3300045976 Bacteria 6425
619 Ga0466967_0066075 3300045976 Bacteria 3222
620 Ga0466967_0067451 3300045976 Bacteria 3191
621 Ga0466967_0081693 3300045976 Bacteria 2919
622 Ga0466967_0108505 3300045976 Bacteria 2547
623 Ga0466967_0194416 3300045976 Unclassified 1919
624 Ga0466967_0204578 3300045976 Bacteria 1871
625 Ga0466967_0268394 3300045976 Bacteria 1634
626 Ga0466967_0303335 3300045976 Bacteria 1537
627 Ga0466967_0338865 3300045976 Bacteria 1454
628 Ga0466967_0363177 3300045976 Bacteria 1403
629 Ga0466967_0633386 3300045976 Bacteria 1057
630 Ga0466967_1067948 3300045976 Unclassified 804
631 Ga0466967_1546989 3300045976 Bacteria 661
632 Ga0466967_1768169 3300045976 Bacteria 615
633 Ga0466967_1991282 3300045976 Bacteria 577
634 Ga0495642_0278241 3300046528 Bacteria 733
635 Ga0495668_0044414 3300046616 Unclassified 2470
636 Ga0495625_0485459 3300046660 Bacteria 758
637 Ga0495623_0158436 3300046679 Unclassified 1332
638 Ga0495669_0002777 3300046684 Bacteria 7177
639 Ga0495669_0026501 3300046684 Bacteria 2533
640 Ga0495669_0187185 3300046684 Bacteria 988
641 Ga0495669_0211352 3300046684 Bacteria 929
642 Ga0495669_0346117 3300046684 Unclassified 718
643 Ga0495670_0118940 3300046691 Bacteria 1372
644 Ga0495677_0081012 3300047445 Bacteria 1217
645 Ga0495677_0349936 3300047445 Bacteria 583
646 Ga0495685_075142 3300047447 Bacteria 1129
647 Ga0495602_0061628 3300048088 Bacteria 3260
648 Ga0496104_1808889 3300048907 Bacteria 513
649 Ga0496105_0131770 3300048908 Bacteria 2061
650 Ga0496106_1004169 3300048909 Unclassified 656
651 Ga0496107_0124461 3300048910 Bacteria 1901
652 Ga0496107_0145681 3300048910 Bacteria 1751
653 Ga0496108_0031963 3300048911 Bacteria 4368
654 Ga0496108_1084483 3300048911 Bacteria 681
655 Ga0496109_0001310 3300048912 Bacteria 20538
656 Ga0496109_0144526 3300048912 Bacteria 2225
657 Ga0496109_0768507 3300048912 Bacteria 901
658 Ga0496110_1108637 3300048913 Bacteria 700
659 Ga0496111_0388740 3300048914 Unclassified 1031
660 Ga0496111_0616594 3300048914 Unclassified 793
661 Ga0496112_0037186 3300048915 Bacteria 4752
662 Ga0496112_0138875 3300048915 Bacteria 2400
663 Ga0496112_0227255 3300048915 Bacteria 1821
664 Ga0496112_0272085 3300048915 Bacteria 1642
665 Ga0496113_0008045 3300048916 Bacteria 6842
666 Ga0496113_0212355 3300048916 Bacteria 1541
667 Ga0496113_0342468 3300048916 Bacteria 1199
668 Ga0496114_0000023 3300048917 Bacteria 219092
669 Ga0501067_0134653 3300049583 Unclassified 1376
670 Ga0501067_0517119 3300049583 Bacteria 668
671 Ga0501069_0150513 3300049585 Bacteria 1337
672 Ga0501069_0239620 3300049585 Bacteria 1057
673 Ga0501070_0752875 3300049586 Bacteria 767
674 Ga0501070_0941849 3300049586 Unclassified 672
675 Ga0501202_119401 3300049652 Bacteria 661
676 Ga0501235_055428 3300049669 Bacteria 923
677 Ga0501239_048843 3300049672 Bacteria 607
678 Ga0501240_099311 3300049673 Unclassified 558
679 Ga0501242_046985 3300049674 Bacteria 625
680 Ga0501247_027446 3300049677 Bacteria 764
681 Ga0501252_022099 3300049682 Bacteria 838
682 Ga0501262_017290 3300049759 Bacteria 961
683 Ga0501267_021686 3300049764 Bacteria 712
684 Ga0501271_015052 3300049768 Bacteria 861
685 Ga0501273_003927 3300049770 Bacteria 1607
686 nmdc:mga0rr50_255140_c1 3300050513 Unclassified 1457
687 Ga0495612_0064824 3300053078 Unclassified 1517
688 Ga0495655_0012915 3300053083 Bacteria 1714
689 Ga0587071_110402 3300060344 Bacteria 646
690 Ga0466962_0003001 3300061719 Bacteria 8043
691 Ga0466962_0073558 3300061719 Bacteria 1633
692 Ga0466962_0114046 3300061719 Bacteria 1302
693 Ga0466963_0043018
694 JGI24741J21665_1056146
695 JGI24740J21852_10007592
696 JGI24740J21852_10029334
697 JGI24740J21852_10034017
698 JGI24739J22299_10010235
699 JGI24739J22299_10024823
700 JGI24737J22298_10002912
701 JGI24737J22298_10038282
702 JGI24737J22298_10100364
703 JGI24735J21928_10001758
704 JGI24735J21928_10006762
705 JGI24735J21928_10033775
706 JGI24738J21930_10003267
707 JGI24744J21845_10021924
708 Ga0058861_11914832
709 Ga0070658_10000260
710 Ga0070658_10024702
711 Ga0070658_10043350
712 Ga0070658_10078788
713 Ga0070658_10171654
714 Ga0070658_10236024
715 Ga0070658_10705686
716 Ga0070658_10748224
717 Ga0070658_11298884
718 Ga0070676_10002568
719 Ga0070676_10412647
720 Ga0070683_100001172
721 Ga0070683_100012475
722 Ga0070683_100111552
723 Ga0070683_101121766
724 Ga0070670_100010245
725 Ga0070670_100064552
726 Ga0070670_100363360
727 Ga0070677_10180360
728 Ga0068869_100562963
729 Ga0070666_10000864
730 Ga0070666_10135869
731 Ga0070666_10239679
732 Ga0070666_10301882
733 Ga0070680_100000214
734 Ga0070680_100027032
735 Ga0070682_100019972
736 Ga0070682_100644203
737 Ga0070682_101409916
738 Ga0068868_100328218
739 Ga0068868_100606152
740 Ga0070660_100001733
741 Ga0070660_100021310
742 Ga0070660_100038076
743 Ga0070660_100081440
744 Ga0070660_100101972
745 Ga0070660_100107407
746 Ga0070660_100153259
747 Ga0070660_100205320
748 Ga0070660_100694660
749 Ga0070660_101055252
750 Ga0070661_100000439
751 Ga0070661_100018920
752 Ga0070661_100020858
753 Ga0070661_100026201
754 Ga0070661_100040458
755 Ga0070661_100229713
756 Ga0070661_100512044
757 Ga0070661_101032082
758 Ga0070692_10017805
759 Ga0070692_10031193
760 Ga0070692_10116101
761 Ga0070692_10248434
762 Ga0070668_100004008
763 Ga0070668_101434494
764 Ga0070669_100037495
765 Ga0070675_100072110
766 Ga0070671_100000784
767 Ga0070671_100012814
768 Ga0070671_100068639
769 Ga0070671_100142164
770 Ga0070674_100005793
771 Ga0070674_100086130
772 Ga0070673_100037720
773 Ga0070673_100055112
774 Ga0070673_100083707
775 Ga0070673_100459247
776 Ga0070673_102169712
777 Ga0070688_100085699
778 Ga0070659_100005599
779 Ga0070659_100005975
780 Ga0070659_100073487
781 Ga0070659_100124166
782 Ga0070659_100159847
783 Ga0070659_100313686
784 Ga0070659_100475485
785 Ga0070659_100576789
786 Ga0070659_101105870
787 Ga0070667_100001684
788 Ga0070667_100013350
789 Ga0070667_100013632
790 Ga0070667_100058886
791 Ga0070667_100091684
792 Ga0070667_102050648
793 Ga0070714_100046518
794 Ga0070701_10404375
795 Ga0070663_100008528
796 Ga0070663_100024189
797 Ga0070663_100146829
798 Ga0070663_100167096
799 Ga0070678_100011788
800 Ga0070678_100324221
801 Ga0070662_100000010
802 Ga0070662_100087213
803 Ga0070662_100331600
804 Ga0070681_10019376
805 Ga0070681_10026025
806 Ga0070681_10034270
807 Ga0070681_10171352
808 Ga0070681_10286775
809 Ga0068867_100003113
810 Ga0068867_100063241
811 Ga0068867_100227806
812 Ga0070679_100017859
813 Ga0070684_100027404
814 Ga0070684_100071731
815 Ga0070684_100393628
816 Ga0068853_100000396
817 Ga0068853_100014321
818 Ga0068853_100026371
819 Ga0068853_100091650
820 Ga0068853_100139597
821 Ga0068853_100167676
822 Ga0068853_100235055
823 Ga0068853_100327611
824 Ga0068853_100858050
825 Ga0068853_100910431
826 Ga0068853_100959959
827 Ga0068853_101077255
828 Ga0070672_100179674
829 Ga0070686_100223552
830 Ga0070696_100984244
831 Ga0070693_100013906
832 Ga0070693_100035509
833 Ga0070693_100045846
834 Ga0070693_100372343
835 Ga0070665_100007327
836 Ga0070665_100085915
837 Ga0070665_100147652
838 Ga0070665_101583643
839 Ga0070665_102469784
840 Ga0068855_100001099
841 Ga0068855_100044654
842 Ga0068855_100091421
843 Ga0070664_100000921
844 Ga0070664_100013075
845 Ga0070664_100055690
846 Ga0070664_100061111
847 Ga0070664_100133747
848 Ga0070664_100178669
849 Ga0070664_100179476
850 Ga0070664_102026156
851 Ga0070664_102149389
852 Ga0068857_100026615
853 Ga0068857_100073146
854 Ga0068857_100177567
855 Ga0068857_101011143
856 Ga0068854_100009588
857 Ga0068854_100010204
858 Ga0068854_100016771
859 Ga0068854_100145833
860 Ga0068854_100170163
861 Ga0068854_101864313
862 Ga0068856_100000101
863 Ga0068856_100033309
864 Ga0068856_100334805
865 Ga0068852_100001412
866 Ga0068852_100007223
867 Ga0068852_100035192
868 Ga0068852_100275409
869 Ga0068852_100459070
870 Ga0068852_100500669
871 Ga0068852_101531064
872 Ga0068864_100000982
873 Ga0068864_100021264
874 Ga0068866_10055476
875 Ga0068866_10564240
876 Ga0068851_10020076
877 Ga0068851_10033999
878 Ga0068851_10040800
879 Ga0068851_10062533
880 Ga0068851_10087220
881 Ga0068851_10201824
882 Ga0068870_10083615
883 Ga0068863_100014521
884 Ga0068863_100116328
885 Ga0068858_100002704
886 Ga0068858_100021499
887 Ga0068858_100152745
888 Ga0068860_100977532
889 Ga0068860_101102420
890 Ga0068860_101132591
891 Ga0068862_100027985
892 Ga0068862_102113199
893 Ga0081540_1175812
894 Ga0081539_10429838
895 Ga0070712_100365795
896 Ga0097621_100085009
897 Ga0097621_100153141
898 Ga0068871_100148596
899 Ga0068871_100232985
900 Ga0068871_100258015
901 Ga0068871_101530424
902 Ga0068865_100067416
903 Ga0068865_100257443
904 Ga0075435_100276988
905 Ga0105240_10023057
906 Ga0105245_10723017
907 Ga0105241_10016068
908 Ga0105241_10135201
909 Ga0105248_10000518
910 Ga0105248_10000673
911 Ga0105248_10000724
912 Ga0105248_10063469
913 Ga0105248_10130710
914 Ga0105248_10257477
915 Ga0105237_10042163
916 Ga0105237_10784995
917 Ga0105238_10020941
918 Ga0105238_10044679
919 Ga0105238_10192825
920 Ga0105238_10557477
921 Ga0105238_10916921
922 Ga0105239_10648469
923 Ga0157373_10002321
924 Ga0157373_10049402
925 Ga0157373_10060121
926 Ga0157373_10075863
927 Ga0157373_10293020
928 Ga0157371_10003868
929 Ga0157371_10050668
930 Ga0157371_10235089
931 Ga0157371_10656123
932 Ga0157371_11301389
933 Ga0157370_10025144
934 Ga0157370_10048689
935 Ga0157370_10060529
936 Ga0157370_10072201
937 Ga0157370_10109241
938 Ga0157370_10205276
939 Ga0157370_11133714
940 Ga0157369_10087549
941 Ga0157369_10093052
942 Ga0157369_10173701
943 Ga0157369_10330291
944 Ga0157369_10433752
945 Ga0157369_10618442
946 Ga0157374_10009179
947 Ga0157374_10097007
948 Ga0157378_10815449
949 Ga0157378_11982417
950 Ga0163162_10575489
951 Ga0157372_10005550
952 Ga0157372_10241476
953 Ga0157372_12410668
954 Ga0157375_11022171
955 Ga0163163_10000580
956 Ga0182008_10033273
957 Ga0182008_10436077
958 Ga0157377_10740515
959 Ga0157379_10136416
960 Ga0157379_10413054
961 Ga0157379_10511376
962 Ga0163161_10948065
963 Ga0197907_11447562
964 Ga0206355_1219541
965 Ga0206352_11361757
966 Ga0213876_10007572
967 Ga0213876_10077295
968 Ga0207697_10007515
969 Ga0207697_10255981
970 Ga0207656_10008312
971 Ga0207656_10043671
972 Ga0207656_10063472
973 Ga0207656_10081600
974 Ga0207656_10290036
975 Ga0207682_10247661
976 Ga0207642_10084165
977 Ga0207642_10454260
978 Ga0207710_10496543
979 Ga0207688_10027931
980 Ga0207680_10010218
981 Ga0207680_10026577
982 Ga0207680_10215957
983 Ga0207680_10219417
984 Ga0207680_10321119
985 Ga0207680_10950320
986 Ga0207647_10006317
987 Ga0207647_10078895
988 Ga0207647_10103807
989 Ga0207647_10307197
990 Ga0207647_10501598
991 Ga0207699_10136677
992 Ga0207645_10008871
993 Ga0207645_10854764
994 Ga0207705_10000113
995 Ga0207705_10020922
996 Ga0207705_10029641
997 Ga0207705_10046426
998 Ga0207705_10063680
999 Ga0207705_10112608
1000 Ga0207705_10301795
1001 Ga0207705_10310498
1002 Ga0207705_10349022
1003 Ga0207705_10373604
1004 Ga0207705_10666171
1005 Ga0207654_10047001
1006 Ga0207707_10021840
1007 Ga0207707_10077946
1008 Ga0207707_10116300
1009 Ga0207707_10459711
1010 Ga0207707_10702746
1011 Ga0207707_10760445
1012 Ga0207695_10056940
1013 Ga0207695_10359435
1014 Ga0207671_10586634
1015 Ga0207693_10422831
1016 Ga0207660_10001468
1017 Ga0207660_10007711
1018 Ga0207657_10000026
1019 Ga0207657_10001248
1020 Ga0207657_10003075
1021 Ga0207657_10009815
1022 Ga0207657_10025391
1023 Ga0207657_10044126
1024 Ga0207657_10091460
1025 Ga0207657_10150346
1026 Ga0207657_10164079
1027 Ga0207657_10316232
1028 Ga0207657_10487905
1029 Ga0207657_11041132
1030 Ga0207649_10000228
1031 Ga0207649_10000594
1032 Ga0207649_10022562
1033 Ga0207649_10059296
1034 Ga0207649_10070942
1035 Ga0207649_10197325
1036 Ga0207649_10322526
1037 Ga0207649_10559481
1038 Ga0207649_10952175
1039 Ga0207652_10073056
1040 Ga0207652_10095305
1041 Ga0207652_10204701
1042 Ga0207681_10033601
1043 Ga0207694_10000667
1044 Ga0207694_10092833
1045 Ga0207694_10290436
1046 Ga0207694_10368631
1047 Ga0207694_10714804
1048 Ga0207694_11281496
1049 Ga0207650_10012852
1050 Ga0207650_10026411
1051 Ga0207650_10067719
1052 Ga0207650_10790390
1053 Ga0207659_10064372
1054 Ga0207664_10020145
1055 Ga0207644_10000308
1056 Ga0207644_10009075
1057 Ga0207644_10032758
1058 Ga0207644_10040854
1059 Ga0207644_10141940
1060 Ga0207690_10000036
1061 Ga0207690_10001936
1062 Ga0207690_10041673
1063 Ga0207690_10053132
1064 Ga0207690_10200985
1065 Ga0207690_10319381
1066 Ga0207690_10333952
1067 Ga0207690_10380162
1068 Ga0207690_10420198
1069 Ga0207690_10586290
1070 Ga0207690_10882984
1071 Ga0207690_11602250
1072 Ga0207706_10000031
1073 Ga0207706_10004389
1074 Ga0207706_10005019
1075 Ga0207706_10588416
1076 Ga0207706_11042412
1077 Ga0207706_11692912
1078 Ga0207669_10001404
1079 Ga0207669_10016515
1080 Ga0207704_10017402
1081 Ga0207704_10031702
1082 Ga0207704_10056453
1083 Ga0207704_10511774
1084 Ga0207691_10240229
1085 Ga0207711_10000876
1086 Ga0207711_10002871
1087 Ga0207711_10005792
1088 Ga0207711_10030921
1089 Ga0207711_10031665
1090 Ga0207711_10172328
1091 Ga0207711_10178635
1092 Ga0207711_10263254
1093 Ga0207689_10313355
1094 Ga0207661_10053660
1095 Ga0207661_10061129
1096 Ga0207661_10092705
1097 Ga0207679_10000093
1098 Ga0207679_10166606
1099 Ga0207679_10173321
1100 Ga0207679_10314966
1101 Ga0207667_10003819
1102 Ga0207667_10043268
1103 Ga0207667_10233423
1104 Ga0207667_10769592
1105 Ga0207651_10026836
1106 Ga0207651_10040263
1107 Ga0207651_10053811
1108 Ga0207668_10001346
1109 Ga0207640_10015159
1110 Ga0207640_10021403
1111 Ga0207640_10023328
1112 Ga0207640_10029070
1113 Ga0207640_11133096
1114 Ga0207658_10019953
1115 Ga0207658_10023451
1116 Ga0207658_10188382
1117 Ga0207658_10424090
1118 Ga0207658_10945030
1119 Ga0207677_10259078
1120 Ga0207677_10283921
1121 Ga0207677_12002480
1122 Ga0207703_10008434
1123 Ga0207703_10028711
1124 Ga0207703_10042846
1125 Ga0207703_10272253
1126 Ga0207703_11941265
1127 Ga0207639_10000727
1128 Ga0207639_10001448
1129 Ga0207639_10017154
1130 Ga0207639_10051214
1131 Ga0207639_10104464
1132 Ga0207639_10152247
1133 Ga0207639_10682577
1134 Ga0207639_11175820
1135 Ga0207639_11257458
1136 Ga0207678_10001448
1137 Ga0207678_10023346
1138 Ga0207678_10052053
1139 Ga0207678_10178682
1140 Ga0207678_10205648
1141 Ga0207678_11093055
1142 Ga0207702_10000353
1143 Ga0207702_10063315
1144 Ga0207702_10136619
1145 Ga0207702_10189964
1146 Ga0207702_10289897
1147 Ga0207702_10348033
1148 Ga0207641_10029107
1149 Ga0207641_10070206
1150 Ga0207648_10002517
1151 Ga0207648_10002532
1152 Ga0207648_10003033
1153 Ga0207648_10079457
1154 Ga0207676_10003014
1155 Ga0207676_10052345
1156 Ga0207674_10009710
1157 Ga0207674_10010984
1158 Ga0207674_10061004
1159 Ga0207674_10759014
1160 Ga0207683_10001784
1161 Ga0207683_10025873
1162 Ga0207683_10422327
1163 Ga0207698_10022382
1164 Ga0207698_10026599
1165 Ga0207698_10037848
1166 Ga0207698_10078276
1167 Ga0207698_10372037
1168 Ga0207698_10377756
1169 Ga0207698_10586850
1170 Ga0207698_11471793
1171 Ga0268266_10112328
1172 Ga0268266_10181519
1173 Ga0268265_10021496
1174 Ga0268264_10754301
1175 Ga0268264_10781898
1176 Ga0268264_10898061
1177 Ga0268264_11254466
1178 Ga0316182_1147984
1179 Ga0307405_10006914
1180 Ga0307410_10403787
1181 Ga0307406_10109115
1182 Ga0307407_10401366
1183 Ga0307412_10101073
1184 Ga0307409_100117710
1185 Ga0307409_101205040
1186 Ga0307409_101541312
1187 Ga0307416_100496710
1188 Ga0307416_101223854
1189 Ga0307414_10164943
1190 Ga0307414_10627750
1191 Ga0307411_10684366
1192 Ga0307415_100082053
1193 Ga0307415_100578754
1194 Ga0373952_0011893
1195 Ga0373923_0097512
1196 Ga0373956_0172970
1197 Ga0373957_0095064
1198 Ga0373960_0128111
1199 Ga0373955_0002343
1200 Ga0373955_0274251
1201 Ga0373931_0354869
1202 Ga0373937_0013140
1203 Ga0395899_0004600
1204 Ga0395899_0014790
1205 Ga0395899_0017932
1206 Ga0395899_0064251
1207 Ga0395899_0102221
1208 Ga0395899_0218382
1209 Ga0395899_0225299
1210 Ga0395899_0267180
1211 Ga0395899_0311399
1212 Ga0395899_0329435
1213 Ga0395899_0432149
1214 Ga0395900_0003611
1215 Ga0395900_0031436
1216 Ga0395900_0032873
1217 Ga0395900_0040036
1218 Ga0395900_0041198
1219 Ga0395900_0066071
1220 Ga0395900_0069973
1221 Ga0395900_0132052
1222 Ga0395900_0144575
1223 Ga0395900_0205123
1224 Ga0395900_0252045
1225 Ga0395900_0277526
1226 Ga0395900_0288595
1227 Ga0395900_0362525
1228 Ga0395900_0511275
1229 Ga0395900_0514192
1230 Ga0395900_0677585
1231 Ga0395900_0700756
1232 Ga0395900_0748487
1233 Ga0395900_0833726
1234 Ga0395900_0942143
1235 Ga0395900_1316940
1236 Ga0395898_0003569
1237 Ga0395898_0009177
1238 Ga0395898_0071242
1239 Ga0395898_0077070
1240 Ga0395898_0107334
1241 Ga0395898_0152050
1242 Ga0395898_0220043
1243 Ga0395898_0240546
1244 Ga0395898_0250645
1245 Ga0395898_0440367
1246 Ga0395898_0610635
1247 Ga0395898_0873978
1248 Ga0395905_0000191
1249 Ga0395905_0002447
1250 Ga0395905_0013731
1251 Ga0395905_0031483
1252 Ga0395905_0054180
1253 Ga0395905_0060368
1254 Ga0395905_0067641
1255 Ga0395905_0078554
1256 Ga0395905_0081790
1257 Ga0395905_0082285
1258 Ga0395905_0109692
1259 Ga0395905_0117138
1260 Ga0395905_0159871
1261 Ga0395905_0162449
1262 Ga0395905_0178318
1263 Ga0395905_0187715
1264 Ga0395905_0488813
1265 Ga0395905_0520103
1266 Ga0395905_0543848
1267 Ga0395905_0605565
1268 Ga0395905_1304921
1269 Ga0395905_1352869
1270 Ga0395901_0001581
1271 Ga0395901_0025952
1272 Ga0395901_0026564
1273 Ga0395901_0037591
1274 Ga0395901_0101039
1275 Ga0395901_0125582
1276 Ga0395901_0303404
1277 Ga0395901_0470307
1278 Ga0395901_0474177
1279 Ga0395901_0638345
1280 Ga0395901_0638383
1281 Ga0395901_0653713
1282 Ga0395901_0826067
1283 Ga0395901_1029428
1284 Ga0395901_1303924
1285 Ga0395901_1416658
1286 Ga0436365_0254469
1287 Ga0436365_1911625
1288 Ga0436363_0541496
1289 Ga0439448_0228197
1290 Ga0439458_0140476
1291 Ga0466965_0052167
1292 Ga0466966_0129648
1293 Ga0466961_0027941
1294 Ga0466963_0026855
1295 Ga0466963_0320143
1296 Ga0466963_0443050
1297 Ga0466963_0844004
1298 Ga0466963_0879215
1299 Ga0466964_0058225
1300 Ga0466971_0013808
1301 Ga0466971_0191878
1302 Ga0466970_0184802
1303 Ga0466957_0002246
1304 Ga0466957_0371225
1305 Ga0466957_0911466
1306 Ga0466960_0396848
1307 Ga0466960_0689348
1308 Ga0466958_0005858
1309 Ga0466958_0793265
1310 Ga0466967_0012901
1311 Ga0466967_0066075
1312 Ga0466967_0067451
1313 Ga0466967_0081693
1314 Ga0466967_0108505
1315 Ga0466967_0194416
1316 Ga0466967_0204578
1317 Ga0466967_0268394
1318 Ga0466967_0303335
1319 Ga0466967_0338865
1320 Ga0466967_0363177
1321 Ga0466967_0633386
1322 Ga0466967_1067948
1323 Ga0466967_1546989
1324 Ga0466967_1768169
1325 Ga0466967_1991282
1326 Ga0495642_0278241
1327 Ga0495668_0044414
1328 Ga0495625_0485459
1329 Ga0495623_0158436
1330 Ga0495669_0002777
1331 Ga0495669_0026501
1332 Ga0495669_0187185
1333 Ga0495669_0211352
1334 Ga0495669_0346117
1335 Ga0495670_0118940
1336 Ga0495677_0081012
1337 Ga0495677_0349936
1338 Ga0495685_075142
1339 Ga0495602_0061628
1340 Ga0496104_1808889
1341 Ga0496105_0131770
1342 Ga0496106_1004169
1343 Ga0496107_0124461
1344 Ga0496107_0145681
1345 Ga0496108_0031963
1346 Ga0496108_1084483
1347 Ga0496109_0001310
1348 Ga0496109_0144526
1349 Ga0496109_0768507
1350 Ga0496110_1108637
1351 Ga0496111_0388740
1352 Ga0496111_0616594
1353 Ga0496112_0037186
1354 Ga0496112_0138875
1355 Ga0496112_0227255
1356 Ga0496112_0272085
1357 Ga0496113_0008045
1358 Ga0496113_0212355
1359 Ga0496113_0342468
1360 Ga0496114_0000023
1361 Ga0501067_0134653
1362 Ga0501067_0517119
1363 Ga0501069_0150513
1364 Ga0501069_0239620
1365 Ga0501070_0752875
1366 Ga0501070_0941849
1367 Ga0501202_119401
1368 Ga0501235_055428
1369 Ga0501239_048843
1370 Ga0501240_099311
1371 Ga0501242_046985
1372 Ga0501247_027446
1373 Ga0501252_022099
1374 Ga0501262_017290
1375 Ga0501267_021686
1376 Ga0501271_015052
1377 Ga0501273_003927
1378 nmdc:mga0rr50_255140_c1
1379 Ga0495612_0064824
1380 Ga0495655_0012915
1381 Ga0587071_110402
1382 Ga0466962_0003001
1383 Ga0466962_0073558
1384 Ga0466962_0114046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map