F475604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 309 | 1378 | 357 |
Family's Representative Sequence
| Representative Sequence | 3300046665|Ga0495661_0145456|Ga0495661_0145456_20_1171 |
| Length | 383 |
| Sequence | MADARIAFAIATHFLLKKENKKMKAAVLHAPGTSMTIEEVGISKPGPREVLVRTVAVGVCHSDLHFVDGAYPYPMPVVLGHEASGIVEQVGSEVRTVKPGDHVVTCLSAYCGHXXXXVTGHLSLCVSPDTKRRVDEESRLTYVQKPMTQFINLSAYAEQMLVHENALVSIRRDMPLDRAALLGCAVTTGTGAVFNTAKVRPGETVAVIGCGGIGLSTINGAALAGAGRIIAIDMLDSKLELAKQFGATDVVNAKDGSAVAQVLELTRGGVHHAFECIGLKQTAEQAFGMLARGGTATIIGMIKPGVKLELDPMAMLHERRIQGSFMGSNRFPVDLPRLTDFYMQGRLKLDEMISQRIKLEQINEAFDELRRGELARSVIVFDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 118 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 132 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 142 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 143 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 144 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 145 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 146 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 147 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 149 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 150 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 151 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 152 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 153 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 154 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 155 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 156 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 157 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 158 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 159 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 160 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 161 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 162 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 163 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 164 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 167 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 168 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 169 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 170 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 244 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 245 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 248 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 249 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 250 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 258 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 261 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 266 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 267 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 268 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 269 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 270 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 271 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 272 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 273 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 274 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 276 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 277 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 279 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 280 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 281 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 282 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 283 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 284 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 285 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 286 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 287 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 288 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 289 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 290 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 291 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 292 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 293 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 294 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 295 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 296 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 297 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 298 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 299 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 300 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 301 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 302 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 303 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 304 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 305 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 306 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 307 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 308 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 309 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.23 |
| Metatranscriptomes | 0.14 |
| Isolates | 4.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.56 |
| Nodule | 0.29 |
| Rhizoplane | 2.75 |
| Rhizosphere | 78.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495661_0145456 | 3300046665 | Bacteria | 1285 |
| 2 | JGI24739J22299_10022219 | 3300001989 | Bacteria | 2253 |
| 3 | JGI25150J39212_1000932 | 3300002774 | Bacteria | 9468 |
| 4 | JGI25153J46596_10000261 | 3300003215 | Bacteria | 42248 |
| 5 | rootL2_10070872 | 3300003322 | Bacteria | 5749 |
| 6 | rootH1_10164772 | 3300003323 | Bacteria | 1740 |
| 7 | Ga0055526_1002398 | 3300003771 | Bacteria | 12694 |
| 8 | Ga0055537_1000890 | 3300003773 | Bacteria | 14167 |
| 9 | Ga0055537_1003277 | 3300003773 | Bacteria | 5031 |
| 10 | Ga0055524_1000149 | 3300003775 | Bacteria | 82511 |
| 11 | Ga0055530_10000060 | 3300003791 | Bacteria | 95767 |
| 12 | Ga0055530_10026442 | 3300003791 | Bacteria | 1604 |
| 13 | Ga0055540_1000263 | 3300003792 | Bacteria | 47496 |
| 14 | Ga0055531_10000049 | 3300003794 | Bacteria | 130662 |
| 15 | Ga0055531_10005978 | 3300003794 | Bacteria | 6992 |
| 16 | Ga0055531_10018497 | 3300003794 | Bacteria | 2872 |
| 17 | Ga0065165_1001830 | 3300005262 | Bacteria | 20784 |
| 18 | Ga0065165_1004357 | 3300005262 | Bacteria | 8860 |
| 19 | Ga0065165_1013991 | 3300005262 | Bacteria | 3143 |
| 20 | Ga0065704_10070989 | 3300005289 | Bacteria | 13960 |
| 21 | Ga0070658_10231050 | 3300005327 | Bacteria | 1566 |
| 22 | Ga0070676_10000307 | 3300005328 | Bacteria | 22080 |
| 23 | Ga0070670_100000020 | 3300005331 | Bacteria | 215458 |
| 24 | Ga0070666_10082188 | 3300005335 | Bacteria | 2203 |
| 25 | Ga0070668_100000108 | 3300005347 | Bacteria | 50828 |
| 26 | Ga0070668_100008132 | 3300005347 | Bacteria | 7792 |
| 27 | Ga0070669_100010694 | 3300005353 | Bacteria | 6514 |
| 28 | Ga0070671_100003218 | 3300005355 | Bacteria | 12731 |
| 29 | Ga0070673_100099911 | 3300005364 | Bacteria | 2387 |
| 30 | Ga0070667_100000163 | 3300005367 | Bacteria | 83059 |
| 31 | Ga0070667_100012087 | 3300005367 | Bacteria | 7148 |
| 32 | Ga0070667_100059544 | 3300005367 | Bacteria | 3231 |
| 33 | Ga0070711_100003889 | 3300005439 | Bacteria | 8771 |
| 34 | Ga0070708_100285493 | 3300005445 | Bacteria | 1553 |
| 35 | Ga0070706_100004963 | 3300005467 | Bacteria | 12737 |
| 36 | Ga0070698_100102782 | 3300005471 | Bacteria | 2828 |
| 37 | Ga0070672_100019678 | 3300005543 | Bacteria | 4905 |
| 38 | Ga0070672_100308003 | 3300005543 | Bacteria | 1344 |
| 39 | Ga0070665_100005271 | 3300005548 | Bacteria | 13362 |
| 40 | Ga0070665_100010368 | 3300005548 | Bacteria | 9429 |
| 41 | Ga0070704_100030286 | 3300005549 | Bacteria | 3625 |
| 42 | Ga0068856_100124285 | 3300005614 | Bacteria | 2583 |
| 43 | Ga0068852_100000554 | 3300005616 | Bacteria | 24527 |
| 44 | Ga0068864_100000071 | 3300005618 | Bacteria | 111481 |
| 45 | Ga0068864_100000108 | 3300005618 | Bacteria | 80532 |
| 46 | Ga0068851_10009710 | 3300005834 | Bacteria | 4482 |
| 47 | Ga0068863_100000037 | 3300005841 | Bacteria | 162638 |
| 48 | Ga0068863_100001227 | 3300005841 | Bacteria | 25564 |
| 49 | Ga0068858_100000029 | 3300005842 | Bacteria | 144691 |
| 50 | Ga0068858_100001579 | 3300005842 | Bacteria | 23329 |
| 51 | Ga0068858_100055066 | 3300005842 | Bacteria | 3677 |
| 52 | Ga0068860_100000372 | 3300005843 | Bacteria | 58763 |
| 53 | Ga0068860_100001003 | 3300005843 | Bacteria | 31241 |
| 54 | Ga0068860_100033505 | 3300005843 | Bacteria | 4928 |
| 55 | Ga0068860_100347640 | 3300005843 | Bacteria | 1459 |
| 56 | Ga0068862_100000057 | 3300005844 | Bacteria | 140795 |
| 57 | Ga0068862_100061508 | 3300005844 | Bacteria | 3228 |
| 58 | Ga0068862_100199611 | 3300005844 | Bacteria | 1803 |
| 59 | Ga0081539_10002146 | 3300005985 | Bacteria | 29153 |
| 60 | Ga0075365_10033182 | 3300006038 | Bacteria | 3324 |
| 61 | Ga0075363_100044450 | 3300006048 | Bacteria | 2353 |
| 62 | Ga0075364_10070445 | 3300006051 | Bacteria | 2302 |
| 63 | Ga0075432_10000298 | 3300006058 | Bacteria | 13871 |
| 64 | Ga0075432_10003920 | 3300006058 | Bacteria | 5068 |
| 65 | Ga0070712_100001349 | 3300006175 | Bacteria | 14896 |
| 66 | Ga0075362_10000011 | 3300006177 | Bacteria | 108953 |
| 67 | Ga0075367_10006592 | 3300006178 | Bacteria | 5880 |
| 68 | Ga0075367_10074914 | 3300006178 | Bacteria | 2041 |
| 69 | Ga0075369_10000469 | 3300006186 | Bacteria | 12412 |
| 70 | Ga0075366_10001111 | 3300006195 | Bacteria | 13234 |
| 71 | Ga0075366_10091586 | 3300006195 | Bacteria | 1821 |
| 72 | Ga0075370_10000880 | 3300006353 | Bacteria | 12260 |
| 73 | Ga0075370_10089038 | 3300006353 | Bacteria | 1780 |
| 74 | Ga0075428_100029000 | 3300006844 | Bacteria | 6124 |
| 75 | Ga0075431_100009331 | 3300006847 | Bacteria | 9846 |
| 76 | Ga0075429_100000107 | 3300006880 | Bacteria | 47068 |
| 77 | Ga0105244_10000979 | 3300009036 | Bacteria | 23974 |
| 78 | Ga0105244_10001512 | 3300009036 | Bacteria | 18578 |
| 79 | Ga0105244_10013000 | 3300009036 | Bacteria | 4890 |
| 80 | Ga0105250_10012758 | 3300009092 | Bacteria | 3461 |
| 81 | Ga0105245_10232967 | 3300009098 | Bacteria | 1782 |
| 82 | Ga0105243_10095152 | 3300009148 | Bacteria | 2461 |
| 83 | Ga0105243_10129206 | 3300009148 | Bacteria | 2141 |
| 84 | Ga0105248_10013706 | 3300009177 | Bacteria | 8924 |
| 85 | Ga0105248_10014581 | 3300009177 | Bacteria | 8649 |
| 86 | Ga0105248_10238498 | 3300009177 | Bacteria | 2047 |
| 87 | Ga0105237_10011346 | 3300009545 | Bacteria | 9428 |
| 88 | Ga0105237_10085856 | 3300009545 | Bacteria | 3137 |
| 89 | Ga0105249_10024032 | 3300009553 | Bacteria | 5473 |
| 90 | Ga0105239_10214007 | 3300010375 | Bacteria | 2160 |
| 91 | Ga0105239_10531471 | 3300010375 | Unclassified | 1338 |
| 92 | Ga0157373_10194613 | 3300013100 | Bacteria | 1429 |
| 93 | Ga0157370_10010895 | 3300013104 | Bacteria | 9550 |
| 94 | Ga0157370_10014633 | 3300013104 | Bacteria | 8018 |
| 95 | Ga0157370_10052705 | 3300013104 | Bacteria | 3883 |
| 96 | Ga0157378_10028784 | 3300013297 | Bacteria | 4905 |
| 97 | Ga0163162_10253803 | 3300013306 | Bacteria | 1890 |
| 98 | Ga0163163_10123239 | 3300014325 | Bacteria | 2627 |
| 99 | Ga0182008_10001435 | 3300014497 | Bacteria | 15944 |
| 100 | Ga0182008_10004986 | 3300014497 | Bacteria | 7641 |
| 101 | Ga0157379_10018528 | 3300014968 | Bacteria | 6141 |
| 102 | Ga0157379_10073311 | 3300014968 | Bacteria | 3064 |
| 103 | Ga0182005_1004755 | 3300015265 | Bacteria | 4332 |
| 104 | Ga0163161_10008962 | 3300017792 | Bacteria | 6919 |
| 105 | Ga0206353_10993341 | 3300020082 | Bacteria | 1530 |
| 106 | Ga0207425_1000026 | 3300025245 | Bacteria | 301303 |
| 107 | Ga0209129_1015273 | 3300025258 | Bacteria | 1589 |
| 108 | Ga0209565_1000010 | 3300025263 | Bacteria | 687724 |
| 109 | Ga0209565_1000099 | 3300025263 | Bacteria | 131080 |
| 110 | Ga0209673_1004403 | 3300025273 | Bacteria | 7562 |
| 111 | Ga0209675_1003464 | 3300025291 | Bacteria | 7482 |
| 112 | Ga0209676_1003844 | 3300025292 | Bacteria | 8805 |
| 113 | Ga0209025_1000876 | 3300025294 | Bacteria | 47312 |
| 114 | Ga0209564_1001189 | 3300025295 | Bacteria | 29952 |
| 115 | Ga0209564_1014945 | 3300025295 | Bacteria | 3192 |
| 116 | Ga0209564_1023088 | 3300025295 | Bacteria | 2174 |
| 117 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 118 | Ga0209758_1037149 | 3300025297 | Bacteria | 1887 |
| 119 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 120 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 121 | Ga0209050_1000229 | 3300025298 | Bacteria | 123110 |
| 122 | Ga0209050_1001359 | 3300025298 | Bacteria | 26792 |
| 123 | Ga0209050_1007069 | 3300025298 | Bacteria | 6433 |
| 124 | Ga0209256_1000034 | 3300025299 | Bacteria | 388475 |
| 125 | Ga0209051_1000032 | 3300025303 | Bacteria | 383445 |
| 126 | Ga0209051_1002171 | 3300025303 | Bacteria | 14542 |
| 127 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 128 | Ga0209257_1000886 | 3300025304 | Bacteria | 42023 |
| 129 | Ga0209257_1000904 | 3300025304 | Bacteria | 41554 |
| 130 | Ga0209257_1002198 | 3300025304 | Bacteria | 20181 |
| 131 | Ga0209257_1004566 | 3300025304 | Bacteria | 10598 |
| 132 | Ga0209257_1014804 | 3300025304 | Bacteria | 3311 |
| 133 | Ga0207656_10054795 | 3300025321 | Bacteria | 1734 |
| 134 | Ga0207713_1008745 | 3300025735 | Bacteria | 5776 |
| 135 | Ga0207680_10054455 | 3300025903 | Bacteria | 2407 |
| 136 | Ga0207647_10152253 | 3300025904 | Bacteria | 1351 |
| 137 | Ga0207645_10109622 | 3300025907 | Bacteria | 1786 |
| 138 | Ga0207671_10128416 | 3300025914 | Bacteria | 1944 |
| 139 | Ga0207693_10000560 | 3300025915 | Bacteria | 33567 |
| 140 | Ga0207663_10002611 | 3300025916 | Bacteria | 8674 |
| 141 | Ga0207681_10002077 | 3300025923 | Bacteria | 12831 |
| 142 | Ga0207650_10000175 | 3300025925 | Bacteria | 75521 |
| 143 | Ga0207687_10345598 | 3300025927 | Bacteria | 1211 |
| 144 | Ga0207644_10007460 | 3300025931 | Bacteria | 7131 |
| 145 | Ga0207706_10092358 | 3300025933 | Bacteria | 2662 |
| 146 | Ga0207691_10013744 | 3300025940 | Bacteria | 7735 |
| 147 | Ga0207711_10005893 | 3300025941 | Bacteria | 10348 |
| 148 | Ga0207711_10024278 | 3300025941 | Bacteria | 5076 |
| 149 | Ga0207711_10025857 | 3300025941 | Bacteria | 4923 |
| 150 | Ga0207711_10165557 | 3300025941 | Bacteria | 2004 |
| 151 | Ga0207661_10220340 | 3300025944 | Bacteria | 1677 |
| 152 | Ga0207651_10115110 | 3300025960 | Bacteria | 2027 |
| 153 | Ga0207712_10004808 | 3300025961 | Bacteria | 8533 |
| 154 | Ga0207668_10000123 | 3300025972 | Bacteria | 54467 |
| 155 | Ga0207668_10004934 | 3300025972 | Bacteria | 7846 |
| 156 | Ga0207658_10000118 | 3300025986 | Bacteria | 87228 |
| 157 | Ga0207658_10017603 | 3300025986 | Bacteria | 4927 |
| 158 | Ga0207658_10270043 | 3300025986 | Bacteria | 1453 |
| 159 | Ga0207677_10047897 | 3300026023 | Bacteria | 2873 |
| 160 | Ga0207703_10000079 | 3300026035 | Bacteria | 112451 |
| 161 | Ga0207703_10001449 | 3300026035 | Bacteria | 21627 |
| 162 | Ga0207641_10000034 | 3300026088 | Bacteria | 217752 |
| 163 | Ga0207641_10003158 | 3300026088 | Bacteria | 14758 |
| 164 | Ga0207648_10080475 | 3300026089 | Bacteria | 2842 |
| 165 | Ga0207676_10000376 | 3300026095 | Bacteria | 38031 |
| 166 | Ga0207676_10000506 | 3300026095 | Bacteria | 32940 |
| 167 | Ga0207674_10096194 | 3300026116 | Bacteria | 2946 |
| 168 | Ga0207683_10174284 | 3300026121 | Bacteria | 1949 |
| 169 | Ga0207683_10276788 | 3300026121 | Bacteria | 1533 |
| 170 | Ga0207698_10011214 | 3300026142 | Bacteria | 5800 |
| 171 | Ga0207428_10008296 | 3300027907 | Bacteria | 9390 |
| 172 | Ga0207428_10031903 | 3300027907 | Bacteria | 4339 |
| 173 | Ga0207428_10183143 | 3300027907 | Bacteria | 1582 |
| 174 | Ga0268266_10023070 | 3300028379 | Bacteria | 5296 |
| 175 | Ga0268265_10002691 | 3300028380 | Bacteria | 13166 |
| 176 | Ga0268264_10000251 | 3300028381 | Bacteria | 100745 |
| 177 | Ga0268264_10000481 | 3300028381 | Bacteria | 53088 |
| 178 | Ga0268264_10024401 | 3300028381 | Bacteria | 4937 |
| 179 | Ga0265338_10164335 | 3300028800 | Bacteria | 1710 |
| 180 | Ga0265325_10000288 | 3300031241 | Bacteria | 35410 |
| 181 | Ga0265339_10013423 | 3300031249 | Bacteria | 4962 |
| 182 | Ga0265316_10013314 | 3300031344 | Bacteria | 7314 |
| 183 | Ga0265313_10034056 | 3300031595 | Bacteria | 2580 |
| 184 | Ga0307508_10000637 | 3300031616 | Bacteria | 42208 |
| 185 | Ga0265314_10000939 | 3300031711 | Bacteria | 34258 |
| 186 | Ga0307405_10216200 | 3300031731 | Bacteria | 1403 |
| 187 | Ga0307413_10019527 | 3300031824 | Bacteria | 3584 |
| 188 | Ga0307410_10047760 | 3300031852 | Bacteria | 2863 |
| 189 | Ga0307410_10103940 | 3300031852 | Bacteria | 2041 |
| 190 | Ga0307407_10190244 | 3300031903 | Bacteria | 1367 |
| 191 | Ga0307412_10001432 | 3300031911 | Bacteria | 13281 |
| 192 | Ga0307412_10022246 | 3300031911 | Bacteria | 3883 |
| 193 | Ga0307409_100009549 | 3300031995 | Bacteria | 5969 |
| 194 | Ga0307414_10009937 | 3300032004 | Bacteria | 5490 |
| 195 | Ga0307414_10049489 | 3300032004 | Bacteria | 2906 |
| 196 | Ga0307414_10077396 | 3300032004 | Bacteria | 2421 |
| 197 | Ga0307411_10006019 | 3300032005 | Bacteria | 6026 |
| 198 | Ga0307510_10045181 | 3300033180 | Bacteria | 4759 |
| 199 | Ga0373928_0012589 | 3300035084 | Bacteria | 1689 |
| 200 | Ga0373931_0025421 | 3300035691 | Bacteria | 3008 |
| 201 | Ga0373927_0032448 | 3300035695 | Bacteria | 3401 |
| 202 | Ga0373937_0006777 | 3300036401 | Bacteria | 9890 |
| 203 | Ga0373925_0000841 | 3300037068 | Bacteria | 28221 |
| 204 | Ga0395899_0000004 | 3300037312 | Bacteria | 874267 |
| 205 | Ga0436364_1309140 | 3300037853 | Bacteria | 4964 |
| 206 | Ga0395901_0040150 | 3300038443 | Bacteria | 4846 |
| 207 | Ga0436365_0971083 | 3300039437 | Bacteria | 1480 |
| 208 | Ga0436365_1649772 | 3300039437 | Bacteria | 1759 |
| 209 | Ga0436361_0811552 | 3300039447 | Bacteria | 3001 |
| 210 | Ga0439436_0003932 | 3300041404 | Bacteria | 4557 |
| 211 | Ga0439438_000023 | 3300041405 | Bacteria | 101913 |
| 212 | Ga0439438_001844 | 3300041405 | Bacteria | 9277 |
| 213 | Ga0439461_0000514 | 3300041410 | Bacteria | 5601 |
| 214 | Ga0439466_0003413 | 3300041411 | Bacteria | 6165 |
| 215 | Ga0439465_0003949 | 3300041413 | Bacteria | 4835 |
| 216 | Ga0451807_1326718 | 3300041486 | Bacteria | 1247 |
| 217 | Ga0439431_0004152 | 3300041997 | Bacteria | 3178 |
| 218 | Ga0439431_0028098 | 3300041997 | Bacteria | 1384 |
| 219 | Ga0439445_0001179 | 3300042004 | Bacteria | 5607 |
| 220 | Ga0439445_0003116 | 3300042004 | Bacteria | 3716 |
| 221 | Ga0439432_005370 | 3300042006 | Bacteria | 4616 |
| 222 | Ga0439452_000838 | 3300042010 | Bacteria | 14296 |
| 223 | Ga0439462_0001909 | 3300042015 | Bacteria | 4744 |
| 224 | Ga0439462_0004221 | 3300042015 | Bacteria | 3496 |
| 225 | Ga0450911_000229 | 3300042115 | Bacteria | 21702 |
| 226 | Ga0450902_001405 | 3300042137 | Bacteria | 3275 |
| 227 | Ga0450903_000581 | 3300042138 | Bacteria | 7514 |
| 228 | Ga0450907_000002 | 3300042146 | Bacteria | 147876 |
| 229 | Ga0450908_000078 | 3300042184 | Bacteria | 19480 |
| 230 | Ga0450909_003332 | 3300042185 | Bacteria | 2287 |
| 231 | Ga0439434_0000499 | 3300042435 | Bacteria | 11168 |
| 232 | Ga0439460_0000133 | 3300042461 | Bacteria | 13282 |
| 233 | Ga0466972_0060961 | 3300044658 | Bacteria | 1810 |
| 234 | Ga0466965_0014563 | 3300044683 | Bacteria | 3724 |
| 235 | Ga0466966_0001485 | 3300044684 | Bacteria | 15049 |
| 236 | Ga0466966_0052266 | 3300044684 | Bacteria | 2596 |
| 237 | Ga0466963_0031494 | 3300044694 | Bacteria | 3429 |
| 238 | Ga0466957_0139035 | 3300044842 | Bacteria | 1563 |
| 239 | Ga0466960_0027281 | 3300044901 | Bacteria | 2603 |
| 240 | Ga0466959_0067152 | 3300045049 | Bacteria | 2600 |
| 241 | Ga0451576_0099932 | 3300045051 | Bacteria | 3018 |
| 242 | Ga0466958_0024590 | 3300045836 | Bacteria | 3544 |
| 243 | Ga0495617_000188 | 3300046452 | Bacteria | 39074 |
| 244 | Ga0495617_000545 | 3300046452 | Bacteria | 19503 |
| 245 | Ga0495617_001228 | 3300046452 | Bacteria | 11540 |
| 246 | Ga0495617_003270 | 3300046452 | Bacteria | 6142 |
| 247 | Ga0495617_004247 | 3300046452 | Bacteria | 5232 |
| 248 | Ga0495627_000426 | 3300046453 | Bacteria | 36618 |
| 249 | Ga0495627_000755 | 3300046453 | Bacteria | 24099 |
| 250 | Ga0495627_002384 | 3300046453 | Bacteria | 9131 |
| 251 | Ga0495627_004565 | 3300046453 | Bacteria | 5758 |
| 252 | Ga0495590_0023757 | 3300046457 | Bacteria | 2162 |
| 253 | Ga0495590_0038408 | 3300046457 | Bacteria | 1669 |
| 254 | Ga0495591_000005 | 3300046458 | Bacteria | 394092 |
| 255 | Ga0495591_000008 | 3300046458 | Bacteria | 353558 |
| 256 | Ga0495591_000097 | 3300046458 | Bacteria | 99942 |
| 257 | Ga0495591_000274 | 3300046458 | Bacteria | 48317 |
| 258 | Ga0495591_001030 | 3300046458 | Bacteria | 18866 |
| 259 | Ga0495591_001725 | 3300046458 | Bacteria | 13030 |
| 260 | Ga0495591_003074 | 3300046458 | Bacteria | 8842 |
| 261 | Ga0495591_004098 | 3300046458 | Bacteria | 7252 |
| 262 | Ga0495591_020131 | 3300046458 | Bacteria | 2212 |
| 263 | Ga0495591_020724 | 3300046458 | Bacteria | 2164 |
| 264 | Ga0495638_0000337 | 3300046460 | Bacteria | 59070 |
| 265 | Ga0495638_0001830 | 3300046460 | Bacteria | 18455 |
| 266 | Ga0495638_0004926 | 3300046460 | Bacteria | 10033 |
| 267 | Ga0495638_0007584 | 3300046460 | Bacteria | 7762 |
| 268 | Ga0495638_0008868 | 3300046460 | Bacteria | 7098 |
| 269 | Ga0495638_0010476 | 3300046460 | Bacteria | 6430 |
| 270 | Ga0495638_0012747 | 3300046460 | Bacteria | 5746 |
| 271 | Ga0495638_0013565 | 3300046460 | Bacteria | 5539 |
| 272 | Ga0495638_0018253 | 3300046460 | Bacteria | 4661 |
| 273 | Ga0495638_0019102 | 3300046460 | Bacteria | 4538 |
| 274 | Ga0495638_0026156 | 3300046460 | Bacteria | 3786 |
| 275 | Ga0495638_0077742 | 3300046460 | Bacteria | 2020 |
| 276 | Ga0495638_0158099 | 3300046460 | Bacteria | 1309 |
| 277 | Ga0495653_0000563 | 3300046463 | Bacteria | 28409 |
| 278 | Ga0495653_0001300 | 3300046463 | Bacteria | 19344 |
| 279 | Ga0495653_0040376 | 3300046463 | Bacteria | 3646 |
| 280 | Ga0495650_0000114 | 3300046471 | Bacteria | 192527 |
| 281 | Ga0495650_0000730 | 3300046471 | Bacteria | 41230 |
| 282 | Ga0495650_0004057 | 3300046471 | Bacteria | 10251 |
| 283 | Ga0495650_0005869 | 3300046471 | Bacteria | 7813 |
| 284 | Ga0495650_0006551 | 3300046471 | Bacteria | 7238 |
| 285 | Ga0495650_0008397 | 3300046471 | Bacteria | 6034 |
| 286 | Ga0495650_0054410 | 3300046471 | Bacteria | 1633 |
| 287 | Ga0495580_0058350 | 3300046472 | Bacteria | 2715 |
| 288 | Ga0495605_0000172 | 3300046474 | Bacteria | 81898 |
| 289 | Ga0495605_0000515 | 3300046474 | Bacteria | 32943 |
| 290 | Ga0495605_0001196 | 3300046474 | Bacteria | 17290 |
| 291 | Ga0495605_0013761 | 3300046474 | Bacteria | 4446 |
| 292 | Ga0495605_0031432 | 3300046474 | Bacteria | 2712 |
| 293 | Ga0495605_0041636 | 3300046474 | Bacteria | 2287 |
| 294 | Ga0495605_0089677 | 3300046474 | Bacteria | 1426 |
| 295 | Ga0495584_0000292 | 3300046491 | Bacteria | 35381 |
| 296 | Ga0495584_0000665 | 3300046491 | Bacteria | 22873 |
| 297 | Ga0495584_0000803 | 3300046491 | Bacteria | 20648 |
| 298 | Ga0495584_0002825 | 3300046491 | Bacteria | 9691 |
| 299 | Ga0495584_0003289 | 3300046491 | Bacteria | 8952 |
| 300 | Ga0495584_0003300 | 3300046491 | Bacteria | 8938 |
| 301 | Ga0495584_0009988 | 3300046491 | Bacteria | 4872 |
| 302 | Ga0495584_0010216 | 3300046491 | Bacteria | 4821 |
| 303 | Ga0495585_0000012 | 3300046492 | Bacteria | 203064 |
| 304 | Ga0495585_0000066 | 3300046492 | Bacteria | 108675 |
| 305 | Ga0495585_0000589 | 3300046492 | Bacteria | 34040 |
| 306 | Ga0495585_0062300 | 3300046492 | Bacteria | 2049 |
| 307 | Ga0495596_0000005 | 3300046500 | Bacteria | 163644 |
| 308 | Ga0495596_0000010 | 3300046500 | Bacteria | 145028 |
| 309 | Ga0495607_0008935 | 3300046501 | Bacteria | 6820 |
| 310 | Ga0495607_0012308 | 3300046501 | Bacteria | 5655 |
| 311 | Ga0495607_0036169 | 3300046501 | Bacteria | 2978 |
| 312 | Ga0495607_0174038 | 3300046501 | Bacteria | 1084 |
| 313 | Ga0495583_0007142 | 3300046506 | Bacteria | 7111 |
| 314 | Ga0495583_0008478 | 3300046506 | Bacteria | 6276 |
| 315 | Ga0495606_0000499 | 3300046507 | Bacteria | 64051 |
| 316 | Ga0495606_0000653 | 3300046507 | Bacteria | 54596 |
| 317 | Ga0495606_0000970 | 3300046507 | Bacteria | 41968 |
| 318 | Ga0495606_0001214 | 3300046507 | Bacteria | 36152 |
| 319 | Ga0495606_0001532 | 3300046507 | Bacteria | 30561 |
| 320 | Ga0495606_0001572 | 3300046507 | Bacteria | 29941 |
| 321 | Ga0495606_0003390 | 3300046507 | Bacteria | 16940 |
| 322 | Ga0495606_0005270 | 3300046507 | Bacteria | 12461 |
| 323 | Ga0495606_0064632 | 3300046507 | Bacteria | 2327 |
| 324 | Ga0495606_0089646 | 3300046507 | Bacteria | 1894 |
| 325 | Ga0495610_0000360 | 3300046512 | Bacteria | 47556 |
| 326 | Ga0495610_0000559 | 3300046512 | Bacteria | 37264 |
| 327 | Ga0495610_0001335 | 3300046512 | Bacteria | 21880 |
| 328 | Ga0495610_0002312 | 3300046512 | Bacteria | 16106 |
| 329 | Ga0495610_0004605 | 3300046512 | Bacteria | 10104 |
| 330 | Ga0495610_0007582 | 3300046512 | Bacteria | 7185 |
| 331 | Ga0495610_0013192 | 3300046512 | Bacteria | 4922 |
| 332 | Ga0495610_0014016 | 3300046512 | Bacteria | 4734 |
| 333 | Ga0495610_0014362 | 3300046512 | Bacteria | 4654 |
| 334 | Ga0495610_0018369 | 3300046512 | Bacteria | 3953 |
| 335 | Ga0495610_0032583 | 3300046512 | Bacteria | 2705 |
| 336 | Ga0495610_0041394 | 3300046512 | Bacteria | 2313 |
| 337 | Ga0495616_0000320 | 3300046513 | Bacteria | 38359 |
| 338 | Ga0495616_0000714 | 3300046513 | Bacteria | 24619 |
| 339 | Ga0495616_0000740 | 3300046513 | Bacteria | 23933 |
| 340 | Ga0495616_0008585 | 3300046513 | Bacteria | 6034 |
| 341 | Ga0495616_0014687 | 3300046513 | Bacteria | 4376 |
| 342 | Ga0495616_0043270 | 3300046513 | Bacteria | 2288 |
| 343 | Ga0495616_0047919 | 3300046513 | Bacteria | 2149 |
| 344 | Ga0495620_0000155 | 3300046515 | Bacteria | 55845 |
| 345 | Ga0495620_0000179 | 3300046515 | Bacteria | 49534 |
| 346 | Ga0495620_0000329 | 3300046515 | Bacteria | 33346 |
| 347 | Ga0495620_0001804 | 3300046515 | Bacteria | 12591 |
| 348 | Ga0495620_0004208 | 3300046515 | Bacteria | 8140 |
| 349 | Ga0495620_0004443 | 3300046515 | Bacteria | 7906 |
| 350 | Ga0495620_0058122 | 3300046515 | Bacteria | 1620 |
| 351 | Ga0495628_0068386 | 3300046516 | Bacteria | 2772 |
| 352 | Ga0495630_0004158 | 3300046517 | Bacteria | 10140 |
| 353 | Ga0495630_0094239 | 3300046517 | Bacteria | 2263 |
| 354 | Ga0495631_0002367 | 3300046518 | Bacteria | 10725 |
| 355 | Ga0495631_0010365 | 3300046518 | Bacteria | 4613 |
| 356 | Ga0495631_0059735 | 3300046518 | Bacteria | 1655 |
| 357 | Ga0495632_0000686 | 3300046519 | Bacteria | 30903 |
| 358 | Ga0495632_0002236 | 3300046519 | Bacteria | 14936 |
| 359 | Ga0495632_0005230 | 3300046519 | Bacteria | 8648 |
| 360 | Ga0495632_0005488 | 3300046519 | Bacteria | 8377 |
| 361 | Ga0495632_0006300 | 3300046519 | Bacteria | 7660 |
| 362 | Ga0495632_0006449 | 3300046519 | Bacteria | 7542 |
| 363 | Ga0495632_0009190 | 3300046519 | Bacteria | 5975 |
| 364 | Ga0495632_0013730 | 3300046519 | Bacteria | 4608 |
| 365 | Ga0495632_0033092 | 3300046519 | Bacteria | 2657 |
| 366 | Ga0495632_0124800 | 3300046519 | Bacteria | 1200 |
| 367 | Ga0495637_0000177 | 3300046520 | Bacteria | 49357 |
| 368 | Ga0495637_0000316 | 3300046520 | Bacteria | 37501 |
| 369 | Ga0495637_0000339 | 3300046520 | Bacteria | 36219 |
| 370 | Ga0495637_0000432 | 3300046520 | Bacteria | 30590 |
| 371 | Ga0495637_0001196 | 3300046520 | Bacteria | 15799 |
| 372 | Ga0495637_0002519 | 3300046520 | Bacteria | 10102 |
| 373 | Ga0495637_0002636 | 3300046520 | Bacteria | 9821 |
| 374 | Ga0495637_0003987 | 3300046520 | Bacteria | 7711 |
| 375 | Ga0495637_0004902 | 3300046520 | Bacteria | 6891 |
| 376 | Ga0495637_0005789 | 3300046520 | Bacteria | 6261 |
| 377 | Ga0495637_0005856 | 3300046520 | Bacteria | 6218 |
| 378 | Ga0495637_0006621 | 3300046520 | Bacteria | 5797 |
| 379 | Ga0495637_0064507 | 3300046520 | Bacteria | 1493 |
| 380 | Ga0495643_0028516 | 3300046522 | Bacteria | 3128 |
| 381 | Ga0495643_0103817 | 3300046522 | Bacteria | 1453 |
| 382 | Ga0495643_0166293 | 3300046522 | Bacteria | 1081 |
| 383 | Ga0495644_0000079 | 3300046523 | Bacteria | 47868 |
| 384 | Ga0495644_0000593 | 3300046523 | Bacteria | 15175 |
| 385 | Ga0495644_0001095 | 3300046523 | Bacteria | 11199 |
| 386 | Ga0495644_0007983 | 3300046523 | Bacteria | 4071 |
| 387 | Ga0495644_0028802 | 3300046523 | Bacteria | 2100 |
| 388 | Ga0495648_0000617 | 3300046524 | Bacteria | 38067 |
| 389 | Ga0495648_0002420 | 3300046524 | Bacteria | 17298 |
| 390 | Ga0495648_0005170 | 3300046524 | Bacteria | 10918 |
| 391 | Ga0495648_0009518 | 3300046524 | Bacteria | 7509 |
| 392 | Ga0495648_0016107 | 3300046524 | Bacteria | 5395 |
| 393 | Ga0495648_0023568 | 3300046524 | Bacteria | 4211 |
| 394 | Ga0495648_0024271 | 3300046524 | Bacteria | 4134 |
| 395 | Ga0495648_0048649 | 3300046524 | Bacteria | 2608 |
| 396 | Ga0495648_0062876 | 3300046524 | Bacteria | 2196 |
| 397 | Ga0495648_0063232 | 3300046524 | Bacteria | 2186 |
| 398 | Ga0495648_0077863 | 3300046524 | Bacteria | 1898 |
| 399 | Ga0495666_0000020 | 3300046526 | Bacteria | 62268 |
| 400 | Ga0495654_0000082 | 3300046530 | Bacteria | 108599 |
| 401 | Ga0495654_0000188 | 3300046530 | Bacteria | 60499 |
| 402 | Ga0495654_0000425 | 3300046530 | Bacteria | 35742 |
| 403 | Ga0495654_0000902 | 3300046530 | Bacteria | 22183 |
| 404 | Ga0495654_0006848 | 3300046530 | Bacteria | 6430 |
| 405 | Ga0495654_0008865 | 3300046530 | Bacteria | 5530 |
| 406 | Ga0495654_0042885 | 3300046530 | Bacteria | 2243 |
| 407 | Ga0495654_0055404 | 3300046530 | Bacteria | 1919 |
| 408 | Ga0495654_0076002 | 3300046530 | Bacteria | 1583 |
| 409 | Ga0495654_0127511 | 3300046530 | Bacteria | 1145 |
| 410 | Ga0495587_0000089 | 3300046536 | Bacteria | 70764 |
| 411 | Ga0495597_0002527 | 3300046542 | Bacteria | 11487 |
| 412 | Ga0495597_0002589 | 3300046542 | Bacteria | 11306 |
| 413 | Ga0495597_0002792 | 3300046542 | Bacteria | 10733 |
| 414 | Ga0495597_0007198 | 3300046542 | Bacteria | 5673 |
| 415 | Ga0495597_0007213 | 3300046542 | Bacteria | 5665 |
| 416 | Ga0495597_0007536 | 3300046542 | Bacteria | 5519 |
| 417 | Ga0495597_0017074 | 3300046542 | Bacteria | 3420 |
| 418 | Ga0495597_0017510 | 3300046542 | Bacteria | 3370 |
| 419 | Ga0495597_0025070 | 3300046542 | Bacteria | 2747 |
| 420 | Ga0495597_0039164 | 3300046542 | Bacteria | 2123 |
| 421 | Ga0495597_0041217 | 3300046542 | Bacteria | 2063 |
| 422 | Ga0495597_0046537 | 3300046542 | Bacteria | 1922 |
| 423 | Ga0495622_0000006 | 3300046557 | Bacteria | 245799 |
| 424 | Ga0495622_0001229 | 3300046557 | Bacteria | 13147 |
| 425 | Ga0495622_0007087 | 3300046557 | Bacteria | 5208 |
| 426 | Ga0495622_0032506 | 3300046557 | Bacteria | 2436 |
| 427 | Ga0495622_0039427 | 3300046557 | Bacteria | 2200 |
| 428 | Ga0495633_0000200 | 3300046558 | Bacteria | 76743 |
| 429 | Ga0495633_0000495 | 3300046558 | Bacteria | 39682 |
| 430 | Ga0495633_0006240 | 3300046558 | Bacteria | 7116 |
| 431 | Ga0495668_0001265 | 3300046616 | Bacteria | 25178 |
| 432 | Ga0495668_0004558 | 3300046616 | Bacteria | 9758 |
| 433 | Ga0495668_0008150 | 3300046616 | Bacteria | 6585 |
| 434 | Ga0495634_0000246 | 3300046642 | Bacteria | 50962 |
| 435 | Ga0495625_0000431 | 3300046660 | Bacteria | 63019 |
| 436 | Ga0495625_0000700 | 3300046660 | Bacteria | 47645 |
| 437 | Ga0495625_0002183 | 3300046660 | Bacteria | 21712 |
| 438 | Ga0495625_0003394 | 3300046660 | Bacteria | 15945 |
| 439 | Ga0495625_0004862 | 3300046660 | Bacteria | 12529 |
| 440 | Ga0495625_0008594 | 3300046660 | Bacteria | 8690 |
| 441 | Ga0495625_0022187 | 3300046660 | Bacteria | 4871 |
| 442 | Ga0495625_0024260 | 3300046660 | Bacteria | 4617 |
| 443 | Ga0495625_0028477 | 3300046660 | Bacteria | 4189 |
| 444 | Ga0495625_0030171 | 3300046660 | Bacteria | 4048 |
| 445 | Ga0495625_0032250 | 3300046660 | Bacteria | 3887 |
| 446 | Ga0495625_0033875 | 3300046660 | Bacteria | 3773 |
| 447 | Ga0495625_0040834 | 3300046660 | Bacteria | 3381 |
| 448 | Ga0495635_0000105 | 3300046663 | Bacteria | 49982 |
| 449 | Ga0495661_0001398 | 3300046665 | Bacteria | 20262 |
| 450 | Ga0495661_0005040 | 3300046665 | Bacteria | 9429 |
| 451 | Ga0495661_0008335 | 3300046665 | Bacteria | 7176 |
| 452 | Ga0495661_0020171 | 3300046665 | Bacteria | 4357 |
| 453 | Ga0495661_0030190 | 3300046665 | Bacteria | 3453 |
| 454 | Ga0495661_0054793 | 3300046665 | Bacteria | 2393 |
| 455 | Ga0495588_0004889 | 3300046674 | Bacteria | 5942 |
| 456 | Ga0495588_0032607 | 3300046674 | Bacteria | 2626 |
| 457 | Ga0495657_0028250 | 3300046675 | Bacteria | 3948 |
| 458 | Ga0495599_0081740 | 3300046678 | Bacteria | 2018 |
| 459 | Ga0495623_0000414 | 3300046679 | Bacteria | 28073 |
| 460 | Ga0495623_0010875 | 3300046679 | Bacteria | 5891 |
| 461 | Ga0495670_0000004 | 3300046691 | Bacteria | 310086 |
| 462 | Ga0495670_0000519 | 3300046691 | Bacteria | 18194 |
| 463 | Ga0495670_0007125 | 3300046691 | Bacteria | 5503 |
| 464 | Ga0495670_0009811 | 3300046691 | Bacteria | 4707 |
| 465 | Ga0495670_0017799 | 3300046691 | Bacteria | 3500 |
| 466 | Ga0495670_0053641 | 3300046691 | Bacteria | 2019 |
| 467 | Ga0495670_0177230 | 3300046691 | Bacteria | 1124 |
| 468 | Ga0495671_0000536 | 3300046692 | Bacteria | 28671 |
| 469 | Ga0495671_0007283 | 3300046692 | Bacteria | 6316 |
| 470 | Ga0495671_0008633 | 3300046692 | Bacteria | 5721 |
| 471 | Ga0495671_0010513 | 3300046692 | Bacteria | 5123 |
| 472 | Ga0495671_0014245 | 3300046692 | Bacteria | 4284 |
| 473 | Ga0495671_0017500 | 3300046692 | Bacteria | 3815 |
| 474 | Ga0495671_0022914 | 3300046692 | Bacteria | 3266 |
| 475 | Ga0495671_0036240 | 3300046692 | Bacteria | 2499 |
| 476 | Ga0495671_0086246 | 3300046692 | Bacteria | 1538 |
| 477 | Ga0495649_0000039 | 3300046694 | Bacteria | 126399 |
| 478 | Ga0495649_0000509 | 3300046694 | Bacteria | 33271 |
| 479 | Ga0495649_0001708 | 3300046694 | Bacteria | 16282 |
| 480 | Ga0495649_0008947 | 3300046694 | Bacteria | 5987 |
| 481 | Ga0495649_0015322 | 3300046694 | Bacteria | 4365 |
| 482 | Ga0495649_0019187 | 3300046694 | Bacteria | 3842 |
| 483 | Ga0495649_0029881 | 3300046694 | Bacteria | 3011 |
| 484 | Ga0495649_0059184 | 3300046694 | Bacteria | 2063 |
| 485 | Ga0495649_0083312 | 3300046694 | Bacteria | 1708 |
| 486 | Ga0495589_0000393 | 3300046794 | Bacteria | 33530 |
| 487 | Ga0495589_0000506 | 3300046794 | Bacteria | 27602 |
| 488 | Ga0495589_0001055 | 3300046794 | Bacteria | 16589 |
| 489 | Ga0495589_0005330 | 3300046794 | Bacteria | 6788 |
| 490 | Ga0495589_0007729 | 3300046794 | Bacteria | 5625 |
| 491 | Ga0495589_0008096 | 3300046794 | Bacteria | 5494 |
| 492 | Ga0495589_0018759 | 3300046794 | Bacteria | 3546 |
| 493 | Ga0495600_0034828 | 3300046809 | Bacteria | 3269 |
| 494 | Ga0495660_0000475 | 3300046810 | Bacteria | 33348 |
| 495 | Ga0495660_0003913 | 3300046810 | Bacteria | 9105 |
| 496 | Ga0495660_0019912 | 3300046810 | Bacteria | 3848 |
| 497 | Ga0495660_0034579 | 3300046810 | Bacteria | 2827 |
| 498 | Ga0495660_0042388 | 3300046810 | Bacteria | 2515 |
| 499 | Ga0495660_0047519 | 3300046810 | Bacteria | 2349 |
| 500 | Ga0495604_0000143 | 3300047317 | Bacteria | 61592 |
| 501 | Ga0495674_0022172 | 3300047319 | Bacteria | 5858 |
| 502 | Ga0495672_0000238 | 3300047320 | Bacteria | 78000 |
| 503 | Ga0495672_0000746 | 3300047320 | Bacteria | 35662 |
| 504 | Ga0495672_0000888 | 3300047320 | Bacteria | 31445 |
| 505 | Ga0495672_0002515 | 3300047320 | Bacteria | 16756 |
| 506 | Ga0495672_0012422 | 3300047320 | Bacteria | 5942 |
| 507 | Ga0495672_0043433 | 3300047320 | Bacteria | 2703 |
| 508 | Ga0495672_0072981 | 3300047320 | Bacteria | 1936 |
| 509 | Ga0495672_0096128 | 3300047320 | Bacteria | 1616 |
| 510 | Ga0495680_0002451 | 3300047322 | Bacteria | 18987 |
| 511 | Ga0495680_0021402 | 3300047322 | Bacteria | 5415 |
| 512 | Ga0495680_0038888 | 3300047322 | Bacteria | 3799 |
| 513 | Ga0495683_0000065 | 3300047323 | Bacteria | 112239 |
| 514 | Ga0495683_0000205 | 3300047323 | Bacteria | 56156 |
| 515 | Ga0495683_0000882 | 3300047323 | Bacteria | 21171 |
| 516 | Ga0495683_0003091 | 3300047323 | Bacteria | 9758 |
| 517 | Ga0495683_0003630 | 3300047323 | Bacteria | 8956 |
| 518 | Ga0495683_0030742 | 3300047323 | Bacteria | 2738 |
| 519 | Ga0495675_0004919 | 3300047444 | Bacteria | 8136 |
| 520 | Ga0495679_000224 | 3300047446 | Bacteria | 47851 |
| 521 | Ga0495679_000408 | 3300047446 | Bacteria | 32211 |
| 522 | Ga0495679_000961 | 3300047446 | Bacteria | 17845 |
| 523 | Ga0495679_008102 | 3300047446 | Bacteria | 4301 |
| 524 | Ga0495673_0000315 | 3300047469 | Bacteria | 62914 |
| 525 | Ga0495673_0000452 | 3300047469 | Bacteria | 44965 |
| 526 | Ga0495673_0004753 | 3300047469 | Bacteria | 8417 |
| 527 | Ga0495673_0005667 | 3300047469 | Bacteria | 7504 |
| 528 | Ga0495673_0005989 | 3300047469 | Bacteria | 7234 |
| 529 | Ga0495673_0006096 | 3300047469 | Bacteria | 7159 |
| 530 | Ga0495673_0022315 | 3300047469 | Bacteria | 3105 |
| 531 | Ga0495673_0057997 | 3300047469 | Bacteria | 1670 |
| 532 | Ga0495673_0093843 | 3300047469 | Bacteria | 1222 |
| 533 | Ga0495681_0000069 | 3300047470 | Bacteria | 96229 |
| 534 | Ga0495681_0000150 | 3300047470 | Bacteria | 58890 |
| 535 | Ga0495681_0000151 | 3300047470 | Bacteria | 58502 |
| 536 | Ga0495681_0000613 | 3300047470 | Bacteria | 27339 |
| 537 | Ga0495681_0000701 | 3300047470 | Bacteria | 25593 |
| 538 | Ga0495681_0001010 | 3300047470 | Bacteria | 21582 |
| 539 | Ga0495681_0002723 | 3300047470 | Bacteria | 12499 |
| 540 | Ga0495681_0003448 | 3300047470 | Bacteria | 11002 |
| 541 | Ga0495681_0003635 | 3300047470 | Bacteria | 10719 |
| 542 | Ga0495681_0003872 | 3300047470 | Bacteria | 10334 |
| 543 | Ga0495681_0004619 | 3300047470 | Bacteria | 9355 |
| 544 | Ga0495681_0005501 | 3300047470 | Bacteria | 8469 |
| 545 | Ga0495681_0005945 | 3300047470 | Bacteria | 8095 |
| 546 | Ga0495681_0008635 | 3300047470 | Bacteria | 6361 |
| 547 | Ga0495681_0039114 | 3300047470 | Bacteria | 2318 |
| 548 | Ga0495681_0075224 | 3300047470 | Bacteria | 1520 |
| 549 | Ga0495684_0005972 | 3300047471 | Bacteria | 9458 |
| 550 | Ga0495686_0000413 | 3300047472 | Bacteria | 67712 |
| 551 | Ga0495686_0000556 | 3300047472 | Bacteria | 53309 |
| 552 | Ga0495686_0000993 | 3300047472 | Bacteria | 34592 |
| 553 | Ga0495686_0005593 | 3300047472 | Bacteria | 9873 |
| 554 | Ga0495686_0006361 | 3300047472 | Bacteria | 9060 |
| 555 | Ga0495686_0009975 | 3300047472 | Bacteria | 6793 |
| 556 | Ga0495686_0013385 | 3300047472 | Bacteria | 5692 |
| 557 | Ga0495686_0043675 | 3300047472 | Bacteria | 2840 |
| 558 | Ga0495686_0091187 | 3300047472 | Bacteria | 1850 |
| 559 | Ga0495686_0094004 | 3300047472 | Bacteria | 1818 |
| 560 | Ga0495686_0108327 | 3300047472 | Bacteria | 1669 |
| 561 | Ga0495686_0128970 | 3300047472 | Bacteria | 1501 |
| 562 | Ga0495593_0000355 | 3300047673 | Bacteria | 25285 |
| 563 | Ga0495593_0005050 | 3300047673 | Bacteria | 7806 |
| 564 | Ga0495593_0049992 | 3300047673 | Bacteria | 2216 |
| 565 | Ga0495602_0147578 | 3300048088 | Bacteria | 1853 |
| 566 | Ga0495626_0000040 | 3300048091 | Bacteria | 172784 |
| 567 | Ga0495626_0000166 | 3300048091 | Bacteria | 81272 |
| 568 | Ga0495626_0000275 | 3300048091 | Bacteria | 56570 |
| 569 | Ga0495626_0000472 | 3300048091 | Bacteria | 40984 |
| 570 | Ga0495626_0001285 | 3300048091 | Bacteria | 20491 |
| 571 | Ga0496100_0121378 | 3300048903 | Bacteria | 1828 |
| 572 | Ga0496102_0000038 | 3300048905 | Bacteria | 198844 |
| 573 | Ga0496102_0000267 | 3300048905 | Bacteria | 66761 |
| 574 | Ga0496102_0032337 | 3300048905 | Bacteria | 4699 |
| 575 | Ga0496103_0000139 | 3300048906 | Bacteria | 75158 |
| 576 | Ga0496103_0001811 | 3300048906 | Bacteria | 13899 |
| 577 | Ga0496104_0001996 | 3300048907 | Bacteria | 17709 |
| 578 | Ga0496105_0000099 | 3300048908 | Bacteria | 59095 |
| 579 | Ga0496105_0120183 | 3300048908 | Bacteria | 2167 |
| 580 | Ga0496106_0207509 | 3300048909 | Bacteria | 1560 |
| 581 | Ga0496107_0020816 | 3300048910 | Bacteria | 4636 |
| 582 | Ga0496107_0216160 | 3300048910 | Bacteria | 1426 |
| 583 | Ga0496110_0030071 | 3300048913 | Bacteria | 4680 |
| 584 | Ga0496112_0018899 | 3300048915 | Bacteria | 6493 |
| 585 | Ga0496113_0004509 | 3300048916 | Bacteria | 8576 |
| 586 | Ga0496115_0001446 | 3300048918 | Bacteria | 17026 |
| 587 | Ga0496115_0005209 | 3300048918 | Bacteria | 9454 |
| 588 | Ga0496116_0001277 | 3300048919 | Bacteria | 28954 |
| 589 | Ga0496116_0017414 | 3300048919 | Bacteria | 5575 |
| 590 | Ga0496117_0002144 | 3300048920 | Bacteria | 25764 |
| 591 | Ga0496117_0008650 | 3300048920 | Bacteria | 9634 |
| 592 | Ga0496117_0029121 | 3300048920 | Bacteria | 4263 |
| 593 | Ga0496118_0003665 | 3300048921 | Bacteria | 19075 |
| 594 | Ga0496118_0004279 | 3300048921 | Bacteria | 17079 |
| 595 | Ga0496118_0006748 | 3300048921 | Bacteria | 12493 |
| 596 | Ga0496118_0009747 | 3300048921 | Bacteria | 9635 |
| 597 | Ga0496118_0209002 | 3300048921 | Bacteria | 1147 |
| 598 | Ga0496119_0004210 | 3300048922 | Bacteria | 14446 |
| 599 | Ga0496119_0112515 | 3300048922 | Bacteria | 1509 |
| 600 | Ga0496120_0003080 | 3300048923 | Bacteria | 15717 |
| 601 | Ga0496121_0000130 | 3300048924 | Bacteria | 168094 |
| 602 | Ga0496121_0013822 | 3300048924 | Bacteria | 8640 |
| 603 | Ga0496122_0005423 | 3300048925 | Bacteria | 15204 |
| 604 | Ga0496122_0067227 | 3300048925 | Bacteria | 2583 |
| 605 | Ga0496123_0002794 | 3300048926 | Bacteria | 20744 |
| 606 | Ga0496123_0010288 | 3300048926 | Bacteria | 8299 |
| 607 | Ga0496123_0071974 | 3300048926 | Bacteria | 2153 |
| 608 | Ga0496124_0001648 | 3300048927 | Bacteria | 31950 |
| 609 | Ga0496124_0001730 | 3300048927 | Bacteria | 30704 |
| 610 | Ga0496124_0005515 | 3300048927 | Bacteria | 14203 |
| 611 | Ga0496124_0006356 | 3300048927 | Bacteria | 12894 |
| 612 | Ga0496124_0107241 | 3300048927 | Bacteria | 2254 |
| 613 | Ga0496125_0004923 | 3300048928 | Bacteria | 15118 |
| 614 | Ga0496125_0108066 | 3300048928 | Bacteria | 2025 |
| 615 | Ga0496126_0000619 | 3300048929 | Bacteria | 66827 |
| 616 | Ga0495678_009211 | 3300049459 | Bacteria | 4911 |
| 617 | Ga0495678_012517 | 3300049459 | Bacteria | 4019 |
| 618 | Ga0495678_022284 | 3300049459 | Bacteria | 2772 |
| 619 | Ga0495678_038080 | 3300049459 | Bacteria | 1949 |
| 620 | Ga0495678_059421 | 3300049459 | Bacteria | 1441 |
| 621 | Ga0495678_070094 | 3300049459 | Bacteria | 1287 |
| 622 | Ga0495682_0006977 | 3300049460 | Bacteria | 4528 |
| 623 | Ga0495682_0099591 | 3300049460 | Bacteria | 1042 |
| 624 | Ga0501039_0232384 | 3300049575 | Bacteria | 1450 |
| 625 | Ga0501040_0066693 | 3300049576 | Bacteria | 2480 |
| 626 | Ga0501041_0268618 | 3300049577 | Bacteria | 1073 |
| 627 | nmdc:mga03683_3460_c1 | 3300050489 | Bacteria | 5098 |
| 628 | nmdc:mga03683_37_c1 | 3300050489 | Bacteria | 63604 |
| 629 | nmdc:mga00v17_32064_c1 | 3300050491 | Bacteria | 3104 |
| 630 | nmdc:mga0yw44_76997_c1 | 3300050492 | Bacteria | 2083 |
| 631 | nmdc:mga0k408_105697_c1 | 3300050493 | Bacteria | 1662 |
| 632 | nmdc:mga0k408_18_c1 | 3300050493 | Bacteria | 112318 |
| 633 | nmdc:mga0k408_77640_c1 | 3300050493 | Bacteria | 1942 |
| 634 | nmdc:mga07m45_19_c1 | 3300050496 | Bacteria | 133476 |
| 635 | nmdc:mga07m45_81392_c1 | 3300050496 | Bacteria | 1849 |
| 636 | nmdc:mga05p37_1054_c1 | 3300050507 | Bacteria | 31460 |
| 637 | nmdc:mga09592_35606_c1 | 3300050508 | Bacteria | 4168 |
| 638 | nmdc:mga0rr50_1007_c1 | 3300050513 | Bacteria | 15282 |
| 639 | nmdc:mga0sz30_161_c3 | 3300050516 | Bacteria | 13509 |
| 640 | nmdc:mga0sz30_18535_c1 | 3300050516 | Bacteria | 2786 |
| 641 | Ga0500643_013222 | 3300053087 | Bacteria | 2923 |
| 642 | Ga0500643_037122 | 3300053087 | Bacteria | 1453 |
| 643 | Ga0500644_0000272 | 3300053088 | Bacteria | 28888 |
| 644 | Ga0500566_0000708 | 3300053094 | Bacteria | 18770 |
| 645 | Ga0500641_0078494 | 3300053096 | Bacteria | 1398 |
| 646 | Ga0500555_030281 | 3300053103 | Bacteria | 1537 |
| 647 | Ga0500595_005215 | 3300053119 | Bacteria | 5696 |
| 648 | Ga0500595_030671 | 3300053119 | Bacteria | 1809 |
| 649 | Ga0500626_067757 | 3300053128 | Bacteria | 1591 |
| 650 | Ga0500642_0012942 | 3300053130 | Bacteria | 3046 |
| 651 | Ga0500658_0013388 | 3300053134 | Bacteria | 3029 |
| 652 | Ga0500658_0053568 | 3300053134 | Bacteria | 1655 |
| 653 | Ga0500559_0003309 | 3300053136 | Bacteria | 7994 |
| 654 | Ga0500573_0000042 | 3300053140 | Bacteria | 103567 |
| 655 | Ga0500616_0068149 | 3300053153 | Bacteria | 1823 |
| 656 | Ga0500616_0100318 | 3300053153 | Bacteria | 1416 |
| 657 | Ga0530510_0227230 | 3300061734 | Bacteria | 1388 |
| 658 | 2511301488 | 2511231012 | Bacteria | 6738011 |
| 659 | 2511358298 | 2511231021 | Bacteria | 7302637 |
| 660 | 2585146389 | 2582581279 | Bacteria | 4980720 |
| 661 | 2587917548 | 2585428106 | Bacteria | 5179711 |
| 662 | 2600224765 | 2599185359 | Bacteria | 4772316 |
| 663 | 2643845801 | 2643221565 | Bacteria | 6216018 |
| 664 | 2644126494 | 2643221622 | Bacteria | 4212502 |
| 665 | 2644226927 | 2643221640 | Bacteria | 5258820 |
| 666 | 2644233605 | 2643221642 | Bacteria | 5357871 |
| 667 | 2738709878 | 2738541275 | Bacteria | 4830863 |
| 668 | 2738848303 | 2738541301 | Bacteria | 4834102 |
| 669 | 2738864032 | 2738541304 | Bacteria | 4833665 |
| 670 | 2739296550 | 2738543022 | Bacteria | 4835059 |
| 671 | 2739358228 | 2738543033 | Bacteria | 4833336 |
| 672 | 2812331201 | 2811994874 | Bacteria | 5367947 |
| 673 | 2819712958 | 2818991466 | Bacteria | 4748179 |
| 674 | 2834645973 | 2834641062 | Bacteria | 5559922 |
| 675 | 2860345545 | 2860339153 | Bacteria | 6846989 |
| 676 | 2905929834 | 2905926851 | Bacteria | 4423176 |
| 677 | 2919460390 | 2919456309 | Bacteria | 6586567 |
| 678 | 2928101426 | 2928100450 | Bacteria | 4837635 |
| 679 | 2928527496 | 2928526807 | Bacteria | 4760224 |
| 680 | 2928960162 | 2928959182 | Bacteria | 4725774 |
| 681 | 2928969015 | 2928968154 | Bacteria | 4633371 |
| 682 | 2946027314 | 2946024296 | Bacteria | 3508095 |
| 683 | 2946787932 | 2946787523 | Bacteria | 4366789 |
| 684 | 2990064116 | 2990059506 | Bacteria | 9321252 |
| 685 | 3007624728 | 3007619802 | Bacteria | 6411688 |
| 686 | 8003402744 | 8003400568 | Bacteria | 5535898 |
| 687 | 8056128266 | 8056125926 | Bacteria | 6228218 |
| 688 | 8056178243 | 8056177738 | Bacteria | 6748268 |
| 689 | 8056182632 | 8056177738 | Bacteria | 6748268 |
| 690 | Ga0495661_0145456 | |||
| 691 | JGI24739J22299_10022219 | |||
| 692 | JGI25150J39212_1000932 | |||
| 693 | JGI25153J46596_10000261 | |||
| 694 | rootL2_10070872 | |||
| 695 | rootH1_10164772 | |||
| 696 | Ga0055526_1002398 | |||
| 697 | Ga0055537_1000890 | |||
| 698 | Ga0055537_1003277 | |||
| 699 | Ga0055524_1000149 | |||
| 700 | Ga0055530_10000060 | |||
| 701 | Ga0055530_10026442 | |||
| 702 | Ga0055540_1000263 | |||
| 703 | Ga0055531_10000049 | |||
| 704 | Ga0055531_10005978 | |||
| 705 | Ga0055531_10018497 | |||
| 706 | Ga0065165_1001830 | |||
| 707 | Ga0065165_1004357 | |||
| 708 | Ga0065165_1013991 | |||
| 709 | Ga0065704_10070989 | |||
| 710 | Ga0070658_10231050 | |||
| 711 | Ga0070676_10000307 | |||
| 712 | Ga0070670_100000020 | |||
| 713 | Ga0070666_10082188 | |||
| 714 | Ga0070668_100000108 | |||
| 715 | Ga0070668_100008132 | |||
| 716 | Ga0070669_100010694 | |||
| 717 | Ga0070671_100003218 | |||
| 718 | Ga0070673_100099911 | |||
| 719 | Ga0070667_100000163 | |||
| 720 | Ga0070667_100012087 | |||
| 721 | Ga0070667_100059544 | |||
| 722 | Ga0070711_100003889 | |||
| 723 | Ga0070708_100285493 | |||
| 724 | Ga0070706_100004963 | |||
| 725 | Ga0070698_100102782 | |||
| 726 | Ga0070672_100019678 | |||
| 727 | Ga0070672_100308003 | |||
| 728 | Ga0070665_100005271 | |||
| 729 | Ga0070665_100010368 | |||
| 730 | Ga0070704_100030286 | |||
| 731 | Ga0068856_100124285 | |||
| 732 | Ga0068852_100000554 | |||
| 733 | Ga0068864_100000071 | |||
| 734 | Ga0068864_100000108 | |||
| 735 | Ga0068851_10009710 | |||
| 736 | Ga0068863_100000037 | |||
| 737 | Ga0068863_100001227 | |||
| 738 | Ga0068858_100000029 | |||
| 739 | Ga0068858_100001579 | |||
| 740 | Ga0068858_100055066 | |||
| 741 | Ga0068860_100000372 | |||
| 742 | Ga0068860_100001003 | |||
| 743 | Ga0068860_100033505 | |||
| 744 | Ga0068860_100347640 | |||
| 745 | Ga0068862_100000057 | |||
| 746 | Ga0068862_100061508 | |||
| 747 | Ga0068862_100199611 | |||
| 748 | Ga0081539_10002146 | |||
| 749 | Ga0075365_10033182 | |||
| 750 | Ga0075363_100044450 | |||
| 751 | Ga0075364_10070445 | |||
| 752 | Ga0075432_10000298 | |||
| 753 | Ga0075432_10003920 | |||
| 754 | Ga0070712_100001349 | |||
| 755 | Ga0075362_10000011 | |||
| 756 | Ga0075367_10006592 | |||
| 757 | Ga0075367_10074914 | |||
| 758 | Ga0075369_10000469 | |||
| 759 | Ga0075366_10001111 | |||
| 760 | Ga0075366_10091586 | |||
| 761 | Ga0075370_10000880 | |||
| 762 | Ga0075370_10089038 | |||
| 763 | Ga0075428_100029000 | |||
| 764 | Ga0075431_100009331 | |||
| 765 | Ga0075429_100000107 | |||
| 766 | Ga0105244_10000979 | |||
| 767 | Ga0105244_10001512 | |||
| 768 | Ga0105244_10013000 | |||
| 769 | Ga0105250_10012758 | |||
| 770 | Ga0105245_10232967 | |||
| 771 | Ga0105243_10095152 | |||
| 772 | Ga0105243_10129206 | |||
| 773 | Ga0105248_10013706 | |||
| 774 | Ga0105248_10014581 | |||
| 775 | Ga0105248_10238498 | |||
| 776 | Ga0105237_10011346 | |||
| 777 | Ga0105237_10085856 | |||
| 778 | Ga0105249_10024032 | |||
| 779 | Ga0105239_10214007 | |||
| 780 | Ga0105239_10531471 | |||
| 781 | Ga0157373_10194613 | |||
| 782 | Ga0157370_10010895 | |||
| 783 | Ga0157370_10014633 | |||
| 784 | Ga0157370_10052705 | |||
| 785 | Ga0157378_10028784 | |||
| 786 | Ga0163162_10253803 | |||
| 787 | Ga0163163_10123239 | |||
| 788 | Ga0182008_10001435 | |||
| 789 | Ga0182008_10004986 | |||
| 790 | Ga0157379_10018528 | |||
| 791 | Ga0157379_10073311 | |||
| 792 | Ga0182005_1004755 | |||
| 793 | Ga0163161_10008962 | |||
| 794 | Ga0206353_10993341 | |||
| 795 | Ga0207425_1000026 | |||
| 796 | Ga0209129_1015273 | |||
| 797 | Ga0209565_1000010 | |||
| 798 | Ga0209565_1000099 | |||
| 799 | Ga0209673_1004403 | |||
| 800 | Ga0209675_1003464 | |||
| 801 | Ga0209676_1003844 | |||
| 802 | Ga0209025_1000876 | |||
| 803 | Ga0209564_1001189 | |||
| 804 | Ga0209564_1014945 | |||
| 805 | Ga0209564_1023088 | |||
| 806 | Ga0209758_1000004 | |||
| 807 | Ga0209758_1037149 | |||
| 808 | Ga0209050_1000001 | |||
| 809 | Ga0209050_1000010 | |||
| 810 | Ga0209050_1000229 | |||
| 811 | Ga0209050_1001359 | |||
| 812 | Ga0209050_1007069 | |||
| 813 | Ga0209256_1000034 | |||
| 814 | Ga0209051_1000032 | |||
| 815 | Ga0209051_1002171 | |||
| 816 | Ga0209257_1000009 | |||
| 817 | Ga0209257_1000886 | |||
| 818 | Ga0209257_1000904 | |||
| 819 | Ga0209257_1002198 | |||
| 820 | Ga0209257_1004566 | |||
| 821 | Ga0209257_1014804 | |||
| 822 | Ga0207656_10054795 | |||
| 823 | Ga0207713_1008745 | |||
| 824 | Ga0207680_10054455 | |||
| 825 | Ga0207647_10152253 | |||
| 826 | Ga0207645_10109622 | |||
| 827 | Ga0207671_10128416 | |||
| 828 | Ga0207693_10000560 | |||
| 829 | Ga0207663_10002611 | |||
| 830 | Ga0207681_10002077 | |||
| 831 | Ga0207650_10000175 | |||
| 832 | Ga0207687_10345598 | |||
| 833 | Ga0207644_10007460 | |||
| 834 | Ga0207706_10092358 | |||
| 835 | Ga0207691_10013744 | |||
| 836 | Ga0207711_10005893 | |||
| 837 | Ga0207711_10024278 | |||
| 838 | Ga0207711_10025857 | |||
| 839 | Ga0207711_10165557 | |||
| 840 | Ga0207661_10220340 | |||
| 841 | Ga0207651_10115110 | |||
| 842 | Ga0207712_10004808 | |||
| 843 | Ga0207668_10000123 | |||
| 844 | Ga0207668_10004934 | |||
| 845 | Ga0207658_10000118 | |||
| 846 | Ga0207658_10017603 | |||
| 847 | Ga0207658_10270043 | |||
| 848 | Ga0207677_10047897 | |||
| 849 | Ga0207703_10000079 | |||
| 850 | Ga0207703_10001449 | |||
| 851 | Ga0207641_10000034 | |||
| 852 | Ga0207641_10003158 | |||
| 853 | Ga0207648_10080475 | |||
| 854 | Ga0207676_10000376 | |||
| 855 | Ga0207676_10000506 | |||
| 856 | Ga0207674_10096194 | |||
| 857 | Ga0207683_10174284 | |||
| 858 | Ga0207683_10276788 | |||
| 859 | Ga0207698_10011214 | |||
| 860 | Ga0207428_10008296 | |||
| 861 | Ga0207428_10031903 | |||
| 862 | Ga0207428_10183143 | |||
| 863 | Ga0268266_10023070 | |||
| 864 | Ga0268265_10002691 | |||
| 865 | Ga0268264_10000251 | |||
| 866 | Ga0268264_10000481 | |||
| 867 | Ga0268264_10024401 | |||
| 868 | Ga0265338_10164335 | |||
| 869 | Ga0265325_10000288 | |||
| 870 | Ga0265339_10013423 | |||
| 871 | Ga0265316_10013314 | |||
| 872 | Ga0265313_10034056 | |||
| 873 | Ga0307508_10000637 | |||
| 874 | Ga0265314_10000939 | |||
| 875 | Ga0307405_10216200 | |||
| 876 | Ga0307413_10019527 | |||
| 877 | Ga0307410_10047760 | |||
| 878 | Ga0307410_10103940 | |||
| 879 | Ga0307407_10190244 | |||
| 880 | Ga0307412_10001432 | |||
| 881 | Ga0307412_10022246 | |||
| 882 | Ga0307409_100009549 | |||
| 883 | Ga0307414_10009937 | |||
| 884 | Ga0307414_10049489 | |||
| 885 | Ga0307414_10077396 | |||
| 886 | Ga0307411_10006019 | |||
| 887 | Ga0307510_10045181 | |||
| 888 | Ga0373928_0012589 | |||
| 889 | Ga0373931_0025421 | |||
| 890 | Ga0373927_0032448 | |||
| 891 | Ga0373937_0006777 | |||
| 892 | Ga0373925_0000841 | |||
| 893 | Ga0395899_0000004 | |||
| 894 | Ga0436364_1309140 | |||
| 895 | Ga0395901_0040150 | |||
| 896 | Ga0436365_0971083 | |||
| 897 | Ga0436365_1649772 | |||
| 898 | Ga0436361_0811552 | |||
| 899 | Ga0439436_0003932 | |||
| 900 | Ga0439438_000023 | |||
| 901 | Ga0439438_001844 | |||
| 902 | Ga0439461_0000514 | |||
| 903 | Ga0439466_0003413 | |||
| 904 | Ga0439465_0003949 | |||
| 905 | Ga0451807_1326718 | |||
| 906 | Ga0439431_0004152 | |||
| 907 | Ga0439431_0028098 | |||
| 908 | Ga0439445_0001179 | |||
| 909 | Ga0439445_0003116 | |||
| 910 | Ga0439432_005370 | |||
| 911 | Ga0439452_000838 | |||
| 912 | Ga0439462_0001909 | |||
| 913 | Ga0439462_0004221 | |||
| 914 | Ga0450911_000229 | |||
| 915 | Ga0450902_001405 | |||
| 916 | Ga0450903_000581 | |||
| 917 | Ga0450907_000002 | |||
| 918 | Ga0450908_000078 | |||
| 919 | Ga0450909_003332 | |||
| 920 | Ga0439434_0000499 | |||
| 921 | Ga0439460_0000133 | |||
| 922 | Ga0466972_0060961 | |||
| 923 | Ga0466965_0014563 | |||
| 924 | Ga0466966_0001485 | |||
| 925 | Ga0466966_0052266 | |||
| 926 | Ga0466963_0031494 | |||
| 927 | Ga0466957_0139035 | |||
| 928 | Ga0466960_0027281 | |||
| 929 | Ga0466959_0067152 | |||
| 930 | Ga0451576_0099932 | |||
| 931 | Ga0466958_0024590 | |||
| 932 | Ga0495617_000188 | |||
| 933 | Ga0495617_000545 | |||
| 934 | Ga0495617_001228 | |||
| 935 | Ga0495617_003270 | |||
| 936 | Ga0495617_004247 | |||
| 937 | Ga0495627_000426 | |||
| 938 | Ga0495627_000755 | |||
| 939 | Ga0495627_002384 | |||
| 940 | Ga0495627_004565 | |||
| 941 | Ga0495590_0023757 | |||
| 942 | Ga0495590_0038408 | |||
| 943 | Ga0495591_000005 | |||
| 944 | Ga0495591_000008 | |||
| 945 | Ga0495591_000097 | |||
| 946 | Ga0495591_000274 | |||
| 947 | Ga0495591_001030 | |||
| 948 | Ga0495591_001725 | |||
| 949 | Ga0495591_003074 | |||
| 950 | Ga0495591_004098 | |||
| 951 | Ga0495591_020131 | |||
| 952 | Ga0495591_020724 | |||
| 953 | Ga0495638_0000337 | |||
| 954 | Ga0495638_0001830 | |||
| 955 | Ga0495638_0004926 | |||
| 956 | Ga0495638_0007584 | |||
| 957 | Ga0495638_0008868 | |||
| 958 | Ga0495638_0010476 | |||
| 959 | Ga0495638_0012747 | |||
| 960 | Ga0495638_0013565 | |||
| 961 | Ga0495638_0018253 | |||
| 962 | Ga0495638_0019102 | |||
| 963 | Ga0495638_0026156 | |||
| 964 | Ga0495638_0077742 | |||
| 965 | Ga0495638_0158099 | |||
| 966 | Ga0495653_0000563 | |||
| 967 | Ga0495653_0001300 | |||
| 968 | Ga0495653_0040376 | |||
| 969 | Ga0495650_0000114 | |||
| 970 | Ga0495650_0000730 | |||
| 971 | Ga0495650_0004057 | |||
| 972 | Ga0495650_0005869 | |||
| 973 | Ga0495650_0006551 | |||
| 974 | Ga0495650_0008397 | |||
| 975 | Ga0495650_0054410 | |||
| 976 | Ga0495580_0058350 | |||
| 977 | Ga0495605_0000172 | |||
| 978 | Ga0495605_0000515 | |||
| 979 | Ga0495605_0001196 | |||
| 980 | Ga0495605_0013761 | |||
| 981 | Ga0495605_0031432 | |||
| 982 | Ga0495605_0041636 | |||
| 983 | Ga0495605_0089677 | |||
| 984 | Ga0495584_0000292 | |||
| 985 | Ga0495584_0000665 | |||
| 986 | Ga0495584_0000803 | |||
| 987 | Ga0495584_0002825 | |||
| 988 | Ga0495584_0003289 | |||
| 989 | Ga0495584_0003300 | |||
| 990 | Ga0495584_0009988 | |||
| 991 | Ga0495584_0010216 | |||
| 992 | Ga0495585_0000012 | |||
| 993 | Ga0495585_0000066 | |||
| 994 | Ga0495585_0000589 | |||
| 995 | Ga0495585_0062300 | |||
| 996 | Ga0495596_0000005 | |||
| 997 | Ga0495596_0000010 | |||
| 998 | Ga0495607_0008935 | |||
| 999 | Ga0495607_0012308 | |||
| 1000 | Ga0495607_0036169 | |||
| 1001 | Ga0495607_0174038 | |||
| 1002 | Ga0495583_0007142 | |||
| 1003 | Ga0495583_0008478 | |||
| 1004 | Ga0495606_0000499 | |||
| 1005 | Ga0495606_0000653 | |||
| 1006 | Ga0495606_0000970 | |||
| 1007 | Ga0495606_0001214 | |||
| 1008 | Ga0495606_0001532 | |||
| 1009 | Ga0495606_0001572 | |||
| 1010 | Ga0495606_0003390 | |||
| 1011 | Ga0495606_0005270 | |||
| 1012 | Ga0495606_0064632 | |||
| 1013 | Ga0495606_0089646 | |||
| 1014 | Ga0495610_0000360 | |||
| 1015 | Ga0495610_0000559 | |||
| 1016 | Ga0495610_0001335 | |||
| 1017 | Ga0495610_0002312 | |||
| 1018 | Ga0495610_0004605 | |||
| 1019 | Ga0495610_0007582 | |||
| 1020 | Ga0495610_0013192 | |||
| 1021 | Ga0495610_0014016 | |||
| 1022 | Ga0495610_0014362 | |||
| 1023 | Ga0495610_0018369 | |||
| 1024 | Ga0495610_0032583 | |||
| 1025 | Ga0495610_0041394 | |||
| 1026 | Ga0495616_0000320 | |||
| 1027 | Ga0495616_0000714 | |||
| 1028 | Ga0495616_0000740 | |||
| 1029 | Ga0495616_0008585 | |||
| 1030 | Ga0495616_0014687 | |||
| 1031 | Ga0495616_0043270 | |||
| 1032 | Ga0495616_0047919 | |||
| 1033 | Ga0495620_0000155 | |||
| 1034 | Ga0495620_0000179 | |||
| 1035 | Ga0495620_0000329 | |||
| 1036 | Ga0495620_0001804 | |||
| 1037 | Ga0495620_0004208 | |||
| 1038 | Ga0495620_0004443 | |||
| 1039 | Ga0495620_0058122 | |||
| 1040 | Ga0495628_0068386 | |||
| 1041 | Ga0495630_0004158 | |||
| 1042 | Ga0495630_0094239 | |||
| 1043 | Ga0495631_0002367 | |||
| 1044 | Ga0495631_0010365 | |||
| 1045 | Ga0495631_0059735 | |||
| 1046 | Ga0495632_0000686 | |||
| 1047 | Ga0495632_0002236 | |||
| 1048 | Ga0495632_0005230 | |||
| 1049 | Ga0495632_0005488 | |||
| 1050 | Ga0495632_0006300 | |||
| 1051 | Ga0495632_0006449 | |||
| 1052 | Ga0495632_0009190 | |||
| 1053 | Ga0495632_0013730 | |||
| 1054 | Ga0495632_0033092 | |||
| 1055 | Ga0495632_0124800 | |||
| 1056 | Ga0495637_0000177 | |||
| 1057 | Ga0495637_0000316 | |||
| 1058 | Ga0495637_0000339 | |||
| 1059 | Ga0495637_0000432 | |||
| 1060 | Ga0495637_0001196 | |||
| 1061 | Ga0495637_0002519 | |||
| 1062 | Ga0495637_0002636 | |||
| 1063 | Ga0495637_0003987 | |||
| 1064 | Ga0495637_0004902 | |||
| 1065 | Ga0495637_0005789 | |||
| 1066 | Ga0495637_0005856 | |||
| 1067 | Ga0495637_0006621 | |||
| 1068 | Ga0495637_0064507 | |||
| 1069 | Ga0495643_0028516 | |||
| 1070 | Ga0495643_0103817 | |||
| 1071 | Ga0495643_0166293 | |||
| 1072 | Ga0495644_0000079 | |||
| 1073 | Ga0495644_0000593 | |||
| 1074 | Ga0495644_0001095 | |||
| 1075 | Ga0495644_0007983 | |||
| 1076 | Ga0495644_0028802 | |||
| 1077 | Ga0495648_0000617 | |||
| 1078 | Ga0495648_0002420 | |||
| 1079 | Ga0495648_0005170 | |||
| 1080 | Ga0495648_0009518 | |||
| 1081 | Ga0495648_0016107 | |||
| 1082 | Ga0495648_0023568 | |||
| 1083 | Ga0495648_0024271 | |||
| 1084 | Ga0495648_0048649 | |||
| 1085 | Ga0495648_0062876 | |||
| 1086 | Ga0495648_0063232 | |||
| 1087 | Ga0495648_0077863 | |||
| 1088 | Ga0495666_0000020 | |||
| 1089 | Ga0495654_0000082 | |||
| 1090 | Ga0495654_0000188 | |||
| 1091 | Ga0495654_0000425 | |||
| 1092 | Ga0495654_0000902 | |||
| 1093 | Ga0495654_0006848 | |||
| 1094 | Ga0495654_0008865 | |||
| 1095 | Ga0495654_0042885 | |||
| 1096 | Ga0495654_0055404 | |||
| 1097 | Ga0495654_0076002 | |||
| 1098 | Ga0495654_0127511 | |||
| 1099 | Ga0495587_0000089 | |||
| 1100 | Ga0495597_0002527 | |||
| 1101 | Ga0495597_0002589 | |||
| 1102 | Ga0495597_0002792 | |||
| 1103 | Ga0495597_0007198 | |||
| 1104 | Ga0495597_0007213 | |||
| 1105 | Ga0495597_0007536 | |||
| 1106 | Ga0495597_0017074 | |||
| 1107 | Ga0495597_0017510 | |||
| 1108 | Ga0495597_0025070 | |||
| 1109 | Ga0495597_0039164 | |||
| 1110 | Ga0495597_0041217 | |||
| 1111 | Ga0495597_0046537 | |||
| 1112 | Ga0495622_0000006 | |||
| 1113 | Ga0495622_0001229 | |||
| 1114 | Ga0495622_0007087 | |||
| 1115 | Ga0495622_0032506 | |||
| 1116 | Ga0495622_0039427 | |||
| 1117 | Ga0495633_0000200 | |||
| 1118 | Ga0495633_0000495 | |||
| 1119 | Ga0495633_0006240 | |||
| 1120 | Ga0495668_0001265 | |||
| 1121 | Ga0495668_0004558 | |||
| 1122 | Ga0495668_0008150 | |||
| 1123 | Ga0495634_0000246 | |||
| 1124 | Ga0495625_0000431 | |||
| 1125 | Ga0495625_0000700 | |||
| 1126 | Ga0495625_0002183 | |||
| 1127 | Ga0495625_0003394 | |||
| 1128 | Ga0495625_0004862 | |||
| 1129 | Ga0495625_0008594 | |||
| 1130 | Ga0495625_0022187 | |||
| 1131 | Ga0495625_0024260 | |||
| 1132 | Ga0495625_0028477 | |||
| 1133 | Ga0495625_0030171 | |||
| 1134 | Ga0495625_0032250 | |||
| 1135 | Ga0495625_0033875 | |||
| 1136 | Ga0495625_0040834 | |||
| 1137 | Ga0495635_0000105 | |||
| 1138 | Ga0495661_0001398 | |||
| 1139 | Ga0495661_0005040 | |||
| 1140 | Ga0495661_0008335 | |||
| 1141 | Ga0495661_0020171 | |||
| 1142 | Ga0495661_0030190 | |||
| 1143 | Ga0495661_0054793 | |||
| 1144 | Ga0495588_0004889 | |||
| 1145 | Ga0495588_0032607 | |||
| 1146 | Ga0495657_0028250 | |||
| 1147 | Ga0495599_0081740 | |||
| 1148 | Ga0495623_0000414 | |||
| 1149 | Ga0495623_0010875 | |||
| 1150 | Ga0495670_0000004 | |||
| 1151 | Ga0495670_0000519 | |||
| 1152 | Ga0495670_0007125 | |||
| 1153 | Ga0495670_0009811 | |||
| 1154 | Ga0495670_0017799 | |||
| 1155 | Ga0495670_0053641 | |||
| 1156 | Ga0495670_0177230 | |||
| 1157 | Ga0495671_0000536 | |||
| 1158 | Ga0495671_0007283 | |||
| 1159 | Ga0495671_0008633 | |||
| 1160 | Ga0495671_0010513 | |||
| 1161 | Ga0495671_0014245 | |||
| 1162 | Ga0495671_0017500 | |||
| 1163 | Ga0495671_0022914 | |||
| 1164 | Ga0495671_0036240 | |||
| 1165 | Ga0495671_0086246 | |||
| 1166 | Ga0495649_0000039 | |||
| 1167 | Ga0495649_0000509 | |||
| 1168 | Ga0495649_0001708 | |||
| 1169 | Ga0495649_0008947 | |||
| 1170 | Ga0495649_0015322 | |||
| 1171 | Ga0495649_0019187 | |||
| 1172 | Ga0495649_0029881 | |||
| 1173 | Ga0495649_0059184 | |||
| 1174 | Ga0495649_0083312 | |||
| 1175 | Ga0495589_0000393 | |||
| 1176 | Ga0495589_0000506 | |||
| 1177 | Ga0495589_0001055 | |||
| 1178 | Ga0495589_0005330 | |||
| 1179 | Ga0495589_0007729 | |||
| 1180 | Ga0495589_0008096 | |||
| 1181 | Ga0495589_0018759 | |||
| 1182 | Ga0495600_0034828 | |||
| 1183 | Ga0495660_0000475 | |||
| 1184 | Ga0495660_0003913 | |||
| 1185 | Ga0495660_0019912 | |||
| 1186 | Ga0495660_0034579 | |||
| 1187 | Ga0495660_0042388 | |||
| 1188 | Ga0495660_0047519 | |||
| 1189 | Ga0495604_0000143 | |||
| 1190 | Ga0495674_0022172 | |||
| 1191 | Ga0495672_0000238 | |||
| 1192 | Ga0495672_0000746 | |||
| 1193 | Ga0495672_0000888 | |||
| 1194 | Ga0495672_0002515 | |||
| 1195 | Ga0495672_0012422 | |||
| 1196 | Ga0495672_0043433 | |||
| 1197 | Ga0495672_0072981 | |||
| 1198 | Ga0495672_0096128 | |||
| 1199 | Ga0495680_0002451 | |||
| 1200 | Ga0495680_0021402 | |||
| 1201 | Ga0495680_0038888 | |||
| 1202 | Ga0495683_0000065 | |||
| 1203 | Ga0495683_0000205 | |||
| 1204 | Ga0495683_0000882 | |||
| 1205 | Ga0495683_0003091 | |||
| 1206 | Ga0495683_0003630 | |||
| 1207 | Ga0495683_0030742 | |||
| 1208 | Ga0495675_0004919 | |||
| 1209 | Ga0495679_000224 | |||
| 1210 | Ga0495679_000408 | |||
| 1211 | Ga0495679_000961 | |||
| 1212 | Ga0495679_008102 | |||
| 1213 | Ga0495673_0000315 | |||
| 1214 | Ga0495673_0000452 | |||
| 1215 | Ga0495673_0004753 | |||
| 1216 | Ga0495673_0005667 | |||
| 1217 | Ga0495673_0005989 | |||
| 1218 | Ga0495673_0006096 | |||
| 1219 | Ga0495673_0022315 | |||
| 1220 | Ga0495673_0057997 | |||
| 1221 | Ga0495673_0093843 | |||
| 1222 | Ga0495681_0000069 | |||
| 1223 | Ga0495681_0000150 | |||
| 1224 | Ga0495681_0000151 | |||
| 1225 | Ga0495681_0000613 | |||
| 1226 | Ga0495681_0000701 | |||
| 1227 | Ga0495681_0001010 | |||
| 1228 | Ga0495681_0002723 | |||
| 1229 | Ga0495681_0003448 | |||
| 1230 | Ga0495681_0003635 | |||
| 1231 | Ga0495681_0003872 | |||
| 1232 | Ga0495681_0004619 | |||
| 1233 | Ga0495681_0005501 | |||
| 1234 | Ga0495681_0005945 | |||
| 1235 | Ga0495681_0008635 | |||
| 1236 | Ga0495681_0039114 | |||
| 1237 | Ga0495681_0075224 | |||
| 1238 | Ga0495684_0005972 | |||
| 1239 | Ga0495686_0000413 | |||
| 1240 | Ga0495686_0000556 | |||
| 1241 | Ga0495686_0000993 | |||
| 1242 | Ga0495686_0005593 | |||
| 1243 | Ga0495686_0006361 | |||
| 1244 | Ga0495686_0009975 | |||
| 1245 | Ga0495686_0013385 | |||
| 1246 | Ga0495686_0043675 | |||
| 1247 | Ga0495686_0091187 | |||
| 1248 | Ga0495686_0094004 | |||
| 1249 | Ga0495686_0108327 | |||
| 1250 | Ga0495686_0128970 | |||
| 1251 | Ga0495593_0000355 | |||
| 1252 | Ga0495593_0005050 | |||
| 1253 | Ga0495593_0049992 | |||
| 1254 | Ga0495602_0147578 | |||
| 1255 | Ga0495626_0000040 | |||
| 1256 | Ga0495626_0000166 | |||
| 1257 | Ga0495626_0000275 | |||
| 1258 | Ga0495626_0000472 | |||
| 1259 | Ga0495626_0001285 | |||
| 1260 | Ga0496100_0121378 | |||
| 1261 | Ga0496102_0000038 | |||
| 1262 | Ga0496102_0000267 | |||
| 1263 | Ga0496102_0032337 | |||
| 1264 | Ga0496103_0000139 | |||
| 1265 | Ga0496103_0001811 | |||
| 1266 | Ga0496104_0001996 | |||
| 1267 | Ga0496105_0000099 | |||
| 1268 | Ga0496105_0120183 | |||
| 1269 | Ga0496106_0207509 | |||
| 1270 | Ga0496107_0020816 | |||
| 1271 | Ga0496107_0216160 | |||
| 1272 | Ga0496110_0030071 | |||
| 1273 | Ga0496112_0018899 | |||
| 1274 | Ga0496113_0004509 | |||
| 1275 | Ga0496115_0001446 | |||
| 1276 | Ga0496115_0005209 | |||
| 1277 | Ga0496116_0001277 | |||
| 1278 | Ga0496116_0017414 | |||
| 1279 | Ga0496117_0002144 | |||
| 1280 | Ga0496117_0008650 | |||
| 1281 | Ga0496117_0029121 | |||
| 1282 | Ga0496118_0003665 | |||
| 1283 | Ga0496118_0004279 | |||
| 1284 | Ga0496118_0006748 | |||
| 1285 | Ga0496118_0009747 | |||
| 1286 | Ga0496118_0209002 | |||
| 1287 | Ga0496119_0004210 | |||
| 1288 | Ga0496119_0112515 | |||
| 1289 | Ga0496120_0003080 | |||
| 1290 | Ga0496121_0000130 | |||
| 1291 | Ga0496121_0013822 | |||
| 1292 | Ga0496122_0005423 | |||
| 1293 | Ga0496122_0067227 | |||
| 1294 | Ga0496123_0002794 | |||
| 1295 | Ga0496123_0010288 | |||
| 1296 | Ga0496123_0071974 | |||
| 1297 | Ga0496124_0001648 | |||
| 1298 | Ga0496124_0001730 | |||
| 1299 | Ga0496124_0005515 | |||
| 1300 | Ga0496124_0006356 | |||
| 1301 | Ga0496124_0107241 | |||
| 1302 | Ga0496125_0004923 | |||
| 1303 | Ga0496125_0108066 | |||
| 1304 | Ga0496126_0000619 | |||
| 1305 | Ga0495678_009211 | |||
| 1306 | Ga0495678_012517 | |||
| 1307 | Ga0495678_022284 | |||
| 1308 | Ga0495678_038080 | |||
| 1309 | Ga0495678_059421 | |||
| 1310 | Ga0495678_070094 | |||
| 1311 | Ga0495682_0006977 | |||
| 1312 | Ga0495682_0099591 | |||
| 1313 | Ga0501039_0232384 | |||
| 1314 | Ga0501040_0066693 | |||
| 1315 | Ga0501041_0268618 | |||
| 1316 | nmdc:mga03683_3460_c1 | |||
| 1317 | nmdc:mga03683_37_c1 | |||
| 1318 | nmdc:mga00v17_32064_c1 | |||
| 1319 | nmdc:mga0yw44_76997_c1 | |||
| 1320 | nmdc:mga0k408_105697_c1 | |||
| 1321 | nmdc:mga0k408_18_c1 | |||
| 1322 | nmdc:mga0k408_77640_c1 | |||
| 1323 | nmdc:mga07m45_19_c1 | |||
| 1324 | nmdc:mga07m45_81392_c1 | |||
| 1325 | nmdc:mga05p37_1054_c1 | |||
| 1326 | nmdc:mga09592_35606_c1 | |||
| 1327 | nmdc:mga0rr50_1007_c1 | |||
| 1328 | nmdc:mga0sz30_161_c3 | |||
| 1329 | nmdc:mga0sz30_18535_c1 | |||
| 1330 | Ga0500643_013222 | |||
| 1331 | Ga0500643_037122 | |||
| 1332 | Ga0500644_0000272 | |||
| 1333 | Ga0500566_0000708 | |||
| 1334 | Ga0500641_0078494 | |||
| 1335 | Ga0500555_030281 | |||
| 1336 | Ga0500595_005215 | |||
| 1337 | Ga0500595_030671 | |||
| 1338 | Ga0500626_067757 | |||
| 1339 | Ga0500642_0012942 | |||
| 1340 | Ga0500658_0013388 | |||
| 1341 | Ga0500658_0053568 | |||
| 1342 | Ga0500559_0003309 | |||
| 1343 | Ga0500573_0000042 | |||
| 1344 | Ga0500616_0068149 | |||
| 1345 | Ga0500616_0100318 | |||
| 1346 | Ga0530510_0227230 | |||
| 1347 | 2511301488 | |||
| 1348 | 2511358298 | |||
| 1349 | 2585146389 | |||
| 1350 | 2587917548 | |||
| 1351 | 2600224765 | |||
| 1352 | 2643845801 | |||
| 1353 | 2644126494 | |||
| 1354 | 2644226927 | |||
| 1355 | 2644233605 | |||
| 1356 | 2738709878 | |||
| 1357 | 2738848303 | |||
| 1358 | 2738864032 | |||
| 1359 | 2739296550 | |||
| 1360 | 2739358228 | |||
| 1361 | 2812331201 | |||
| 1362 | 2819712958 | |||
| 1363 | 2834645973 | |||
| 1364 | 2860345545 | |||
| 1365 | 2905929834 | |||
| 1366 | 2919460390 | |||
| 1367 | 2928101426 | |||
| 1368 | 2928527496 | |||
| 1369 | 2928960162 | |||
| 1370 | 2928969015 | |||
| 1371 | 2946027314 | |||
| 1372 | 2946787932 | |||
| 1373 | 2990064116 | |||
| 1374 | 3007624728 | |||
| 1375 | 8003402744 | |||
| 1376 | 8056128266 | |||
| 1377 | 8056178243 | |||
| 1378 | 8056182632 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tnx-assembly1.cif.gz_A | crystal structure of alcohol dehydrogenase zinc-binding domain protein from burkholderia ambifaria | 0.9589 | 2 | 359 |
| 5tnx-assembly1.cif.gz_A | crystal structure of alcohol dehydrogenase zinc-binding domain protein from burkholderia ambifaria | 0.9537 | 2 | 359 |
| 4gl4-assembly1.cif.gz_A | crystal structure of oxidized s-nitrosoglutathione reductase from arabidopsis thalina, complex with nadh | 0.947 | 2 | 359 |
| 6cy3-assembly1.cif.gz_A-2 | horse liver e267n alcohol dehydrogenase complex with 3'-dephosphocoenzyme a | 0.9467 | 2 | 358 |
| 8adh-assembly1.cif.gz_A | interdomain motion in liver alcohol dehydrogenase. structural and energetic analysis of the hinge bending mode | 0.9455 | 2 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5tnxA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9672 | 168 | 301 | 3.40.50.720 |
| af_B4G1G0_229_356_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9649 | 175 | 298 | 3.40.50.720 |
| af_A0A0R4IGI3_166_529_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9518 | 177 | 210 | 3.50.50.60 |
| af_A0A1D6JR65_187_347_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9482 | 172 | 301 | 3.40.50.720 |
| af_K7MH10_157_229_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9442 | 168 | 229 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D7BUH6-F1-model_v4 | Alcohol dehydrogenase | 0.9811 | 131 | 285 |
GO:0005829
GO:0008270 GO:0046294 GO:0051903 |
| AF-A0A351XC68-F1-model_v4 | Alcohol dehydrogenase | 0.9808 | 130 | 359 |
GO:0005829
GO:0008270 GO:0046294 GO:0051903 |
| AF-A0A6N8VZV7-F1-model_v4 | Alcohol dehydrogenase catalytic domain-containing protein | 0.9687 | 1 | 93 |
GO:0008270
GO:0016491 |
| AF-A0A126NIH1-F1-model_v4 | Alcohol dehydrogenase-like N-terminal domain-containing protein | 0.967 | 1 | 132 |
GO:0004022
GO:0005737 GO:0008270 |
| AF-A0A6I4PHA8-F1-model_v4 | deleted | 0.966 | 1 | 359 |
|